254780607

254780607

hypothetical protein CLIBASIA_02470

GeneID in NCBI database:8209606Locus tag:CLIBASIA_02470
Protein GI in NCBI database:254780607Protein Accession:YP_003065020.1
Gene range:-(669428, 669823)Protein Length:131aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein
SEED prediction:Putative secreted protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFINN
cHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc
ccHHHHHHHHHHHHHcHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccc
MCRKIIFALTIIAIAFQSMALNCNETLMqadmnqctgnSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGsecafaasgaeegtaQSMIYANCLQGhaierneklesyltcpegdllcpfinn
MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLesyltcpegdllcpfinn
MCRKiifaltiiaiafQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFINN
*CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEK**********KSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF***
MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFINN
*CRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFIN*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVxxxxxxxxxxxxxxxxxxxxxLFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFINN
MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFINN
MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPFINN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target131 hypothetical protein CLIBASIA_02470 [Candidatus Liberib
238789061128 hypothetical protein yfred0001_41930 [Yersinia frederik 1 2e-21
123442042129 hypothetical protein YE1744 [Yersinia enterocolitica su 1 5e-21
332162045129 hypothetical protein YE105_C2423 [Yersinia enterocoliti 1 7e-21
238798075128 hypothetical protein ymoll0001_17410 [Yersinia mollaret 1 1e-20
318606086140 putative periplasmic protein [Yersinia enterocolitica s 1 1e-20
261339324131 hypothetical protein ENTCAN_05568 [Enterobacter cancero 1 1e-18
238762255129 hypothetical protein ykris0001_1720 [Yersinia kristense 1 1e-18
204930708131 putative secreted protein [Salmonella enterica subsp. e 1 2e-18
283833727131 putative periplasmic protein [Citrobacter youngae ATCC 1 3e-18
16764480131 periplasmic protein [Salmonella enterica subsp. enteric 1 5e-18
>gi|238789061|ref|ZP_04632850.1| hypothetical protein yfred0001_41930 [Yersinia frederiksenii ATCC 33641] Length = 128 Back     alignment and organism information
 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 71/128 (55%)

Query: 1   MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK 60
           M +KI+    +I    Q++A++C   + Q DMNQC    +     +L  TYK+VL K   
Sbjct: 1   MLKKIMLVSLLIFPVSQALAVDCKNAMTQLDMNQCANADYKKADAELNRTYKEVLAKTPM 60

Query: 61  HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP 120
            QR L + +Q+ W  +R ++C F AS  E G+   MI + CL     ER  +L+SYL CP
Sbjct: 61  VQRALLKSAQLTWIKFRDADCTFQASATEGGSVHPMIISACLTRKTEERIAQLKSYLNCP 120

Query: 121 EGDLLCPF 128
           EGDL CP 
Sbjct: 121 EGDLSCPL 128


Species: Yersinia frederiksenii
Genus: Yersinia
Family: Enterobacteriaceae
Order: Enterobacteriales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|123442042|ref|YP_001006025.1| hypothetical protein YE1744 [Yersinia enterocolitica subsp. enterocolitica 8081] Length = 129 Back     alignment and organism information
>gi|332162045|ref|YP_004298622.1| hypothetical protein YE105_C2423 [Yersinia enterocolitica subsp. palearctica 105.5R(r)] Length = 129 Back     alignment and organism information
>gi|238798075|ref|ZP_04641563.1| hypothetical protein ymoll0001_17410 [Yersinia mollaretii ATCC 43969] Length = 128 Back     alignment and organism information
>gi|318606086|emb|CBY27584.1| putative periplasmic protein [Yersinia enterocolitica subsp. palearctica Y11] Length = 140 Back     alignment and organism information
>gi|261339324|ref|ZP_05967182.1| hypothetical protein ENTCAN_05568 [Enterobacter cancerogenus ATCC 35316] Length = 131 Back     alignment and organism information
>gi|238762255|ref|ZP_04623227.1| hypothetical protein ykris0001_1720 [Yersinia kristensenii ATCC 33638] Length = 129 Back     alignment and organism information
>gi|204930708|ref|ZP_03221581.1| putative secreted protein [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] Length = 131 Back     alignment and organism information
>gi|283833727|ref|ZP_06353468.1| putative periplasmic protein [Citrobacter youngae ATCC 29220] Length = 131 Back     alignment and organism information
>gi|16764480|ref|NP_460095.1| periplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] Length = 131 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target131 hypothetical protein CLIBASIA_02470 [Candidatus Liberib
pfam0700792 pfam07007, DUF1311, Protein of unknown function (DUF131 6e-13
COG3755127 COG3755, COG3755, Uncharacterized protein conserved in 3e-12
>gnl|CDD|148561 pfam07007, DUF1311, Protein of unknown function (DUF1311) Back     alignment and domain information
>gnl|CDD|33550 COG3755, COG3755, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 131 hypothetical protein CLIBASIA_02470 [Candidatus Liberib
COG3755127 Uncharacterized protein conserved in bacteria [Function 99.91
pfam0700792 DUF1311 Protein of unknown function (DUF1311). This fam 99.84
COG4461185 LprI Uncharacterized protein conserved in bacteria, put 99.23
PHA02067 221 hypothetical protein 97.92
>COG3755 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam07007 DUF1311 Protein of unknown function (DUF1311) Back     alignment and domain information
>COG4461 LprI Uncharacterized protein conserved in bacteria, putative lipoprotein [Function unknown] Back     alignment and domain information
>PHA02067 hypothetical protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target131 hypothetical protein CLIBASIA_02470 [Candidatus Liberib
3gi7_A122 Crystal Structure Of A Duf1311 Family Protein (Pp03 5e-06
>gi|226192748|pdb|3GI7|A Chain A, Crystal Structure Of A Duf1311 Family Protein (Pp0307) From Pseudomonas Putida Kt2440 At 1.85 A Resolution Length = 122 Back     alignment and structure
 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/115 (17%), Positives = 44/115 (38%), Gaps = 8/115 (6%)

