254780606

254780606

cell division protein

GeneID in NCBI database:8209605Locus tag:CLIBASIA_02465
Protein GI in NCBI database:254780606Protein Accession:YP_003065019.1
Gene range:-(670382, 672616)Protein Length:744aa
Gene description:cell division protein
COG prediction:[D] DNA segregation ATPase FtsK/SpoIIIE and related proteins
KEGG prediction:ftsK; cell division protein; K03466 DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family
SEED prediction:Cell division protein FtsK
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Bacterial Cell Division;
Bacterial RNA-metabolizing Zn-dependent hydrolases;
Bacterial Cytoskeleton
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740----
MKCSKKNNLHWLETPHKQVDLKSFVPPWHEAFLLAPNVRFTRTPENDLNRYRNNSTLQQPKETEHSIGDYLHTKAVTESLKSTSSLVYLKNRFMMNRNSVADQFNSQKTPHKLHLVQKNGSHPDPNMQKETIEPSLDVIEEVNTDTASNVSDQINQNPDTLSWLSDFAFFEGLSTPHSFLSFNDHHQYTPIPIQSAEDLSDHTDLAPHMSTEYLHNKKIRTDSTPTTAGDQQKKSSIDHKPSSSNTMTEHMFQDTSQEIAKGQKQYEQPCSSFLQVQSNVNLQGITHEILEKNAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLSARVAVIPKRNAIGIELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGCPEYLNTVTTDTDTDKDGNNFDSEEKKERSNLYAKAVDLVIDNQRCSTSFIQRRLQIGYNRAALLVERMEQEGLVSEADHVGKRHVFSEKFS
ccccccccccHHccccccccccccccHHHHHHHcccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEcccccccccccccccccccccccccccccccccHHHHHHccccccHHccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccHHHHccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEccEEcccEEEEEEcccccccHHHHHHHHHHHHHHHccccccEEEEccccccEEEcccccccEEEHHHHcccccccccccccEEEEEccccccEEEEEccccccEEEEEcccccHHHHHHHHHHHHHHcccHHHEEEEEEEcccccHHHHcccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccccEEEEEHHHHHHHHHHcHHHHHHHHHHHHHHHHHccEEEEEEEcccccccHHHHHHHHcccEEEEEEccHHHHHHHHccccHHHcccccEEEEEcccccEEEEEEEccccHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccEEEEEccc
cccccccccEEEEcccccccccccccHHHHHHccccccEEccccHHHHHHcccccHccccHHcHHHcccEEEccccccccccccccEHccccccccHHHHHHHccccccccccccccHccccccccHcccccccccccHHHccccccHHHHHHHcccccccccccHHcccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccHHHcccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEccccEEEEEEEEcccccEEHHHHcHHHHHHHHHHHccEEEEEEccccEEEEEccccccEEEEHHHHHccHHccccccccEEEEccccccccEEEEHHcccEEEEEccccccHHHHHHHHHHHHHHHcccccEEEEEEcccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHcHHHHHHHHHcccccccccccccccEEEEEEHHHHHHHHHHcHHHHHHHHHHHHHHHHHccEEEEEccccccEEEEHEEEcccccEEEEEEEcccccHHHccccHHHHHHccccEEEcccccccEEEccccccHHHHHHHHHHHHHcccccHHHHHccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHcHHHHHHHHHHHHHcccEcccccccccEEEEcccc
mkcskknnlhwletphkqvdlksfvppwheafllapnvrftrtpendlnryrnnstlqqpketehsigdylhtKAVTESLKSTSSLVYLKNRfmmnrnsvadqfnsqktphklhlvqkngshpdpnmqketiepslDVIEEVntdtasnvsdqinqnpdtlswlsdfaffeglstphsflsfndhhqytpipiqsaedlsdhtdlaphmsteylhnkkirtdstpttagdqqkkssidhkpsssntmtehmfQDTSQEIAKGqkqyeqpcssflQVQSNVNLQGITHEILEKNAGSLETILEEfgikgeiinvnpgpvvtlyefepapgikssrvIGLADDIARSMSSLSARVAVipkrnaigielpnetrETVYLRQIIESRSFSHSKANLALCLgktisgesviadlanmphilvagttgsgksVAINTMIMSLLYRlrpdecrmimvdpkmlelsvydgiphlltpvvtnpKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERIstmygekpqgcgddmrpmpYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLImatqrpsvdvitgtikanfpirisfqvtskidsrtilgehgaeqllgrgdmlymsgggriqrvhgplvsdIEIEKVVQHLKkqgcpeylntvttdtdtdkdgnnfdseEKKERSNLYAKAVDLVIDNQRCSTSFIQRRLQIGYNRAALLVERMEQeglvseadhvgkrhvfsekfs
mkcskknnlhwletphkqvdlkSFVPPWHEAFLLAPNVrftrtpendlnryrnnstlqqpketehSIGDYLHTKAVTESLKSTSSLVYLKNRFMMNRNSVADQFNSQKTPHKLHLVqkngshpdpnMQKETIEPSLDVIEEVNTDtasnvsdqinQNPDTLSWLSDFAFFEGLSTPHSFLSFNDHHQYTPIPIQSAEDLSDHTDLAPHMSteylhnkkirtdstpttagdqqkkssidhkpsssntMTEHMFQDTSQEIAKGQKQYEQPCSSFLQVQSNVNLQGITHEILEKNAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLsarvavipkrnaigielpnetreTVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHILVAgttgsgksvAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHlltpvvtnpkKAVMALKWAVREMEEryrkmshlsvrnIKSYNERISTmygekpqgcgddMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHlkkqgcpeylntvttdtdtdkdgnnfdseekkersnLYAKAVDLVIDNQRCSTSFIQRRLQIGYNRAALLVERMEQEglvseadhvgkrhvfsekfs
