254780601

254780601

ATP-dependent RNA helicase protein

GeneID in NCBI database:8209598Locus tag:CLIBASIA_02440
Protein GI in NCBI database:254780601Protein Accession:YP_003065014.1
Gene range:+(679565, 681286)Protein Length:573aa
Gene description:ATP-dependent RNA helicase protein
COG prediction:[L] [K] [J] Superfamily II DNA and RNA helicases
KEGG prediction:deaD; ATP-dependent RNA helicase protein; K05592 ATP-dependent RNA helicase DeaD [EC:3.6.4.13]
SEED prediction:ATP-dependent RNA helicase, DEAD/DEAH box family
Pathway involved in KEGG:RNA degradation [PATH:las03018]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570---
MKIFENIPQVIGEALSERGYVNLTSVQEAILNPDLREKDVLVSAQTGSGKTVAFGLALASTLLAENDRFSPASAPLALAIAPTRELAVQVGRELEWLYAKTGVVVAVCIGGVSVHRERRDLQNGAHIVVGTPGRLCDHIRGKGLNISHLKAVVLDEADEMLDLGFRDDIEFILDSSPKKRRMLMFSATISPAITTLAKNYQKDAVRVNIASENRQHSDIDYRAVLVALSDRDNAIVNILRYHGAKNAIVFCSTRASVSRFTKVLAEHLFQVVALSGELSQQERSNALQMMRDGRARVCIATDVAARGIDLPDLELVIHAELSSNPENLLHRSGRTGRAGRKGMSVFVIPQNMQRRAERLFREANVSVVWEPAPSVEAIRERDAQRILQDPLFLDSIQGDEKKMVDVLLAKHDPEKIAAGFLRIHRAGLCAPEEITPVSLVSGRDRFRDDSRAFKVGGGSRDNFKGSSWFSLSVGSKQKAEARWLMPMLCRSSGINRQSIGAIRVQPDLTFVEVSADGVDLLRRTVKLDKGIQLKYLGGEKPDFRGYKSSGFKSKNSQDGATKRFKRFKGASKN
ccccHHccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHcccccccccccEEEEEEcHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHccccEEEEcHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHcccccEEcccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHcccccEEEEcHHHHHccccccccEEEEccccccHHHHHHHHHHHcccccccEEEEEEcHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHccHHccccHHHHHHHHHccccccHHHEEEEEEccccEEEEEcHHHHHHHHHHHHccccccEEEcccccccccccccccccccccccccccccccccccccc
cccHccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHcccHHcccccccccccEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHccccEEEEcHHHHHHHHcccccccccccEEEEccHHHHHccccHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHccccEEEEEEccccccccEEEEEEEEccccHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHHccccHHHccccHcHHHHHHHHHHHHcccccEEEEEcHHHcccccccEEEEEEEccccccHHHEEEcccccccccccEEEEEEcHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccHHHHHHHHHHHcccccccEEEEEEccccEEEEccHHHHHHHHHHHHcccccEEEEcccccccccccccccccccccccccccccccccccccc
MKIFENIPQVIGEALSERGYVNLTSVQEailnpdlrekdvlvsaqtgsgktVAFGLALASTLlaendrfspasaplalaiapTRELAVQVGRELEWLYAKTGVVVAVCIGGVsvhrerrdlqngahivvgtpgrlcdhirgkglnishLKAVVLDEADEMldlgfrddIEFILDSSPKKRRMLMFSATISPAITTLAKNYQKDAVRVNIasenrqhsdidYRAVLVALSDRDNAIVNILRYHGAKNAIVFCSTRASVSRFTKVLAEHLFQVVALSGELSQQERSNALQMMRDGRARVCIATDvaargidlpdlELVIHAElssnpenllhrsgrtgragrkgmsvfVIPQNMQRRAERLFREanvsvvwepapsveaIRERDAQRilqdplfldsiqgDEKKMVDVLLAKHDPEKIAAGFLRIHraglcapeeitpvslvsgrdrfrddsrafkvgggsrdnfkgsswfsLSVGSKQKAEARWLMPMlcrssginrqsigairvqpdltfvEVSADGVDLLRRTVKLDKGIqlkylggekpdfrgykssgfksknsqdgATKRFKRFKGASKN
MKIFENIPQVIGEALSERGYVNLTSVQEAILNPDLREKDVLVSaqtgsgktVAFGLALASTLLAENDRFSPASAPLALAIAPTRELAVQVGRELEWLYAKTGVVVAVCIGGVSvhrerrdlqngahivvgtpgrLCDHIRGKGLNISHLKAVVLDEADEMLDLGFRDDIEFILDSSPKKRRMLMFSATISPAITTLAKNYQKDAVRVNiasenrqhsdidYRAVLVALSDRDNAIVNILRYHGAKNAIVFCSTRASVSRFTKVLAEHLFQVValsgelsqqERSNALQMMRDGRARVCIATDVAARGIDLPDLELVIHAelssnpenllhrsgrtgragrkgmsvfVIPQNMQRRAERLfreanvsvvwepapsveaIRERDAQRILQDPLFLDSIQGDEKKMVDVLLAKHDPEKIAAGFLRIHRAglcapeeitpvslvsgrdrfrDDSRafkvgggsrdnfkgsswfSLSVGSKQKAEARWLMPMLCRSSGINRQSIGAIRVQPDLTFVEVSADGVDLlrrtvkldkgiqlkylggekpdfrgykssgfksknsqdgatkrfkrfkgaskn
MKIFENIPQVIGEALSERGYVNLTSVQEAILNPDLREKDVLVSAQTGSGKTVAFGLALASTLLAENDRFspasaplalaiapTRELAVQVGRELEWLYAKTgvvvavciggvsvHRERRDLQNGAHIVVGTPGRLCDHIRGKGLNISHLKAVVLDEADEMLDLGFRDDIEFILDSSPKKRRMLMFSATISPAITTLAKNYQKDAVRVNIASENRQHSDIDYRAVLVALSDRDNAIVNILRYHGAKNAIVFCSTRASVSRFTKVLAEHLFQVVALSGELSQQERSNALQMMRDGRARVCIATDVAARGIDLPDLELVIHAELSSNPENLLHRSGRTGRAGRKGMSVFVIPQNMQRRAERLFREANVSVVWEPAPSVEAIRERDAQRILQDPLFLDSIQGDEKKMVDVLLAKHDPEKIAAGFLRIHRAGLCAPEEITPVSLVSGRDRFRDDSRAFKVGGGSRDNFKGSSWFSLSVGSKQKAEARWLMPMLCRSSGINRQSIGAIRVQPDLTFVEVSADGVDLLRRTVKLDKGIQLKYLGGEKPDFRGYKSSGFKSKNSQDGATKRFKRFKGASKN