Query: 20  ALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQREL------FEKSQMAW 73
           +  C+          C   +  + + +L++ Y +++E+      +        E ++  W
Sbjct: 7   STPCDNVETDQQTFACAAFNKQVAERELQSAYDELIERXRDQFGDEAGLXSRIEAAEKVW 66

Query: 74  EIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
              R ++C       + G+ A  + + +C+   + ER E L S L     D   P
Sbjct: 67  SQLRDADCKVETHAEQPGSNAYQIAWNSCIAQRSDERAEYLRS-LGSQNSDEPAP 120


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target131 hypothetical protein CLIBASIA_02470 [Candidatus Liberib
3gi7_A122 Secreted protein of unknown function DUF1311; NP_742474 2e-12
>3gi7_A Secreted protein of unknown function DUF1311; NP_742474.1, structural genomics, joint center for structural genomics, JCSG; 1.85A {Pseudomonas putida KT2440} Length = 122 Back     alignment and structure
 Score = 66.3 bits (161), Expect = 2e-12
 Identities = 21/120 (17%), Positives = 46/120 (38%), Gaps = 8/120 (6%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKH------QRELFEK 68
           A +  +  C+          C   +  + + +L++ Y +++E++              E 
Sbjct: 2   ADEEESTPCDNVETDQQTFACAAFNKQVAERELQSAYDELIERMRDQFGDEAGLMSRIEA 61

Query: 69  SQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
           ++  W   R ++C       + G+ A  + + +C+   + ER E L S L     D   P
Sbjct: 62  AEKVWSQLRDADCKVETHAEQPGSNAYQIAWNSCIAQRSDERAEYLRS-LGSQNSDEPAP 120


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target131 hypothetical protein CLIBASIA_02470 [Candidatus Liberib
3gi7_A122 Secreted protein of unknown function DUF1311; NP_742474 99.89
>3gi7_A Secreted protein of unknown function DUF1311; NP_742474.1, structural genomics, joint center for structural genomics, JCSG; 1.85A {Pseudomonas putida KT2440} Back     alignment and structure
Probab=99.89  E-value=1e-22  Score=153.21  Aligned_cols=112  Identities=17%  Similarity=0.360  Sum_probs=100.6

Q ss_pred             HHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC------CHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             1012202378899899999999999999999999999999732------9356899999999999999997887551246
Q gi|254780607|r   16 FQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV------EKHQRELFEKSQMAWEIYRGSECAFAASGAE   89 (131)
Q Consensus        16 ~~a~a~dC~~a~t~~e~~~C~~~~~~~ad~~Ln~~y~~l~~~l------~~~~~~~L~~sQr~W~~~R~~~C~~~~~~~~   89 (131)
                      ....++||+++.|+.|+++|+..++..+|++||++|+.+++++      +++.++.|+.+|++|++||+++|.+....+.
T Consensus         3 ~~~~~~~C~~~~t~~e~~~C~~~~~~~~d~~Ln~~Y~~~~~~l~~~~~~~~~~~~~L~~aQraW~~~Rd~~C~~~~~~~~   82 (122)
T 3gi7_A            3 DEEESTPCDNVETDQQTFACAAFNKQVAERELQSAYDELIERMRDQFGDEAGLMSRIEAAEKVWSQLRDADCKVETHAEQ   82 (122)
T ss_dssp             ---------CTTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSCTTHHHHHHHHHHHHHHHHHHHHHHHTTTSC
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             65568998888987999999999999999999999999998600223247899999999999999999988778750336