MKCSKKNNLHWLETPHKQVDLKSFVPPWHEAFLLAPNVRFTRTPENDLNRYRNNSTLQQPKETEHSIGDYLHTKAVTESLKSTSSLVYLKNRFMMNRNSVADQFNSQKTPHKLHLVQKNGSHPDPNMQKETIEPSLDVIEEVNTDTASNVSDQINQNPDTLSWLSDFAFFEGLSTPHSFLSFNDHHQYTPIPIQSAEDLSDHTDLAPHMSTEYLHNKKIRTDSTPTTAGDQQKKSSIDHKPSSSNTMTEHMFQDTSQEIAKGQKQYEQPCSSFLQVQSNVNLQGITHEILEKNAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLSARVAVIPKRNAIGIELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGCPEYLntvttdtdtdkdgnnfdSEEKKERSNLYAKAVDLVIDNQRCSTSFIQRRLQIGYNRAALLVERMEQEGLVSEADHVGKRHVFSEKFS
*******************************FLLAPNV***************************************************************************************************************************************************************************************************************************************CSSF*******************NAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLSARVAVIPKRNAIGIELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNER*****************PMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGCPEYLNT*************************YAKAVDLVIDNQRCSTSFIQRRLQIGYNRAALLVERMEQEGL***********VFS****
MKCSKKNNLHWLETPHKQVDLKSFVPPWHEAFLLAPNVRFTRTPENDLNRYRNNSTLQQPKETEHSIGDYLHTKAVTESLKSTSSLVYLKNRFMMNRNSVADQFNSQKTPHKLHLVQKNGSHPDPNMQKETIEPSLDVIEEVNTDTASNVSDQINQNPDTLSWLSDFAFFEGLSTPHSFLSFNDHHQYTPIPIQSAEDLSDHTDLAPHMSTEYLHNKKIRTD************************MTEHMFQDTSQEIAKGQKQYEQPCSSFLQVQSNVNLQGITHEILEKNAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLSARVAVIPKRNAIGIELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGCPEYLNTVTTDTDTDKDGNNFDSEEKKERSNLYAKAVDLVIDNQRCSTSFIQRRLQIGYNRAALLVERMEQEGLVSEADHVGKRHVFSEKFS
**CSKKNNLHWLETPHKQVDLKSFVPPWHEAFLLAPNVRFTRTPENDLNRYRNNSTLQQPKETEHSIGDYLHTKAVTESLKSTSSLVYLKNRFMMNRNSVADQFNSQKTPHKLHLVQKN**************PSLDVIEEVN*************************************************************************************************************************QYEQPCSSFLQVQSNVNLQGITHEILEKNAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLSARVAVIPKRNAIGIELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGCPEYLNTVTT******************RSNLYAKAVDLVIDNQRCSTSFIQRRLQIGYNRAALLVERMEQEGLVSEA*HVGKR********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKCSKKNNLHWLETPHKQVDLKSFVPPWHEAFLLAPNVRFTRTPENDLNRYRNNSTLQQPKETEHSIGDYLHTKAVTESLKSTSSLVYLKNRFMMNRNSVADQFNSQKTPHKLHLVQKNGSHPDPNMQKETIEPSLDVIEEVNTDTASNVSDQINQNPDTLSWLSDFAFFEGLSTPHSFLSFNDHHQYTPIPIQSAEDLSDHTDLAPHMSTEYLHNKKIRTDSTPTTAGDQQKKSSIDHKPSSSNTMTEHMFQDTSQEIAKGQKQYEQPCSSFLQVQSNVNLQGITHEILEKNAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLSARVAVIPKRNAIGIELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGCPEYLNTVTTDTDTDKDGNNFDSEEKKERSNLYAKAVDLVIDNQRCSTSFIQRRLQIGYNRAALLVERMEQEGLVSEADHVGKRHVFSEKFS
MKCSKKNNLHWLETPHKQVDLKSFVPPWHEAFLLAPNVRFTRTPENDLNRYRNNSTLQQPKETEHSIGDYLHTKAVTESLKSTSSLVYLKNRFMMNRNSVADQFNSQKTPHKLHLVQKNGSHPDPNMQKETIEPSLDVIEEVNTDTASNVSDQINQNPDTLSWLSDFAFFEGLSTPHSFLSFNDHHQYTPIPIQSAEDLSDHTDLAPHMSTEYLHNKKIRTDSTPTTAGDQQKKSSIDHKPSSSNTMTEHMFQDTSQEIAKGQKQYEQPCSSFLQVQSNVNLQGITHEILEKNAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLSARVAVIPKRNAIGIELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGCPEYLNTVTTDTDTDKDGNNFDSEEKKERSNLYAKAVDLVIDNQRCSTSFIQRRLQIGYNRAALLVERMEQEGLVSEADHVGKRHVFSEKFS
MKCSKKNNLHWLETPHKQVDLKSFVPPWHEAFLLAPNVRFTRTPENDLNRYRNNSTLQQPKETEHSIGDYLHTKAVTESLKSTSSLVYLKNRFMMNRNSVADQFNSQKTPHKLHLVQKNGSHPDPNMQKETIEPSLDVIEEVNTDTASNVSDQINQNPDTLSWLSDFAFFEGLSTPHSFLSFNDHHQYTPIPIQSAEDLSDHTDLAPHMSTEYLHNKKIRTDSTPTTAGDQQKKSSIDHKPSSSNTMTEHMFQDTSQEIAKGQKQYEQPCSSFLQVQSNVNLQGITHEILEKNAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLSARVAVIPKRNAIGIELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQGCPEYLNTVTTDTDTDKDGNNFDSEEKKERSNLYAKAVDLVIDNQRCSTSFIQRRLQIGYNRAALLVERMEQEGLVSEADHVGKRHVFSEKFS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target744 cell division protein [Candidatus Liberibacter asiaticu
254780799806 DNA translocase FtsK [Candidatus Liberibacter asia 1e-178
>gi|254780799|ref|YP_003065212.1| DNA translocase FtsK [Candidatus Liberibacter asiaticus str. psy62] Length = 806 Back     alignment
 Score =  617 bits (1591), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 312/528 (59%), Positives = 396/528 (75%), Gaps = 30/528 (5%)

