254780600

254780600

CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase

GeneID in NCBI database:8209597Locus tag:CLIBASIA_02435
Protein GI in NCBI database:254780600Protein Accession:YP_003065013.1
Gene range:-(681399, 682001)Protein Length:200aa
Gene description:CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase
COG prediction:[I] Phosphatidylglycerophosphate synthase
KEGG prediction:pgsA; CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase; K00995 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
SEED prediction:CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)
Pathway involved in KEGG:Glycerophospholipid metabolism [PATH:las00564]
Subsystem involved in SEED:Glycerolipid and Glycerophospholipid Metabolism in Bacteria
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM3 TM-Helix
TOPPRED5 TM-Helix
HMMTOP6 TM-Helix
MEMSAT6 TM-Helix
MEMSAT_SVM6 TM-Helix
PHOBIUS6 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MASRSYNIPNMLTYGRILVVPLIVLCFFIQEIGSFTSPNLMRWIALSLFTIASITDFFDGYLARVWNQTSNIGRMLDPIADKLLISSVLLLMTADGTINRYSIWAAITILCREILVSGLREYLAELKVSVPVTRIARFKTGIQMISIGFLLAGPACENQTSYITGTGIILLWISALLTIYSGYDYFRVGIKHIDSEDKQE
cccccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
cccccccccHHHHHHHHHHHHEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHccccHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccHcHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
masrsynipnmltygRILVVPLIVLCFFIqeigsftspnLMRWIALSLFTIASITDFFDGYLARVWNqtsnigrmLDPIADKLLISSVLLLMTADGTINRYSIWAAITILCREILVSGLREYLAELKVSVPVTRIARFKTGIQMISIGFLlagpacenqtsyiTGTGIILLWISALLTIYSgydyfrvgikhidsedkqe
MASRSYNIPNMLTYGRILVVPLIVLCFFIQEIGSFTSPNLMRWIALSLFTIASITDFFDGYLARVWNQTSNIGRMLDPIADKLLISSVLLLMTADGTINRYSIWAAITILCREILVSGLREYLAELKVSVPVTRIARFKTGIQMISIGFLLAGPACENQTSYITGTGIILLWISALLTIYSGYDYFRVGIKHIDSEDKQE
MASRSYNIPNMLTYGRILVVPLIVLCFFIQEIGSFTSPNLMRWIALSLFTIASITDFFDGYLARVWNQTSNIGRMLDPIADKLLISSVLLLMTADGTINRYSIWAAITILCREILVSGLREYLAELKVSVPVTRIARFKTGIQMISIGFLLAGPACENQTSYITGTGIILLWISALLTIYSGYDYFRVGIKHIDSEDKQE
***RSYNIPNMLTYGRILVVPLIVLCFFIQEIGSFTSPNLMRWIALSLFTIASITDFFDGYLARVWNQTSNIGRMLDPIADKLLISSVLLLMTADGTINRYSIWAAITILCREILVSGLREYLAELKVSVPVTRIARFKTGIQMISIGFLLAGPACENQTSYITGTGIILLWISALLTIYSGYDYFRVGI**********
MASRSYNIPNMLTYGRILVVPLIVLCFFIQEIGSFTSPNLMRWIALSLFTIASITDFFDGYLARVWNQTSNIGRMLDPIADKLLISSVLLLMTADGTINRYSIWAAITILCREILVSGLREYLAELKVSVPVTRIARFKTGIQMISIGFLLAGPACENQTSYITGTGIILLWISALLTIYSGYDYFRVGIKHIDSEDKQE
****SYNIPNMLTYGRILVVPLIVLCFFIQEIGSFTSPNLMRWIALSLFTIASITDFFDGYLARVWNQTSNIGRMLDPIADKLLISSVLLLMTADGTINRYSIWAAITILCREILVSGLREYLAELKVSVPVTRIARFKTGIQMISIGFLLAGPACENQTSYITGTGIILLWISALLTIYSGYDYFRVGIKHIDS*****
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooo
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
iiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASRSYNIPNMLTYGRILVVPLIVLCFFIQEIGSFTSPNLMRWIALSLFTIASITDFFDGYLARVWNQTSNIGRMLDPIADKLLISSVLLLMTADGTINRYSIWAAITILCREILVSGLREYLAELKVSVPVTRIARFKTGIQMISIGFLLAGPACENQTSYITGTGIILLWISALLTIYSGYDYFRVGIKHIDSEDKQE
MASRSYNIPNMLTYGRILVVPLIVLCFFIQEIGSFTSPNLMRWIALSLFTIASITDFFDGYLARVWNQTSNIGRMLDPIADKLLISSVLLLMTADGTINRYSIWAAITILCREILVSGLREYLAELKVSVPVTRIARFKTGIQMISIGFLLAGPACENQTSYITGTGIILLWISALLTIYSGYDYFRVGIKHIDSEDKQE
MASRSYNIPNMLTYGRILVVPLIVLCFFIQEIGSFTSPNLMRWIALSLFTIASITDFFDGYLARVWNQTSNIGRMLDPIADKLLISSVLLLMTADGTINRYSIWAAITILCREILVSGLREYLAELKVSVPVTRIARFKTGIQMISIGFLLAGPACENQTSYITGTGIILLWISALLTIYSGYDYFRVGIKHIDSEDKQE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target200 CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidylt
254780578298 phosphatidylserine synthase [Candidatus Liberibact 0.011
>gi|254780578|ref|YP_003064991.1| phosphatidylserine synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 298 Back     alignment
 Score = 31.2 bits (69), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 10/73 (13%)