*KIFENIPQVIGEALSERGYVNLTSVQEAILNPDLREKDVLVSAQTGSGKTVAFGLALASTLLAENDRFSPASAPLALAIAPTRELAVQVGRELEWLYAKTGVVVAVCIGGVSVHRERRDLQNGAHIVVGTPGRLCDHIRGKGLNISHLKAVVLDEADEMLDLGFRDDIEFILDSSPKKRRMLMFSATISPAITTLAKNYQKDAVRVNIASENRQHSDIDYRAVLVALSDRDNAIVNILRYHGAKNAIVFCSTRASVSRFTKVLAEHLFQVVALSGELSQQERSNALQMMRDGRARVCIATDVAARGIDLPDLELVIHAELSSNPENLLHRSGRTGRAGRKGMSVFVIPQNMQRRAERLFREANVSVVWEPAPSVEAIRERDAQRILQDPLF**SIQGDEKKMVDVLLAKHDPEKIAAGFLRIHR******************************************WFSLSVGSKQKAEARWLMPMLCRSSGINRQSIGAIRVQPDLTFVEVSADGVDLLRRTVKL**********************************************
MKIFENIPQVIGEALSERGYVNLTSVQEAILNPDLREKDVLVSAQTGSGKTVAFGLALASTLLAENDRFSPASAPLALAIAPTRELAVQVGRELEWLYAKTGVVVAVCIGGVSVHRERRDLQNGAHIVVGTPGRLCDHIRGKGLNISHLKAVVLDEADEMLDLGFRDDIEFILDSSPKKRRMLMFSATISPAITTLAKNYQKDAVRVNIASENRQHSDIDYRAVLVALSDRDNAIVNILRYHGAKNAIVFCSTRASVSRFTKVLAEHLFQVVALSGELSQQERSNALQMMRDGRARVCIATDVAARGIDLPDLELVIHAELSSNPENLLHRSGRTGRAGRKGMSVFVIPQNMQRRAERLFREANVSVVWEPAPSVEAIRERDAQRILQDPLFLDSIQGDEKKMVDVLLAKHDPEKIAAGFLRIHRAGLCAPEEITPVSLVSGRDRFRDDSRAFKVGGGSRDNFKGSSWFSLSVGSKQKAEARWLMPMLCRSSGINRQSIGAIRVQPDLTFVEVSADGVDLLRRTVKLDKGIQLKYLGGEKPDFRGYKSS**********ATKRF*********
***FENIPQVIGEALSERGYVNLTSVQEAILNPDLREKDVLVSAQTGSGKTVAFGLALASTLLAENDRFSPASAPLALAIAPTRELAVQVGRELEWLYAKTGVVVAVCIGGVSVHRERRDLQNGAHIVVGTPGRLCDHIRGKGLNISHLKAVVLDEADEMLDLGFRDDIEFILDSSPKKRRMLMFSATISPAITTLAKNYQKDAVRVNIASENRQHSDIDYRAVLVALSDRDNAIVNILRYHGAKNAIVFCSTRASVSRFTKVLAEHLFQVVALSGELSQQERSNALQMMRDGRARVCIATDVAARGIDLPDLELVIHAELSSNPENLLHRSGRTGRAGRKGMSVFVIPQNMQRRAERLFREANVSVVWEPAPSVEAIRERDAQRILQDPLFLDSIQGDEKKMVDVLLAKHDPEKIAAGFLRIHRAGLCA*********************************KGSSWFSLSVGSKQKAEARWLMPMLCRSSGINRQSIGAIRVQPDLTFVEVSADGVDLLRRTVKLDKGIQLKYLGG***********************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIFENIPQVIGEALSERGYVNLTSVQEAILNPDLREKDVLVSAQTGSGKTVAFGLALASTLLAENDRFSPASAPLALAIAPTRELAVQVGRELEWLYAKTGVVVAVCIGGVSVHRERRDLQNGAHIVVGTPGRLCDHIRGKGLNISHLKAVVLDEADEMLDLGFRDDIEFILDSSPKKRRMLMFSATISPAITTLAKNYQKDAVRVNIASENRQHSDIDYRAVLVALSDRDNAIVNILRYHGAKNAIVFCSTRASVSRFTKVLAEHLFQVVALSGELSQQERSNALQMMRDGRARVCIATDVAARGIDLPDLELVIHAELSSNPENLLHRSGRTGRAGRKGMSVFVIPQNMQRRAERLFREANVSVVWEPAPSVEAIRERDAQRILQDPLFLDSIQGDEKKMVDVLLAKHDPEKIAAGFLRIHRAGLCAPEEITPVSLVSGRDRFRDDSRAFKVGGGSRDNFKGSSWFSLSVGSKQKAEARWLMPMLCRSSGINRQSIGAIRVQPDLTFVEVSADGVDLLRRTVKLDKGIQLKYLGGEKPDFRGYKSSGFKSKNSQDGATKRFKRFKGASKN
MKIFENIPQVIGEALSERGYVNLTSVQEAILNPDLREKDVLVSAQTGSGKTVAFGLALASTLLAENDRFSPASAPLALAIAPTRELAVQVGRELEWLYAKTGVVVAVCIGGVSVHRERRDLQNGAHIVVGTPGRLCDHIRGKGLNISHLKAVVLDEADEMLDLGFRDDIEFILDSSPKKRRMLMFSATISPAITTLAKNYQKDAVRVNIASENRQHSDIDYRAVLVALSDRDNAIVNILRYHGAKNAIVFCSTRASVSRFTKVLAEHLFQVVALSGELSQQERSNALQMMRDGRARVCIATDVAARGIDLPDLELVIHAELSSNPENLLHRSGRTGRAGRKGMSVFVIPQNMQRRAERLFREANVSVVWEPAPSVEAIRERDAQRILQDPLFLDSIQGDEKKMVDVLLAKHDPEKIAAGFLRIHRAGLCAPEEITPVSLVSGRDRFRDDSRAFKVGGGSRDNFKGSSWFSLSVGSKQKAEARWLMPMLCRSSGINRQSIGAIRVQPDLTFVEVSADGVDLLRRTVKLDKGIQLKYLGGEKPDFRGYKSSGFKSKNSQDGATKRFKRFKGASKN
MKIFENIPQVIGEALSERGYVNLTSVQEAILNPDLREKDVLVSAQTGSGKTVAFGLALASTLLAENDRFSPASAPLALAIAPTRELAVQVGRELEWLYAKTGVVVAVCIGGVSVHRERRDLQNGAHIVVGTPGRLCDHIRGKGLNISHLKAVVLDEADEMLDLGFRDDIEFILDSSPKKRRMLMFSATISPAITTLAKNYQKDAVRVNIASENRQHSDIDYRAVLVALSDRDNAIVNILRYHGAKNAIVFCSTRASVSRFTKVLAEHLFQVVALSGELSQQERSNALQMMRDGRARVCIATDVAARGIDLPDLELVIHAELSSNPENLLHRSGRTGRAGRKGMSVFVIPQNMQRRAERLFREANVSVVWEPAPSVEAIRERDAQRILQDPLFLDSIQGDEKKMVDVLLAKHDPEKIAAGFLRIHRAGLCAPEEITPVSLVSGRDRFRDDSRAFKVGGGSRDNFKGSSWFSLSVGSKQKAEARWLMPMLCRSSGINRQSIGAIRVQPDLTFVEVSADGVDLLRRTVKLDKGIQLKYLGGEKPDFRGYKSSGFKSKNSQDGATKRFKRFKGASKN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target573 ATP-dependent RNA helicase protein [Candidatus Liberiba
254780382465 ATP dependent RNA helicase protein [Candidatus Lib 4e-49
254780945700 ATP-dependent DNA helicase RecG [Candidatus Liberi 3e-08
2547809471187 transcription-repair coupling factor [Candidatus L 0.002
>gi|254780382|ref|YP_003064795.1| ATP dependent RNA helicase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 465 Back     alignment
 Score =  187 bits (475), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 110/344 (31%), Positives = 185/344 (53%), Gaps = 7/344 (2%)