Query: 239 HKPSSSNTMTEH-----MFQDTSQE--IAKGQKQYEQPCSSFLQV-QSNVNLQGITHEIL 290
           H     N++TE+     + Q+ SQ   I  G   +  P    L   QS VN    + +++
Sbjct: 273 HDAIDINSITEYQLNADIVQNISQSNLINHGTGTFVLPSKEILSTSQSPVNQMTFSPKVM 332

Query: 291 EKNAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLS 350
           + NA +L+++L +FGI+GEI+NV PGPV+TLYE EPAPGIKSSR+IGL+DDIARSMS++S
Sbjct: 333 QNNACTLKSVLSDFGIQGEIVNVRPGPVITLYELEPAPGIKSSRIIGLSDDIARSMSAIS 392

Query: 351 ARVAVIPKRNAIGIELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLA 410
           ARVAVIP+RNAIGIELPN+ RETV LR +I SR F  ++ +LA+ LGK+I G+ +IADLA
Sbjct: 393 ARVAVIPRRNAIGIELPNDIRETVMLRDLIVSRVFEKNQCDLAINLGKSIEGKPIIADLA 452

Query: 411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPV 470
            MPH+L+AGTTGSGKSVAINTMI+SLLYR+ P +CR+IM+DPKMLELSVYDGIP+LLTPV
Sbjct: 453 RMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLTPV 512