Query: 9   PNMLTYGRILVVPLIVLCFFIQEIGSFTSPNLMRWIALSLFTIASITDFFDGYLARVWNQ 68
           PN++T        ++ +C     IGS    N     A+ +  +A+  D  DG +AR    
Sbjct: 58  PNLVT--------ILAICAGFSGIGSAIEGNYE--TAVCMVLVAAFLDGIDGRIARFMEA 107

Query: 69  TSNIGRMLDPIAD 81
           TS  G  LD +AD
Sbjct: 108 TSKFGAQLDSLAD 120

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target200 CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidylt
315121800200 CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidylt 1 2e-94
209548688196 CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidylt 1 4e-77
116251352196 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyl 1 6e-77
218675312196 CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidylt 1 1e-76
15888465195 phosphatidylglycerophosphate synthase [Agrobacterium tu 1 1e-76
190891160196 CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidylt 1 1e-76
325292502195 CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidylt 1 5e-76
222085473195 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyl 1 7e-76
86357116196 CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidylt 1 7e-76
227821492202 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyl 1 5e-74
>gi|315121800|ref|YP_004062289.1| CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 200 Back     alignment and organism information
 Score =  348 bits (893), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 183/200 (91%)

Query: 1   MASRSYNIPNMLTYGRILVVPLIVLCFFIQEIGSFTSPNLMRWIALSLFTIASITDFFDG 60
           MA R YNIPNMLTYGRILVVPLI LCFF++EI    SP+L+RW+AL LF IASITDFFDG
Sbjct: 1   MAYRYYNIPNMLTYGRILVVPLIALCFFVKEIEFLASPHLLRWVALLLFIIASITDFFDG 60

Query: 61  YLARVWNQTSNIGRMLDPIADKLLISSVLLLMTADGTINRYSIWAAITILCREILVSGLR 120
           YLAR+WNQTSNIGRMLDPIADKLLISSVLLLMTADGTINRYS WAAITILCREILVSGLR
Sbjct: 61  YLARIWNQTSNIGRMLDPIADKLLISSVLLLMTADGTINRYSTWAAITILCREILVSGLR 120

Query: 121 EYLAELKVSVPVTRIARFKTGIQMISIGFLLAGPACENQTSYITGTGIILLWISALLTIY 180
           EYLAELKVSVPVTRIARFKT IQMISIGFLLAGP+CE+ T YIT  G ILLWISA+LTIY
Sbjct: 121 EYLAELKVSVPVTRIARFKTTIQMISIGFLLAGPSCEDWTPYITRIGTILLWISAILTIY 180