Query: 8   PQVIGEALSERGYVNLTSVQEAILNPDLREKDVLVSAQTGSGKTVAFGLALASTLLAEND 67
           P+V+   L + GYV  T +Q   +   L+  DV   AQTG+GKT +F L + + L     
Sbjct: 10  PKVVCAVL-DAGYVKPTPIQIKTIPLVLQRHDVCGIAQTGTGKTASFVLPMLTILEKGRA 68

Query: 68  RFSPASAPLALAIAPTRELAVQVGRELEWLYAKTGVVVAVCIGGVSVHRERRDLQNGAHI 127
           R      P  L + PTRELA QV    E       + VA+ IGG+    + + L+ GA +
Sbjct: 69  R---VRMPRTLILEPTRELAAQVADNFEKYGKNYNLTVALLIGGIPFEAQNKKLERGADV 125

Query: 128 VVGTPGRLCDHIRGKGLNISHLKAVVLDEADEMLDLGFRDDIEFILDSSPKKRRMLMFSA 187
           ++ TPGR+ DH     L +++++ +V+DEAD MLD+GF   I+ I    P  R+ L+FSA
Sbjct: 126 LICTPGRILDHFNRGKLLMNNIEILVIDEADRMLDMGFIPYIQNITSLVPFTRQTLLFSA 185

Query: 188 TISPAITTLAKNYQKDAVRVNIASENRQHSDID--YRAVLVALSDR-DNAIVNILRYHGA 244
           T++  +  +++N+ ++  R+ + + +     I+  + A     S +       +      
Sbjct: 186 TMTDELQKVSENFLQNPKRIEVNTPSSTAETIEHCFVATYAQYSKKCALLQQLLQSQDTM 245

Query: 245 KNAIVFCSTRASVSRFTKVLAEHLFQVVALSGELSQQERSNALQMMRDGRARVCIATDVA 304
           KN I+FC+ + +V      L +  F V A+ G + Q+ R   L   ++G  ++ +A+D+A
Sbjct: 246 KNGIIFCNQKKNVVNLCHSLEKQGFSVCAIHGNIDQRSRMKILSNFKEGTIQLMVASDLA 305

Query: 305 ARGIDLPDLELVIHAELSSNPENLLHRSGRTGRAGRKGMSVFVI 348
           ARG+D+PD+  V + ++ +  EN +HR GRTGRAGR G +  ++
Sbjct: 306 ARGLDIPDVGHVFNFDVPNRAENYIHRIGRTGRAGRHGKAFTLV 349

>gi|254780945|ref|YP_003065358.1| ATP-dependent DNA helicase RecG [Candidatus Liberibacter asiaticus str. psy62] Length = 700 Back     alignment
 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 74/318 (23%), Positives = 130/318 (40%), Gaps = 50/318 (15%)

Query: 41  LVSAQTGSGKTVAFGLALASTLLAENDRFSPASAPLALAIAPTRELAVQVGRELEWLYAK 100
           ++    GSGKT+   +A+A+ + A            A+ +AP   LA Q    ++     
Sbjct: 297 ILQGDVGSGKTLVALIAMAAAVEAGGQ---------AVIMAPIGILAQQHYEFIKKYTQN 347

Query: 101 TGVVVAVCIGGVSVHRERRDLQ----NGAHIVVGTPGRLCDHIRGKGLNISHLKAVVLDE 156
           T ++V +  G +     R+ L+      AHI++GT     D I+   L        +L  
Sbjct: 348 TQIIVEIITGNMPQAHRRKALERIAHGQAHIIIGTHALFQDSIQYYKL--------ILVI 399

Query: 157 ADEMLDLGFRDDIEFILDSSPKKRRMLMFSATISPAITTLAKNYQKDAVRVNIASENRQH 216
            DE    G +  ++  L        +L+ +AT  P    L      D  ++      R+ 
Sbjct: 400 VDEQHRFGVQQRLK--LTQKATAPHVLLMTATPIPRTLVLTSLGDIDISKITEKPAGRK- 456

Query: 217 SDIDYRAVLVALSDRDNAI--VNILRYHGAKNAIVFC---------STRASVSRFTKVLA 265
                + V++ ++  D  I  + ++   G K A   C         + R+ V RF   L 
Sbjct: 457 ---PIKTVIIPINRIDEVIERLKVVLSEG-KKAYWICPQIEEKKESNFRSVVERFNS-LH 511

Query: 266 EHLFQVVAL-SGELSQQERSNALQMMRDGRARVCIATDVAARGIDLPDLELVIHAELSSN 324
           EH    +A+  G +S  ++ + +   ++G  ++ IAT V   GID+ D  ++I      N
Sbjct: 512 EHFTSSIAIIHGRMSDIDKESVMDSFKNGTCKLLIATTVIEVGIDVVDASIII----IEN 567

Query: 325 PENL----LHR-SGRTGR 337
            E+     LH+  GR GR
Sbjct: 568 AEHFGLAQLHQLRGRVGR 585

>gi|254780947|ref|YP_003065360.1| transcription-repair coupling factor [Candidatus Liberibacter asiaticus str. psy62] Length = 1187 Back     alignment
 Score = 35.8 bits (81), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 67/328 (20%), Positives = 133/328 (40%), Gaps = 40/328 (12%)

Query: 36  REKDVLVSAQTGSGKTVAFGLALASTLLAENDRFSPASAPLALAIAPTRELAVQVGRELE 95
           R  D L+    G GKT    +AL +  +A  +    A       IAPT  L  Q  R   
Sbjct: 645 RLMDRLICGDVGFGKT---EIALRAAFIAVMNGLQVA------VIAPTTLLVRQHFRLFS 695