Query: 471 VTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMY--GEK---------PQ 519
           VTNP+KAV  LKW V EMEERY+KMS + VRNI  +N +++  +  G+K          +
Sbjct: 513 VTNPQKAVTVLKWLVCEMEERYQKMSKIGVRNIDGFNLKVAQYHNTGKKFNRTVQTGFDR 572

Query: 520 GCGD--------DMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMAT 571
             G+        D + MPYIV+++DEMADLMMVA K+IE A+QRLAQMARA+GIH+IMAT
Sbjct: 573 KTGEAIYETEHFDFQHMPYIVVVIDEMADLMMVARKDIESAVQRLAQMARASGIHVIMAT 632

Query: 572 QRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGGGRIQRV 631
           QRPSVDVITGTIKANFP RISFQV+SKIDSRTILGE GAEQLLG+GDMLYM+GGGR+QR+
Sbjct: 633 QRPSVDVITGTIKANFPTRISFQVSSKIDSRTILGEQGAEQLLGQGDMLYMTGGGRVQRI 692

Query: 632 HGPLVSDIEIEKVVQHLKKQGCPEYLNTVTTDTDTDKDGNNFDSEEKKERSNLYAKAVDL 691
           HGP VSDIE+EKVV HLK QG  +Y++    D     +   F SE      +LY +AVD+
Sbjct: 693 HGPFVSDIEVEKVVSHLKTQGEAKYID--IKDKILLNEEMRF-SENSSVADDLYKQAVDI 749

Query: 692 VIDNQRCSTSFIQRRLQIGYNRAALLVERMEQEGLVSEADHVGKRHVF 739
           V+ + + S S+IQRRL IGYNRAA ++E ME++G++  A   GKR + 
Sbjct: 750 VLRDNKASISYIQRRLGIGYNRAASIIENMEEKGVIGPASSTGKREIL 797

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target744 cell division protein [Candidatus Liberibacter asiaticu
315121807753 cell division protein [Candidatus Liberibacter solanace 1 0.0
86355812775 cell division protein [Rhizobium etli CFN 42] Length = 1 0.0
260466806861 cell division protein FtsK/SpoIIIE [Mesorhizobium oppor 1 0.0
227820385928 DNA segregation ATPase FtsK/SpoIIIE [Sinorhizobium fred 1 0.0
150376336951 cell divisionFtsK/SpoIIIE [Sinorhizobium medicae WSM419 1 0.0
209551675787 cell divisionFtsK/SpoIIIE [Rhizobium leguminosarum bv. 1 0.0
116249928781 cell division DNA translocase protein [Rhizobium legumi 1 0.0
241207105781 cell divisionFtsK/SpoIIIE [Rhizobium leguminosarum bv. 1 0.0
190889823786 cell division protein [Rhizobium etli CIAT 652] Length 1 0.0
307316754946 cell division protein FtsK/SpoIIIE [Sinorhizobium melil 1 0.0
>gi|315121807|ref|YP_004062296.1| cell division protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 753 Back     alignment and organism information
 Score = 1098 bits (2840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/753 (73%), Positives = 619/753 (82%), Gaps = 11/753 (1%)

Query: 1   MKCSKKNNLHWLETPHKQVDLKSFVPPWHEAFLLAPNVRFTRTPENDLNRYRNNSTLQQP 60
           MKCSKKNN HW    HK VD+K F+PPWHEAFLL PNVRFTRTPEN++N+Y N ST+Q+ 
Sbjct: 1   MKCSKKNNSHWPNISHKHVDIKRFLPPWHEAFLLGPNVRFTRTPENNINQYHNYSTVQKS 60

Query: 61  KETEH-SIGDYLHTKAVTESLKSTSSLVYLKNRFMMNRNSVADQFNSQKTPHKLHLVQKN 119
           K+ EH +I +YL  ++  ESL+STSSLV LK +FMMN++S+ADQF SQKT ++LHLV K+
Sbjct: 61  KKVEHYNISNYLPEQSTKESLQSTSSLVNLKTQFMMNQDSIADQFKSQKTSYELHLVNKD 120

Query: 120 GSHPDPNMQKETIEPSLDVIEEVNTDTASNVSDQINQNPDTLSWLSDFAFFEGLSTPHSF 179
            SH +   QKE ++ S +  E   TDT S+   +++QN  T+SWLSD AFFEG S P   
Sbjct: 121 NSHFEQKTQKEEVQLSSE--ETKITDTVSDTPYKMSQNRGTVSWLSDSAFFEGFSIPIPS 178