Q ss_pred             CCCH-HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             8835-67999999999999999999997137236758899
Q gi|254780607|r   90 EGTA-QSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF  128 (131)
Q Consensus        90 ~Gs~-~~~~~~~C~~~~t~~R~~eL~~~l~~~eg~~~~~~  128 (131)
                      +||+ +++.+.+|++++|++|+.+|+.+... .+|.++|.
T Consensus        83 ~gs~~~~~~~~~C~~~~t~~R~~~L~~l~~~-~~~~pa~~  121 (122)
T 3gi7_A           83 PGSNAYQIAWNSCIAQRSDERAEYLRSLGSQ-NSDEPAPE  121 (122)
T ss_dssp             TTSHHHHHHHHHHHHHHHHHHHHHHHHHHTC-C-------
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCCCCC
T ss_conf             9976788999999999999999999998752-58999999




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 131 hypothetical protein CLIBASIA_02470 [Candidatus Li
3gi7_A_122 (A:) Secreted protein of unknown function DUF1311; 2e-13
>3gi7_A (A:) Secreted protein of unknown function DUF1311; NP_742474.1, structural genomics, joint center for structural genomics, JCSG; 1.85A {Pseudomonas putida KT2440}Length = 122 Back     alignment and structure
 Score = 69.4 bits (169), Expect = 2e-13
 Identities = 20/120 (16%), Positives = 44/120 (36%), Gaps = 8/120 (6%)

Query: 15  AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVL------EKVEKHQRELFEK 68
           A +  +  C+          C   +  + + +L++ Y +++         E       E 
Sbjct: 2   ADEEESTPCDNVETDQQTFACAAFNKQVAERELQSAYDELIERXRDQFGDEAGLXSRIEA 61

Query: 69  SQMAWEIYRGSECAFAASGAEEGT-AQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCP 127
           ++  W   R ++C       + G+ A  + + +C+   + ER E L S  +    D   P
Sbjct: 62  AEKVWSQLRDADCKVETHAEQPGSNAYQIAWNSCIAQRSDERAEYLRSLGSQ-NSDEPAP 120


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target131 hypothetical protein CLIBASIA_02470 [Candidatus Liberib
3gi7_A_122 Secreted protein of unknown function DUF1311; NP_7 99.92
>3gi7_A (A:) Secreted protein of unknown function DUF1311; NP_742474.1, structural genomics, joint center for structural genomics, JCSG; 1.85A {Pseudomonas putida KT2440} Back     alignment and structure
Probab=99.92  E-value=3.4e-24  Score=162.95  Aligned_cols=113  Identities=18%  Similarity=0.359  Sum_probs=102.9

Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC------CHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             31012202378899899999999999999999999999999732------935689999999999999999788755124
Q gi|254780607|r   15 AFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKV------EKHQRELFEKSQMAWEIYRGSECAFAASGA   88 (131)
Q Consensus        15 s~~a~a~dC~~a~t~~e~~~C~~~~~~~ad~~Ln~~y~~l~~~l------~~~~~~~L~~sQr~W~~~R~~~C~~~~~~~   88 (131)
                      ++.++++||.++.|+.+|++|+...++.+|++||++|+.+++.+      ++..++.|+.+|++|++||+++|.++...+
T Consensus         2 ~a~~~~~dC~~a~s~~e~~~C~~~~~~~~D~~Ln~~Y~~~~~~~~~~~~~~~~~~~~L~~sQraW~~~R~~~c~~~~~~~   81 (122)
T 3gi7_A            2 ADEEESTPCDNVETDQQTFACAAFNKQVAERELQSAYDELIERXRDQFGDEAGLXSRIEAAEKVWSQLRDADCKVETHAE   81 (122)
T ss_dssp             ----------CTTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSCTTHHHHHHHHHHHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             76657899899998499999988999999999999999999872202212488999999999999999998888865022


Q ss_pred             CCCCH-HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             68835-67999999999999999999997137236758899
Q gi|254780607|r   89 EEGTA-QSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF  128 (131)
Q Consensus        89 ~~Gs~-~~~~~~~C~~~~t~~R~~eL~~~l~~~eg~~~~~~  128 (131)
                      .+|++ +++.+.+|+.++|++||.+|+.|+++. |+.+||-
T Consensus        82 ~~gs~~~~~~~~~C~~~~t~~Ri~eL~~~~~~~-~~~~~p~  121 (122)
T 3gi7_A           82 QPGSNAYQIAWNSCIAQRSDERAEYLRSLGSQN-SDEPAPE  121 (122)
T ss_dssp             CTTSHHHHHHHHHHHHHHHHHHHHHHHHHHTCC--------
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCCCCC
T ss_conf             589767889999999999999999999987046-7899999