Query: 96  WLYAKTGVVVA-----VCIGGVSVHRERRDLQNGAHIVVGTPGRLCDHIRGKGLNISHLK 150
             +    V +A     V     ++H+ +   +    IV+GT   L        +  ++L 
Sbjct: 696 ERFQGFSVRIASISRFVQTKEAALHK-KSITEGQVDIVIGTHALL-----NPKITFANLG 749

Query: 151 AVVLDEADEMLDLGFRDDIEFILDSSPKKRRMLMFSATISPAITTLAKNYQKDAVRVNIA 210
            +++DE ++   +  ++     L  +     +L  SAT  P    LA    ++   +++ 
Sbjct: 750 LIIIDE-EQHFGVKHKEA----LKETHTGVHVLTLSATPIPRTLQLAITGVRELSLISMP 804

Query: 211 SENRQHSDIDYRAVLVALSDRDNAIV--NILR-YHGAKNAIVFCSTRASVSRFTKVLAEH 267
             NR        A   ++S  D  +V   ++R Y+    +   C   + + +    L   
Sbjct: 805 PINR-------IACRTSISIFDPLVVRETLMREYYRGGQSFYVCPRLSDLEKCYTFLQSE 857

Query: 268 L--FQVVALSGELSQQERSNALQMMRDGRARVCIATDVAARGIDLP--DLELVIHAELSS 323
           +   ++    G++S +   + +    +G+  V ++T +   G+DLP  +  +V  A++  
Sbjct: 858 VPELKIAMAHGQMSPKNLEDKMNAFYEGQYDVLLSTSIVESGLDLPKANTMIVQRADMFG 917

Query: 324 NPENLLHRSGRTGRAGRKGMSVFVIPQN 351
             + L    GR GR+     ++F++P+N
Sbjct: 918 LAQ-LYQLRGRVGRSKIASFALFLLPEN 944

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target573 ATP-dependent RNA helicase protein [Candidatus Liberiba
315121801571 ATP-dependent RNA helicase protein [Candidatus Liberiba 1 0.0
190891857651 ATP-dependent RNA helicase [Rhizobium etli CIAT 652] Le 1 0.0
86357796651 ATP-dependent RNA helicase protein [Rhizobium etli CFN 1 0.0
327190854651 ATP-dependent RNA helicase protein [Rhizobium etli CNPA 1 0.0
332716889615 cold-shock DEAD box protein [Agrobacterium sp. H13-3] L 1 0.0
209549420659 DEAD/DEAH box helicase [Rhizobium leguminosarum bv. tri 1 0.0
15890807615 cold-shock dead-box protein A [Agrobacterium tumefacien 1 0.0
241204745651 DEAD/DEAH box helicase [Rhizobium leguminosarum bv. tri 1 0.0
116252251651 cold-shock DEAD-box protein A (ATP-dependent RNA helica 1 0.0
227820653633 DEAD/DEAH box protein, ATP-dependent RNA helicase [Sino 1 0.0
>gi|315121801|ref|YP_004062290.1| ATP-dependent RNA helicase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 571 Back     alignment and organism information
 Score =  919 bits (2376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/571 (82%), Positives = 526/571 (92%)

Query: 1   MKIFENIPQVIGEALSERGYVNLTSVQEAILNPDLREKDVLVSAQTGSGKTVAFGLALAS 60
           M IFE+IPQVIG+ALSERGYVNLT+VQ+A+L+P+LR+KD+LVSAQTGSGKTVAFGLALAS
Sbjct: 1   MNIFEDIPQVIGDALSERGYVNLTAVQKAVLDPNLRDKDILVSAQTGSGKTVAFGLALAS 60

Query: 61  TLLAENDRFSPASAPLALAIAPTRELAVQVGRELEWLYAKTGVVVAVCIGGVSVHRERRD 120
            LL   DRF PA+APLALAIAPTRELA+QVGRELEWLYAKTGVVV+VCIGGVS+HRERRD
Sbjct: 61  NLLEGKDRFGPAAAPLALAIAPTRELAMQVGRELEWLYAKTGVVVSVCIGGVSLHRERRD 120

Query: 121 LQNGAHIVVGTPGRLCDHIRGKGLNISHLKAVVLDEADEMLDLGFRDDIEFILDSSPKKR 180
           LQNG+HIVVGTPGRLCDHIRGKGLN+SHLKAV+LDEADEMLDLGFRDDIEFILDSSP+KR
Sbjct: 121 LQNGSHIVVGTPGRLCDHIRGKGLNMSHLKAVILDEADEMLDLGFRDDIEFILDSSPEKR 180

Query: 181 RMLMFSATISPAITTLAKNYQKDAVRVNIASENRQHSDIDYRAVLVALSDRDNAIVNILR 240
           RMLMFSATIS AITTLAKNYQKDAVR+NIASENRQHSDIDYRA+LV+LSDRDNAIVN+LR
Sbjct: 181 RMLMFSATISSAITTLAKNYQKDAVRINIASENRQHSDIDYRAILVSLSDRDNAIVNLLR 240

Query: 241 YHGAKNAIVFCSTRASVSRFTKVLAEHLFQVVALSGELSQQERSNALQMMRDGRARVCIA 300
           Y+ AKNAIVFCSTRASVSRFT+VL EHLFQVVALSGELSQQERSNALQMMRDGRARVCIA
Sbjct: 241 YYEAKNAIVFCSTRASVSRFTRVLGEHLFQVVALSGELSQQERSNALQMMRDGRARVCIA 300

Query: 301 TDVAARGIDLPDLELVIHAELSSNPENLLHRSGRTGRAGRKGMSVFVIPQNMQRRAERLF 360
           TDVAARGIDLPDLE+VIHAELSSNPENLLHRSGRTGRAGRKG+SVFV+PQNMQRRAERLF
Sbjct: 301 TDVAARGIDLPDLEIVIHAELSSNPENLLHRSGRTGRAGRKGVSVFVVPQNMQRRAERLF 360

Query: 361 REANVSVVWEPAPSVEAIRERDAQRILQDPLFLDSIQGDEKKMVDVLLAKHDPEKIAAGF 420
           +EANVS  WE APSVEAI ERD+QR+L +PL +D IQGDEKK +  LLAKHDPEKIAA F
Sbjct: 361 KEANVSATWESAPSVEAIMERDSQRMLHNPLLIDPIQGDEKKSIGDLLAKHDPEKIAAAF 420

Query: 421 LRIHRAGLCAPEEITPVSLVSGRDRFRDDSRAFKVGGGSRDNFKGSSWFSLSVGSKQKAE 480
           LR++RAG+C PE+I  VSL +GRDRFRDDSR  + GG SRDNF+ SSWFSLS+GS+QKAE
Sbjct: 421 LRLNRAGMCPPEKIKAVSLSTGRDRFRDDSRDSRFGGASRDNFRNSSWFSLSIGSEQKAE 480