Query: 180 LSFNDHHQYTPIPIQSAEDLSDHTDLAPHMST--EYLHNKKIRTDSTPTT----AGDQQK 233
           +  N+  Q+    +Q AE  S +TDL P +    E  ++    T   PTT       ++ 
Sbjct: 179 IPLNNQQQHVSNSLQLAEKSSTNTDLIPQIFRIPENAYDGGNTTTHQPTTPIIRKNPKKF 238

Query: 234 KSSIDHKPS-SSNTMTEHMFQDTSQEIAKGQKQYEQPCSSFLQVQSNVNLQGITHEILEK 292
            ++  H+ S SS  MT  + Q  +Q+I    + YEQPCSSFLQ +SN++ Q  THE LEK
Sbjct: 239 ATNSAHQESLSSEKMTTSITQGNAQKIDAEIQLYEQPCSSFLQEKSNISFQRTTHEYLEK 298

Query: 293 NAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLSAR 352
           NAG LE +LEEFGIKGEI+NVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLSAR
Sbjct: 299 NAGLLENVLEEFGIKGEIVNVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLSAR 358

Query: 353 VAVIPKRNAIGIELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLANM 412
           VAVIPKRNAIGIELPN+ RETVYLRQIIESR+FS+SKA+LALCLGKTI GESVIADLA M
Sbjct: 359 VAVIPKRNAIGIELPNDNRETVYLRQIIESRAFSYSKADLALCLGKTIGGESVIADLAKM 418

Query: 413 PHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVT 472
           PHILVAGTTGSGKSVAINTMIMSLLYRL PDECRMIMVDPKMLELSVYDGIPHLLTPVVT
Sbjct: 419 PHILVAGTTGSGKSVAINTMIMSLLYRLHPDECRMIMVDPKMLELSVYDGIPHLLTPVVT 478

Query: 473 NPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGC-GDDMRPMPYI 531
           +PKKAVMALKWAVREMEERYRKMS LSVRNIKSYNERI  M  +K + C  DDMRPMPYI
Sbjct: 479 DPKKAVMALKWAVREMEERYRKMSQLSVRNIKSYNERIIAMDKQKSEECPNDDMRPMPYI 538

Query: 532 VIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRI 591
           VIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRI
Sbjct: 539 VIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRI 598

Query: 592 SFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGGGRIQRVHGPLVSDIEIEKVVQHLKKQ 651
           SFQVTSKIDSRTILGEHGAEQLLG+GDMLYMSGGGR+QRVHGPLVS+IEIEKVVQHLKKQ
Sbjct: 599 SFQVTSKIDSRTILGEHGAEQLLGQGDMLYMSGGGRVQRVHGPLVSEIEIEKVVQHLKKQ 658

Query: 652 GCPEYLNTVTTDTDTDKDGNNFDSEEKKERSNLYAKAVDLVIDNQRCSTSFIQRRLQIGY 711
           GCPEYLNTVTTD   D      +SE KKER NLY KA DLVI+NQRCSTSFIQRRLQIGY
Sbjct: 659 GCPEYLNTVTTDNSKDSTNIERESEAKKERYNLYEKATDLVINNQRCSTSFIQRRLQIGY 718

Query: 712 NRAALLVERMEQEGLVSEADHVGKRHVFSEKFS 744
           NRAALLVERMEQEGLVS+ADHVGKRHVF++K S
Sbjct: 719 NRAALLVERMEQEGLVSKADHVGKRHVFAQKSS 751