Query: 181 SGYDYFRVGIKHIDSEDKQE 200
           SG+DYFRVG+KHID ED+Q+
Sbjct: 181 SGHDYFRVGLKHIDLEDQQK 200


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209548688|ref|YP_002280605.1| CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 196 Back     alignment and organism information
>gi|116251352|ref|YP_767190.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 196 Back     alignment and organism information
>gi|218675312|ref|ZP_03524981.1| CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase [Rhizobium etli GR56] Length = 196 Back     alignment and organism information
>gi|15888465|ref|NP_354146.1| phosphatidylglycerophosphate synthase [Agrobacterium tumefaciens str. C58] Length = 195 Back     alignment and organism information
>gi|190891160|ref|YP_001977702.1| CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase [Rhizobium etli CIAT 652] Length = 196 Back     alignment and organism information
>gi|325292502|ref|YP_004278366.1| CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase [Agrobacterium sp. H13-3] Length = 195 Back     alignment and organism information
>gi|222085473|ref|YP_002544003.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [Agrobacterium radiobacter K84] Length = 195 Back     alignment and organism information
>gi|86357116|ref|YP_469008.1| CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase protein [Rhizobium etli CFN 42] Length = 196 Back     alignment and organism information
>gi|227821492|ref|YP_002825462.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [Sinorhizobium fredii NGR234] Length = 202 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target200 CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidylt
TIGR00560182 TIGR00560, pgsA, CDP-diacylglycerol--glycerol-3-phospha 2e-33
PRK10832182 PRK10832, PRK10832, phosphatidylglycerophosphate synthe 5e-28
PLN02558203 PLN02558, PLN02558, CDP-diacylglycerol-glycerol-3-phosp 1e-20
KOG1617243 KOG1617, KOG1617, KOG1617, CDP-alcohol phosphatidyltran 6e-18
COG0558192 COG0558, PgsA, Phosphatidylglycerophosphate synthase [L 4e-27
pfam0106696 pfam01066, CDP-OH_P_transf, CDP-alcohol phosphatidyltra 7e-12
KOG3240218 KOG3240, KOG3240, KOG3240, Phosphatidylinositol synthas 8e-08
PLN02794341 PLN02794, PLN02794, cardiolipin synthase 9e-08
>gnl|CDD|161929 TIGR00560, pgsA, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase Back     alignment and domain information
>gnl|CDD|182763 PRK10832, PRK10832, phosphatidylglycerophosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|166199 PLN02558, PLN02558, CDP-diacylglycerol-glycerol-3-phosphate/ 3-phosphatidyltransferase Back     alignment and domain information
>gnl|CDD|36830 KOG1617, KOG1617, KOG1617, CDP-alcohol phosphatidyltransferase/Phosphatidylglycerol-phosphate synthase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30904 COG0558, PgsA, Phosphatidylglycerophosphate synthase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|144601 pfam01066, CDP-OH_P_transf, CDP-alcohol phosphatidyltransferase Back     alignment and domain information
>gnl|CDD|38450 KOG3240, KOG3240, KOG3240, Phosphatidylinositol synthase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178391 PLN02794, PLN02794, cardiolipin synthase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 200 CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidylt
TIGR00560217 pgsA CDP-diacylglycerol--glycerol-3-phosphate 3-phospha 100.0
PRK10832182 phosphatidylglycerophosphate synthetase; Provisional 100.0
COG0558192 PgsA Phosphatidylglycerophosphate synthase [Lipid metab 100.0
KOG1617243 consensus 100.0
pfam0106696 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase. Al 99.72
COG1183234 PssA Phosphatidylserine synthase [Lipid metabolism] 99.48
COG5050 384 EPT1 sn-1,2-diacylglycerol ethanolamine- and cholinepho 99.03
KOG2877 389 consensus 99.61
KOG3240218 consensus 99.51
PTZ00307 417 ethanolamine phosphotransferase; Provisional 99.46
TIGR00473174 pssA CDP-diacylglycerol--serine O-phosphatidyltransfera 99.06
>TIGR00560 pgsA CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase; InterPro: IPR004570 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (2 Back     alignment and domain information
>PRK10832 phosphatidylglycerophosphate synthetase; Provisional Back     alignment and domain information
>COG0558 PgsA Phosphatidylglycerophosphate synthase [Lipid metabolism] Back     alignment and domain information
>KOG1617 consensus Back     alignment and domain information
>pfam01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase Back     alignment and domain information
>COG1183 PssA Phosphatidylserine synthase [Lipid metabolism] Back     alignment and domain information
>COG5050 EPT1 sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases [Lipid metabolism] Back     alignment and domain information
>KOG2877 consensus Back     alignment and domain information
>KOG3240 consensus Back     alignment and domain information
>PTZ00307 ethanolamine phosphotransferase; Provisional Back     alignment and domain information
>TIGR00473 pssA CDP-diacylglycerol--serine O-phosphatidyltransferase; InterPro: IPR004533 This enzyme, CDP-diacylglycerol--serine O-phosphatidyltransferase, is involved in phospholipid biosynthesis catalyzing the reaction CDP-diacylglycerol + L-serine = CMP + L-1-phosphatidylserine Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00