Query: 481 ARWLMPMLCRSSGINRQSIGAIRVQPDLTFVEVSADGVDLLRRTVKLDKGIQLKYLGGEK 540
           ARWL+PMLCR SGI+R SIGAIRV PD TF+E++  GV+ LRR VKLDKGI +KYL GEK
Sbjct: 481 ARWLIPMLCRKSGIDRHSIGAIRVLPDQTFIEIAESGVEFLRRPVKLDKGITIKYLNGEK 540

Query: 541 PDFRGYKSSGFKSKNSQDGATKRFKRFKGAS 571
           PDFRG +SS F+S+++ D   KRFK+FKGAS
Sbjct: 541 PDFRGGRSSSFRSRSNYDNTNKRFKKFKGAS 571


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190891857|ref|YP_001978399.1| ATP-dependent RNA helicase [Rhizobium etli CIAT 652] Length = 651 Back     alignment and organism information
>gi|86357796|ref|YP_469688.1| ATP-dependent RNA helicase protein [Rhizobium etli CFN 42] Length = 651 Back     alignment and organism information
>gi|327190854|gb|EGE57918.1| ATP-dependent RNA helicase protein [Rhizobium etli CNPAF512] Length = 651 Back     alignment and organism information
>gi|332716889|ref|YP_004444355.1| cold-shock DEAD box protein [Agrobacterium sp. H13-3] Length = 615 Back     alignment and organism information
>gi|209549420|ref|YP_002281337.1| DEAD/DEAH box helicase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 659 Back     alignment and organism information
>gi|15890807|ref|NP_356479.1| cold-shock dead-box protein A [Agrobacterium tumefaciens str. C58] Length = 615 Back     alignment and organism information
>gi|241204745|ref|YP_002975841.1| DEAD/DEAH box helicase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 651 Back     alignment and organism information
>gi|116252251|ref|YP_768089.1| cold-shock DEAD-box protein A (ATP-dependent RNA helicase DEAD) [Rhizobium leguminosarum bv. viciae 3841] Length = 651 Back     alignment and organism information
>gi|227820653|ref|YP_002824623.1| DEAD/DEAH box protein, ATP-dependent RNA helicase [Sinorhizobium fredii NGR234] Length = 633 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target573 ATP-dependent RNA helicase protein [Candidatus Liberiba
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Pr 1e-82
KOG0331519 KOG0331, KOG0331, KOG0331, ATP-dependent RNA helicase [ 2e-73
KOG0330476 KOG0330, KOG0330, KOG0330, ATP-dependent RNA helicase [ 5e-66
KOG0342543 KOG0342, KOG0342, KOG0342, ATP-dependent RNA helicase p 2e-59
KOG0328400 KOG0328, KOG0328, KOG0328, Predicted ATP-dependent RNA 2e-58
KOG0345567 KOG0345, KOG0345, KOG0345, ATP-dependent RNA helicase [ 5e-58
KOG0340442 KOG0340, KOG0340, KOG0340, ATP-dependent RNA helicase [ 4e-54
KOG0333673 KOG0333, KOG0333, KOG0333, U5 snRNP-like RNA helicase s 1e-53
KOG0327397 KOG0327, KOG0327, KOG0327, Translation initiation facto 4e-52
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 9e-52
KOG0335482 KOG0335, KOG0335, KOG0335, ATP-dependent RNA helicase [ 1e-51
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Pr 3e-50
KOG0341610 KOG0341, KOG0341, KOG0341, DEAD-box protein abstrakt [R 2e-49
KOG0348708 KOG0348, KOG0348, KOG0348, ATP-dependent RNA helicase [ 9e-49
KOG0343 758 KOG0343, KOG0343, KOG0343, RNA Helicase [RNA processing 1e-48
KOG0339731 KOG0339, KOG0339, KOG0339, ATP-dependent RNA helicase [ 5e-48
KOG0347731 KOG0347, KOG0347, KOG0347, RNA helicase [RNA processing 6e-48
KOG0334997 KOG0334, KOG0334, KOG0334, RNA helicase [RNA processing 3e-47
KOG0336629 KOG0336, KOG0336, KOG0336, ATP-dependent RNA helicase [ 3e-47
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 2e-44
KOG0326459 KOG0326, KOG0326, KOG0326, ATP-dependent RNA helicase [ 2e-41
KOG0350620 KOG0350, KOG0350, KOG0350, DEAD-box ATP-dependent RNA h 4e-40
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase 2e-39
KOG0346569 KOG0346, KOG0346, KOG0346, RNA helicase [RNA processing 4e-34
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function pred 6e-25
COG1205 851 COG1205, COG1205, Distinct helicase family with a uniqu 3e-14
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily II [ 5e-12
TIGR00643630 TIGR00643, recG, ATP-dependent DNA helicase RecG 9e-06
COG1200677 COG1200, RecG, RecG-like helicase [DNA replication, rec 2e-05
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB 3e-05
KOG0951 1674 KOG0951, KOG0951, KOG0951, RNA helicase BRR2, DEAD-box 4e-04
KOG4150 1034 KOG4150, KOG4150, KOG4150, Predicted ATP-dependent RNA 0.002
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Pr 1e-57
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Pr 8e-56
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Pr 2e-54
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Pr 4e-53
KOG0338691 KOG0338, KOG0338, KOG0338, ATP-dependent RNA helicase [ 9e-52
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Pr 1e-44
KOG4284 980 KOG4284, KOG4284, KOG4284, DEAD box protein [Transcript 6e-44
KOG0332477 KOG0332, KOG0332, KOG0332, ATP-dependent RNA helicase [ 2e-43
KOG0337529 KOG0337, KOG0337, KOG0337, ATP-dependent RNA helicase [ 5e-34
KOG0329387 KOG0329, KOG0329, KOG0329, ATP-dependent RNA helicase [ 2e-31
KOG0344593 KOG0344, KOG0344, KOG0344, ATP-dependent RNA helicase [ 8e-28
COG0514590 COG0514, RecQ, Superfamily II DNA helicase [DNA replica 2e-15
COG1204 766 COG1204, COG1204, Superfamily II helicase [General func 3e-11
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ f 6e-10
KOG0351 941 KOG0351, KOG0351, KOG0351, ATP-dependent DNA helicase [ 2e-09
COG1202830 COG1202, COG1202, Superfamily II helicase, archaea-spec 6e-09
COG1203733 COG1203, COG1203, Predicted helicases [General function 3e-08
KOG0353695 KOG0353, KOG0353, KOG0353, ATP-dependent DNA helicase [ 5e-08
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replication, re 1e-06
PRK01172674 PRK01172, PRK01172, ski2-like helicase; Provisional 7e-06
COG4098441 COG4098, comFA, Superfamily II DNA/RNA helicase require 2e-04
PRK09401 1176 PRK09401, PRK09401, reverse gyrase; Reviewed 9e-04
cd00268203 cd00268, DEADc, DEAD-box helicases 1e-51
pfam00270167 pfam00270, DEAD, DEAD/DEAH box helicase 1e-45
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 5e-38
PRK00254 720 PRK00254, PRK00254, ski2-like helicase; Provisional 4e-06
COG4581 1041 COG4581, COG4581, Superfamily II RNA helicase [DNA repl 4e-04
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 2e-27
KOG0349725 KOG0349, KOG0349, KOG0349, Putative DEAD-box RNA helica 5e-27
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal domain 7e-23
KOG0354746 KOG0354, KOG0354, KOG0354, DEAD-box like helicase [Gene 3e-11
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replication, r 1e-08
KOG0352641 KOG0352, KOG0352, KOG0352, ATP-dependent DNA helicase [ 1e-06
PRK13766773 PRK13766, PRK13766, Hef nuclease; Provisional 5e-06
PRK11057607 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Pr 0.004
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-terminal do 1e-17
smart0049082 smart00490, HELICc, helicase superfamily c-terminal dom 2e-17
pfam0388074 pfam03880, DbpA, DbpA RNA binding domain 3e-11
TIGR01389591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 8e-11
KOG1000689 KOG1000, KOG1000, KOG1000, Chromatin remodeling protein 0.003
TIGR01054 1171 TIGR01054, rgy, reverse gyrase 3e-06
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicases [DN 5e-90