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86355812|ref|YP_467704.1| cell division protein [Rhizobium etli CFN 42] Length = 775 Back     alignment and organism information
>gi|260466806|ref|ZP_05812991.1| cell division protein FtsK/SpoIIIE [Mesorhizobium opportunistum WSM2075] Length = 861 Back     alignment and organism information
>gi|227820385|ref|YP_002824356.1| DNA segregation ATPase FtsK/SpoIIIE [Sinorhizobium fredii NGR234] Length = 928 Back     alignment and organism information
>gi|150376336|ref|YP_001312932.1| cell divisionFtsK/SpoIIIE [Sinorhizobium medicae WSM419] Length = 951 Back     alignment and organism information
>gi|209551675|ref|YP_002283592.1| cell divisionFtsK/SpoIIIE [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 787 Back     alignment and organism information
>gi|116249928|ref|YP_765766.1| cell division DNA translocase protein [Rhizobium leguminosarum bv. viciae 3841] Length = 781 Back     alignment and organism information
>gi|241207105|ref|YP_002978201.1| cell divisionFtsK/SpoIIIE [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 781 Back     alignment and organism information
>gi|190889823|ref|YP_001976365.1| cell division protein [Rhizobium etli CIAT 652] Length = 786 Back     alignment and organism information
>gi|307316754|ref|ZP_07596196.1| cell division protein FtsK/SpoIIIE [Sinorhizobium meliloti AK83] Length = 946 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target744 cell division protein [Candidatus Liberibacter asiaticu
PRK102631355 PRK10263, PRK10263, DNA translocase FtsK; Provisional 1e-139
COG1674858 COG1674, FtsK, DNA segregation ATPase FtsK/SpoIIIE and 1e-134
pfam01580202 pfam01580, FtsK_SpoIIIE, FtsK/SpoIIIE family 7e-61
pfam0939767 pfam09397, Ftsk_gamma, Ftsk gamma domain 2e-20
smart0084363 smart00843, Ftsk_gamma, This domain directs oriented DN 3e-20
COG1674 858 COG1674, FtsK, DNA segregation ATPase FtsK/SpoIIIE and 2e-08
pfam10412386 pfam10412, TrwB_AAD_bind, Type IV secretion-system coup 2e-04
cd01127410 cd01127, TrwB, Bacterial conjugation protein TrwB, ATP 0.002
TIGR03744893 TIGR03744, traC_PFL_4706, conjugative transfer ATPase, 0.004
smart00382148 smart00382, AAA, ATPases associated with a variety of c 6e-04
>gnl|CDD|182344 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|31860 COG1674, FtsK, DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|144975 pfam01580, FtsK_SpoIIIE, FtsK/SpoIIIE family Back     alignment and domain information
>gnl|CDD|150161 pfam09397, Ftsk_gamma, Ftsk gamma domain Back     alignment and domain information
>gnl|CDD|129076 smart00843, Ftsk_gamma, This domain directs oriented DNA translocation and forms a winged helix structure Back     alignment and domain information
>gnl|CDD|31860 COG1674, FtsK, DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|150993 pfam10412, TrwB_AAD_bind, Type IV secretion-system coupling protein DNA-binding domain Back     alignment and domain information
>gnl|CDD|29993 cd01127, TrwB, Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>gnl|CDD|163456 TIGR03744, traC_PFL_4706, conjugative transfer ATPase, PFL_4706 family Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 744 cell division protein [Candidatus Liberibacter asiaticu
PRK102631355 DNA translocase FtsK; Provisional 100.0
COG1674858 FtsK DNA segregation ATPase FtsK/SpoIIIE and related pr 100.0
pfam01580202 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive se 100.0
COG2401593 ABC-type ATPase fused to a predicted acetyltransferase 98.23
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes. Th 97.31
PHA00520326 packaging NTPase P4 96.48
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 96.48
KOG0060659 consensus 96.25
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 96.17
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 96.08
PRK10789569 putative multidrug transporter membrane\ATP-binding com 95.97
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 95.48
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 95.3
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-binding 93.65
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein; Int 93.59
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 93.42
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 92.29
COG4178604 ABC-type uncharacterized transport system, permease and 92.24
KOG0064728 consensus 91.8
smart0084363 Ftsk_gamma This domain directs oriented DNA translocati 99.89
pfam0939767 Ftsk_gamma Ftsk gamma domain. This domain directs orien 99.89
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 95.14
pfam10443428 RNA12 RNA12 protein. This family includes RNA12 from S. 92.69
COG1674 858 FtsK DNA segregation ATPase FtsK/SpoIIIE and related pr 99.61
COG2805353 PilT Tfp pilus assembly protein, pilus retraction ATPas 97.67
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 97.4
KOG0926 1172 consensus 97.13
PRK00440318 rfc replication factor C small subunit; Reviewed 96.64
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.41
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.07
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 95.94
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 95.73
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.71
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 95.66
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 95.51
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 95.5
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.46
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.45
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.41
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.09
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.05
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.99
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.95
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.93
TIGR012711534 CFTR_protein cystic fibrosis transmembrane conductor re 94.89
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.79
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 94.74
PRK11607377 potG putrescine transporter ATP-binding subunit; Provis 94.7
COG1158422 Rho Transcription termination factor [Transcription] 94.59
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.57
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.44
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.32
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.22
PRK11153343 metN DL-methionine transporter ATP-binding subunit; Pro 93.9
PRK06871324 DNA polymerase III subunit delta'; Validated 93.71
KOG0345 567 consensus 93.38
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.32
TIGR02142361 modC_ABC molybdate ABC transporter, ATP-binding protein 93.29
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 92.83
COG0714329 MoxR-like ATPases [General function prediction only] 92.7
PRK07429331 phosphoribulokinase; Provisional 92.08
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 91.72
PRK09376416 rho transcription termination factor Rho; Provisional 90.98
PRK13873815 conjugal transfer ATPase TrbE; Provisional 99.33
PRK13891852 conjugal transfer protein TrbE; Provisional 99.24
PRK03992390 proteasome-activating nucleotidase; Provisional 96.19
PRK13830818 conjugal transfer protein TrbE; Provisional 99.26
PRK13853789 type IV secretion system protein VirB4; Provisional 99.15
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 95.85
KOG0924 1042 consensus 95.59
pfam05872504 DUF853 Bacterial protein of unknown function (DUF853). 99.07
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP binding do 98.94
PRK13721864 conjugal transfer ATP-binding protein TraC; Provisional 98.4
TIGR02746900 TraC-F-type type-IV secretion system protein TraC; Inte 96.81
pfam07693301 KAP_NTPase KAP family P-loop domain. The KAP (after Kid 96.04
PRK13850670 type IV secretion system protein VirD4; Provisional 91.44
PRK13898800 type IV secretion system ATPase VirB4; Provisional 99.06
COG3451796 VirB4 Type IV secretory pathway, VirB4 components [Intr 98.88
TIGR00929931 VirB4_CagE type IV secretion/conjugal transfer ATPase, 98.02
smart00382148 AAA ATPases associated with a variety of cellular activ 97.83
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 97.54
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 97.54
pfam04665241 Pox_A32 Poxvirus A32 protein. The A32 protein is though 97.44
KOG2035351 consensus 97.02
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 96.93
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 96.92
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS prot 96.84
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 96.67
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 96.46
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS prot 96.35
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 96.3
PRK09112352 DNA polymerase III subunit delta'; Validated 96.27
COG3839338 MalK ABC-type sugar transport systems, ATPase component 96.16
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 96.13
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 96.13
COG3840231 ThiQ ABC-type thiamine transport system, ATPase compone 96.12
PRK09452378 potA putrescine/spermidine ABC transporter ATPase prote 96.07
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 96.04
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 95.95
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 95.78
PRK11650358 ugpC glycerol-3-phosphate transporter ATP-binding subun 95.57
PRK06305 462 DNA polymerase III subunits gamma and tau; Validated 95.57
KOG1514767 consensus 95.41
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 95.23
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 95.21
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 95.19
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 94.98
PRK05707328 DNA polymerase III subunit delta'; Validated 94.65
PRK08058329 DNA polymerase III subunit delta'; Validated 94.45
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 94.43
PRK07399314 DNA polymerase III subunit delta'; Validated 94.26
PRK00409 780 recombination and DNA strand exchange inhibitor protein 93.88
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transport s 93.75
PRK05564313 DNA polymerase III subunit delta'; Validated 92.92
pfam10412386 TrwB_AAD_bind Type IV secretion-system coupling protein 98.77
PRK13700732 conjugal transfer protein TraD; Provisional 97.84
COG0433520 HerA helicase [Replication, recombination, and repair] 97.43
PRK12402337 replication factor C small subunit 2; Reviewed 97.31
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial con 97.16
pfam02534468 TraG TraG/TraD family. These proteins contain a P-loop 96.9
KOG0922 674 consensus 96.68
pfam05707183 Zot Zonular occludens toxin (Zot). This family consists 96.58
pfam00004131 AAA ATPase family associated with various cellular acti 96.29
PRK13897628 type IV secretion system component VirD4; Provisional 96.03
PRK13407334 bchI magnesium chelatase subunit I; Provisional 95.95
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 95.76
PRK13342 417 recombination factor protein RarA; Reviewed 94.88
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] 94.71
pfam07088 484 GvpD GvpD gas vesicle protein. This family consists of 94.44
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 94.25
KOG0733 802 consensus 93.37
PRK07471363 DNA polymerase III subunit delta'; Validated 93.08
PRK05642234 DNA replication initiation factor; Validated 92.89
PRK01172 674 ski2-like helicase; Provisional 92.5
KOG0952 1230 consensus 92.27
PHA00350402 putative assembly protein 91.99
pfam09140261 MipZ ATPase MipZ. MipZ is an ATPase that forms a comple 91.37
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 90.17
pfam01935218 DUF87 Domain of unknown function DUF87. The function of 98.01
TIGR02759613 TraD_Ftype type IV conjugative transfer system coupling 97.8
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 97.59
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 97.58
PRK13851343 type IV secretion system protein VirB11; Provisional 97.06
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 96.94
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 96.79
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 96.61
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 96.51
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 96.42
smart00487201 DEXDc DEAD-like helicases superfamily. 96.39
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 96.38
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 96.36
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 96.28
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 96.28
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 96.16
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 96.1
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 96.06
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 96.05
COG0419 908 SbcC ATPase involved in DNA repair [DNA replication, re 95.99
PRK10744257 phosphate transporter subunit; Provisional 95.93
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 95.82
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 95.8
pfam00735280 Septin Septin. Members of this family include CDC3, CDC 95.79
PTZ00301210 uridine kinase; Provisional 95.76
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 95.75
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 95.74
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 95.73
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 95.73