>gnl|CDD|183308 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|35552 KOG0331, KOG0331, KOG0331, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35551 KOG0330, KOG0330, KOG0330, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35563 KOG0342, KOG0342, KOG0342, ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35549 KOG0328, KOG0328, KOG0328, Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35566 KOG0345, KOG0345, KOG0345, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35561 KOG0340, KOG0340, KOG0340, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35554 KOG0333, KOG0333, KOG0333, U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35548 KOG0327, KOG0327, KOG0327, Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|35556 KOG0335, KOG0335, KOG0335, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|182572 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|35562 KOG0341, KOG0341, KOG0341, DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35569 KOG0348, KOG0348, KOG0348, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35564 KOG0343, KOG0343, KOG0343, RNA Helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35560 KOG0339, KOG0339, KOG0339, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35568 KOG0347, KOG0347, KOG0347, RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35555 KOG0334, KOG0334, KOG0334, RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35557 KOG0336, KOG0336, KOG0336, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|185453 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|35547 KOG0326, KOG0326, KOG0326, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35571 KOG0350, KOG0350, KOG0350, DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|177796 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|35567 KOG0346, KOG0346, KOG0346, RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|31394 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|31398 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|31261 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|161975 TIGR00643, recG, ATP-dependent DNA helicase RecG Back     alignment and domain information
>gnl|CDD|31393 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>gnl|CDD|162630 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|36169 KOG0951, KOG0951, KOG0951, RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|39353 KOG4150, KOG4150, KOG4150, Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|183247 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|183029 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|179276 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|179884 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|35559 KOG0338, KOG0338, KOG0338, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|179861 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|39485 KOG4284, KOG4284, KOG4284, DEAD box protein [Transcription] Back     alignment and domain information
>gnl|CDD|35553 KOG0332, KOG0332, KOG0332, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35558 KOG0337, KOG0337, KOG0337, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35550 KOG0329, KOG0329, KOG0329, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35565 KOG0344, KOG0344, KOG0344, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|30860 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|31397 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|35572 KOG0351, KOG0351, KOG0351, ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|31395 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|31396 COG1203, COG1203, Predicted helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|35574 KOG0353, KOG0353, KOG0353, ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|31829 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|100801 PRK01172, PRK01172, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|33855 COG4098, comFA, Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|181823 PRK09401, PRK09401, reverse gyrase; Reviewed Back     alignment and domain information
>gnl|CDD|28928 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|144015 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|128763 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|166873 PRK00254, PRK00254, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|34219 COG4581, COG4581, Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|28927 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|35570 KOG0349, KOG0349, KOG0349, Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|28960 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|35575 KOG0354, KOG0354, KOG0354, DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|31308 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|35573 KOG0352, KOG0352, KOG0352, ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|184313 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|144016 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|128766 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|146487 pfam03880, DbpA, DbpA RNA binding domain Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|36218 KOG1000, KOG1000, KOG1000, Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|162177 TIGR01054, rgy, reverse gyrase Back     alignment and domain information
>gnl|CDD|30859 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 573 ATP-dependent RNA helicase protein [Candidatus Liberiba
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK11776459 ATP-dependent RNA helicase DbpA; Provisional 100.0
PTZ00110602 helicase; Provisional 100.0
PRK10590457 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK04537574 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 100.0
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0331519 consensus 100.0
KOG0330476 consensus 100.0
KOG0338691 consensus 100.0
KOG0328400 consensus 100.0
KOG0333673 consensus 100.0
KOG0342543 consensus 100.0
KOG0345567 consensus 100.0
KOG0335482 consensus 100.0
KOG0340442 consensus 100.0
KOG0343 758 consensus 100.0
KOG0336629 consensus 100.0
KOG0347731 consensus 100.0
KOG0334997 consensus 100.0
KOG0327397 consensus 100.0
KOG0326459 consensus 100.0
KOG0339731 consensus 100.0
KOG0348708 consensus 100.0
KOG0341610 consensus 100.0
KOG0346569 consensus 100.0
KOG0332477 consensus 100.0
KOG4284 980 consensus 100.0
KOG0337529 consensus 100.0
KOG0350620 consensus 100.0
KOG0344593 consensus 100.0
KOG0329387 consensus 100.0
KOG0349725 consensus 100.0
PRK13767 878 ATP-dependent helicase; Provisional 100.0
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 100.0
COG1201 814 Lhr Lhr-like helicases [General function prediction onl 100.0
PRK13766764 Hef nuclease; Provisional 100.0
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, reco 100.0
PRK00254 717 ski2-like helicase; Provisional 100.0
PRK02362 736 ski2-like helicase; Provisional 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
COG1205 851 Distinct helicase family with a unique C-terminal domai 100.0
TIGR00614497 recQ_fam ATP-dependent DNA helicase, RecQ family; Inter 100.0
KOG0351 941 consensus 100.0
COG1202830 Superfamily II helicase, archaea-specific [General func 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recombinati 100.0
COG1204 766 Superfamily II helicase [General function prediction on 100.0
KOG0354746 consensus 100.0
PRK10917677 ATP-dependent DNA helicase RecG; Provisional 100.0
TIGR00643721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 99.97
KOG0352641 consensus 99.97
KOG0952 1230 consensus 99.96
COG1200677 RecG RecG-like helicase [DNA replication, recombination 99.96
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 99.95
PRK106891148 transcription-repair coupling factor; Provisional 99.95
KOG0353695 consensus 99.94
COG11971139 Mfd Transcription-repair coupling factor (superfamily I 99.92
KOG0951 1674 consensus 99.92
TIGR00580997 mfd transcription-repair coupling factor; InterPro: IPR 99.92
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanisms] 99.9
COG4581 1041 Superfamily II RNA helicase [DNA replication, recombina 99.88
KOG0950 1008 consensus 99.88
KOG0947 1248 consensus 99.85
COG1198730 PriA Primosomal protein N' (replication factor Y) - sup 99.84
PRK05580699 primosome assembly protein PriA; Validated 99.84
COG4098441 comFA Superfamily II DNA/RNA helicase required for DNA 99.84
PRK09694878 hypothetical protein; Provisional 99.81
KOG0920 924 consensus 99.75
KOG0948 1041 consensus 99.75
PRK09200799 preprotein translocase subunit SecA; Reviewed 99.74
PRK114481126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 99.74
PRK12906823 secA preprotein translocase subunit SecA; Reviewed 99.72
PRK12904833 preprotein translocase subunit SecA; Reviewed 99.71
PRK12898673 secA preprotein translocase subunit SecA; Reviewed 99.7
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 99.68
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.68
PRK12326775 preprotein translocase subunit SecA; Reviewed 99.66
PRK12903 885 secA preprotein translocase subunit SecA; Reviewed 99.65
PRK13107908 preprotein translocase subunit SecA; Reviewed 99.62
KOG2340698 consensus 99.56
KOG0924 1042 consensus 99.54
KOG4150 1034 consensus 99.53
TIGR02621 975 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-sub 99.53
COG4096 875 HsdR Type I site-specific restriction-modification syst 99.49
KOG0385 971 consensus 99.41
KOG09511674 consensus 99.37
KOG0926 1172 consensus 99.37
KOG0925699 consensus 99.35
KOG0384 1373 consensus 99.29
KOG0390776 consensus 99.26
KOG0387923 consensus 99.26
KOG03921549 consensus 99.24
KOG0389941 consensus 99.1
COG4889 1518 Predicted helicase [General function prediction only] 99.09
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, RNA h 98.95
KOG1123776 consensus 98.89
KOG1000689 consensus 98.81
TIGR00963 904 secA preprotein translocase, SecA subunit; InterPro: IP 98.8
TIGR00603756 rad25 DNA repair helicase rad25; InterPro: IPR001161 Xe 98.63
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 100.0
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 100.0
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 100.0
smart00487201 DEXDc DEAD-like helicases superfamily. 99.94
KOG0949 1330 consensus 99.41
pfam04851103 ResIII Type III restriction enzyme, res subunit. 99.06
pfam00176295 SNF2_N SNF2 family N-terminal domain. This domain is fo 98.04
PRK10875607 recD exonuclease V subunit alpha; Provisional 97.88
TIGR01448769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 97.65
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 97.5
COG1444758 Predicted P-loop ATPase fused to an acetyltransferase [ 96.38
PRK10536262 hypothetical protein; Provisional 96.18
PRK08769319 DNA polymerase III subunit delta'; Validated 95.92
PRK13889 992 conjugal transfer relaxase TraA; Provisional 94.61
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 94.24
KOG2543438 consensus 91.33
TIGR01389607 recQ ATP-dependent DNA helicase RecQ; InterPro: IPR0062 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.9
PRK04914 955 ATP-dependent helicase HepA; Validated 99.89
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 99.86
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 99.85
KOG0922674 consensus 99.69
TIGR01967 1320 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IP 99.62
KOG0953700 consensus 99.42
TIGR025621153 cas3_yersinia CRISPR-associated helicase Cas3, Yersinia 98.35
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. subt 99.97
PRK09401 1176 reverse gyrase; Reviewed 99.95
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 99.91
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 99.89
TIGR01587424 cas3_core CRISPR-associated helicase Cas3; InterPro: IP 99.85
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polymerase 99.7
TIGR01970 858 DEAH_box_HrpB ATP-dependent helicase HrpB; InterPro: IP 99.68
KOG0923902 consensus 99.49
TIGR00595524 priA primosomal protein N'; InterPro: IPR005259 All pro 99.36
pfam02399 829 Herpes_ori_bp Origin of replication binding protein. Th 98.08
KOG0921 1282 consensus 97.61
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 99.94
TIGR01447753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 97.83
pfam07652146 Flavi_DEAD Flavivirus DEAD domain. 97.51
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 97.45
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.99
TIGR00348813 hsdR type I site-specific deoxyribonuclease, HsdR famil 96.45
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 96.3
PRK07471363 DNA polymerase III subunit delta'; Validated 96.3
PRK07940395 DNA polymerase III subunit delta'; Validated 96.18
cd03115173 SRP The signal recognition particle (SRP) mediates the 96.18
pfam04466387 Terminase_3 Phage terminase large subunit. Initiation o 96.01
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 95.41
PRK09112352 DNA polymerase III subunit delta'; Validated 94.98
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 94.94
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 94.72
pfam05970418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 94.54
PRK06647560 DNA polymerase III subunits gamma and tau; Validated 92.45
PRK07270557 DNA polymerase III subunits gamma and tau; Validated 92.19
PRK05563541 DNA polymerase III subunits gamma and tau; Validated 91.6
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 91.28
TIGR00678216 holB DNA polymerase III, delta' subunit; InterPro: IPR0 90.39
PRK06090319 DNA polymerase III subunit delta'; Validated 90.28
PRK08058329 DNA polymerase III subunit delta'; Validated 90.28
PRK05896613 DNA polymerase III subunits gamma and tau; Validated 90.04
TIGR00631667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 99.93
cd00079131 HELICc Helicase superfamily c-terminal domain; associat 99.91
PRK05298657 excinuclease ABC subunit B; Provisional 99.89
COG0556663 UvrB Helicase subunit of the DNA excision repair comple 99.85
KOG03861157 consensus 98.25
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family [Tra 98.19
KOG1002791 consensus 97.36
KOG0331519 consensus 95.89
KOG03881185 consensus 95.04
PRK08074932 bifunctional ATP-dependent DNA helicase/DNA polymerase 99.74
smart0049082 HELICc helicase superfamily c-terminal domain. 99.73
pfam0027178 Helicase_C Helicase conserved C-terminal domain. The Pr 99.7
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. 99.55
COG1199654 DinG Rad3-related DNA helicases [Transcription / DNA re 99.46
KOG0391 1958 consensus 97.89
PTZ00110602 helicase; Provisional 96.61
KOG10151567 consensus 96.53
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 96.47
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 96.38
PRK05580 699 primosome assembly protein PriA; Validated 96.31
PRK10917677 ATP-dependent DNA helicase RecG; Provisional 95.94
KOG0701 1606 consensus 95.82
COG1198 730 PriA Primosomal protein N' (replication factor Y) - sup 95.76
TIGR00643721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 95.17
KOG4439901 consensus 94.6
KOG0333673 consensus 94.13
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 92.94
KOG0330476 consensus 91.98
COG1200677 RecG RecG-like helicase [DNA replication, recombination 91.69
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 90.75
pfam06862435 DUF1253 Protein of unknown function (DUF1253). This fam 99.69
CHL00122 891 secA preprotein translocase subunit SecA; Validated 99.69
PRK12902 946 secA preprotein translocase subunit SecA; Reviewed 99.64
PRK12900 983 secA preprotein translocase subunit SecA; Reviewed 99.64
PRK12899 969 secA preprotein translocase subunit SecA; Reviewed 99.57
PRK12901 1111 secA preprotein translocase subunit SecA; Reviewed 99.55
pfam07517381 SecA_DEAD SecA DEAD-like domain. SecA protein binds to 98.85
KOG0391 1958 consensus 97.53
KOG18051100 consensus 97.24
pfam12340229 DUF3638 Protein of unknown function (DUF3638). This dom 96.74
KOG03881185 consensus 96.65
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 95.97
KOG1002791 consensus 95.92
pfam03237380 Terminase_6 Terminase-like family. This family represen 95.85
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 95.31
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 94.85
KOG0243 1041 consensus 94.43
KOG1001674 consensus 94.27
KOG4439901 consensus 93.43
pfam05876552 Terminase_GpA Phage terminase large subunit (GpA). This 93.3
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family [Tra 90.63
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 99.6
TIGR01407 944 dinG_rel DnaQ family exonuclease/DinG family helicase, 99.45
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.59
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.59
KOG1802935 consensus 97.65
KOG1132 945 consensus 97.06
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 96.68
KOG1803649 consensus 96.61
pfam00580494 UvrD-helicase UvrD/REP helicase. The Rep family helicas 96.33
PRK10689 1148 transcription-repair coupling factor; Provisional 96.28
TIGR02785 1295 addA_Gpos recombination helicase AddA; InterPro: IPR014 96.15
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 95.33
pfam10412386 TrwB_AAD_bind Type IV secretion-system coupling protein 94.95
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 94.63
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP binding do 94.57
PRK11054684 helD DNA helicase IV; Provisional 93.6
COG3973747 Superfamily I DNA and RNA helicases [General function p 93.4
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta subuni 92.56
PRK13709 1756 conjugal transfer nickase/helicase TraI; Provisional 92.52
PRK12377248 putative replication protein; Provisional 91.52
COG1484254 DnaC DNA replication protein [DNA replication, recombin 91.09
pfam0388074 DbpA DbpA RNA binding domain. This RNA binding domain i 99.49
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 90.26
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 90.09
KOG0952 1230 consensus 97.9
KOG1133 821 consensus 94.44
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 94.41
smart00382148 AAA ATPases associated with a variety of cellular activ 94.19
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 92.66
COG0630312 VirB11 Type IV secretory pathway, VirB11 components, an 92.21
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 92.05
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 92.03
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 91.96
PRK09183258 transposase/IS protein; Provisional 91.57
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 91.24
PRK06526254 transposase; Provisional 91.06
PRK08181269 transposase; Validated 90.35
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.31
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.19
PRK10590457 ATP-dependent RNA helicase RhlE; Provisional 97.02
PRK11776459 ATP-dependent RNA helicase DbpA; Provisional 97.02
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 96.61
KOG0327397 consensus 91.57
PRK04537574 ATP-dependent RNA helicase RhlB; Provisional 97.13
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 96.92
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 96.88
KOG3089271 consensus 95.91
PRK13894320 conjugal transfer ATPase TrbB; Provisional 94.61
PRK13833323 conjugal transfer protein TrbB; Provisional 94.49
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 93.11
COG0610962 Type I site-specific restriction-modification system, R 96.98
KOG0344593 consensus 96.91
PRK12402337 replication factor C small subunit 2; Reviewed 96.49
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 96.37
PRK04195403 replication factor C large subunit; Provisional 95.35
PRK10436461 hypothetical protein; Provisional 93.42
KOG0991333 consensus 92.77
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 90.26
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 96.79
PRK09401 1176 reverse gyrase; Reviewed 96.7
cd00079131 HELICc Helicase superfamily c-terminal domain; associat 95.58
PRK03321352 putative aminotransferase; Provisional 91.22
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 96.72
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial con 96.56
pfam02534468 TraG TraG/TraD family. These proteins contain a P-loop 96.49
PRK13897628 type IV secretion system component VirD4; Provisional 94.53
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 96.33
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 95.54
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 96.15
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 95.74
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.02
PRK13851343 type IV secretion system protein VirB11; Provisional 94.58
PRK13900332 type IV secretion system ATPase VirB11; Provisional 93.74
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 91.6
COG1875436 NYN ribonuclease and ATPase of PhoH family domains [Gen 95.77
PRK13826 1102 Dtr system oriT relaxase; Provisional 95.47
PRK00440318 rfc replication factor C small subunit; Reviewed 95.44
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; Vali 95.24
COG2109198 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabo 95.14
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intracell 94.96
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 94.27
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/C 93.62
PRK05564313 DNA polymerase III subunit delta'; Validated 92.18
PRK05917290 DNA polymerase III subunit delta'; Validated 92.06
KOG0989346 consensus 91.13
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 90.67
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 94.72
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 94.66
pfam03668284 ATP_bind_2 P-loop ATPase protein family. This family co 92.98
PRK05416292 hypothetical protein; Provisional 92.27
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 94.21
TIGR00614497 recQ_fam ATP-dependent DNA helicase, RecQ family; Inter 91.27
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 90.37
PRK13766764 Hef nuclease; Provisional 93.95
TIGR00580 997 mfd transcription-repair coupling factor; InterPro: IPR 93.95
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 90.54
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0331 consensus Back     alignment and domain information
>KOG0330 consensus Back     alignment and domain information
>KOG0338 consensus Back     alignment and domain information
>KOG0328 consensus Back     alignment and domain information
>KOG0333 consensus Back     alignment and domain information
>KOG0342 consensus Back     alignment and domain information
>KOG0345 consensus Back     alignment and domain information
>KOG0335 consensus Back     alignment and domain information
>KOG0340 consensus Back     alignment and domain information
>KOG0343 consensus Back     alignment and domain information
>KOG0336 consensus Back     alignment and domain information
>KOG0347 consensus Back     alignment and domain information
>KOG0334 consensus Back     alignment and domain information
>KOG0327 consensus Back     alignment and domain information
>KOG0326 consensus Back     alignment and domain information
>KOG0339 consensus Back     alignment and domain information
>KOG0348 consensus Back     alignment and domain information
>KOG0341 consensus Back     alignment and domain information
>KOG0346 consensus Back     alignment and domain information
>KOG0332 consensus Back     alignment and domain information
>KOG4284 consensus Back     alignment and domain information
>KOG0337 consensus Back     alignment and domain information
>KOG0350 consensus Back     alignment and domain information
>KOG0344 consensus Back     alignment and domain information
>KOG0329 consensus Back     alignment and domain information
>KOG0349 consensus Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back