cd01394218 radB RadB. The archaeal protein radB shares similarity 95.71
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 95.68
cd01124187 KaiC KaiC is a circadian clock protein primarily found 95.67
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial con 95.62
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved family o 95.58
pfam02456370 Adeno_IVa2 Adenovirus IVa2 protein. IVa2 protein can in 95.54
TIGR02525374 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IP 95.53
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 95.52
COG0433520 HerA helicase [Replication, recombination, and repair] 95.49
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 95.47
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 95.45
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 95.44
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 95.33
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase famil 95.33
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 95.31
cd01128249 rho_factor Transcription termination factor rho is a ba 95.28
PRK10261623 glutathione transporter ATP-binding protein; Provisiona 95.28
PRK10790593 putative multidrug transporter membrane\ATP-binding com 95.27
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 95.2
KOG0735 952 consensus 95.19
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 95.16
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 95.14
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.13
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 95.13
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 95.08
PRK06526254 transposase; Provisional 95.08
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 95.06
PRK13542224 consensus 95.01
PRK06067241 flagellar accessory protein FlaH; Validated 95.01
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 94.99
TIGR00618 1063 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins 94.97
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 94.95
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 94.92
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 94.91
COG3596296 Predicted GTPase [General function prediction only] 94.88
PRK08233182 hypothetical protein; Provisional 94.88
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 94.87
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 94.85
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 94.81
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes ar 94.61
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 94.59
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 94.56
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 94.5
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 94.27
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 94.25
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 94.24
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 94.18
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 94.16
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 94.15
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 94.1
KOG1384348 consensus 94.09
TIGR01073 811 pcrA ATP-dependent DNA helicase PcrA; InterPro: IPR0057 94.08
PRK06893229 DNA replication initiation factor; Validated 94.07
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 94.05
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 94.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 93.97
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 93.94
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 93.94
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 93.93
PRK12608379 transcription termination factor Rho; Provisional 93.79
COG0630312 VirB11 Type IV secretory pathway, VirB11 components, an 93.75
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 93.71
PRK10938 490 putative molybdenum transport ATP-binding protein ModF; 93.7
PRK09700510 D-allose transporter ATP-binding protein; Provisional 93.59
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 93.5
PRK03918 882 chromosome segregation protein; Provisional 93.49
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 93.48
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.45
PTZ00209 693 retrotransposon hot spot protein; Provisional 93.35
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 93.32
PRK13768253 GTPase; Provisional 93.31
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 93.29
pfam05049375 IIGP Interferon-inducible GTPase (IIGP). Interferon-ind 93.28
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 93.26
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 93.24
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 93.22
PRK09183258 transposase/IS protein; Provisional 93.2
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 93.19
COG4615546 PvdE ABC-type siderophore export system, fused ATPase a 93.09
PTZ00243 1560 ABC transporter; Provisional 93.03
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 93.0
KOG0991333 consensus 92.94
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 92.94
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 92.91
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 92.9
PRK10865 857 protein disaggregation chaperone; Provisional 92.88
PRK09270230 frcK putative fructose transport system kinase; Reviewe 92.83
PRK07667190 uridine kinase; Provisional 92.72
KOG2655366 consensus 92.67
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 92.48
cd03114148 ArgK-like The function of this protein family is unkown 92.41
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 92.37
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 92.35
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 92.33
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 92.32
PRK11784333 tRNA 2-selenouridine synthase; Provisional 92.31
COG5019373 CDC3 Septin family protein [Cell division and chromosom 92.3
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 92.29
PRK09435325 arginine/ornithine transport system ATPase; Provisional 92.12
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 92.06
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 92.06
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involved in 92.05
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 92.04
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, reco 91.99
COG4987573 CydC ABC-type transport system involved in cytochrome b 91.94
KOG0054 1381 consensus 91.94
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 91.91
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The Esch 91.9
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 91.89
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 91.89
PRK10522547 multidrug transporter membrane component/ATP-binding co 91.77
PRK05917290 DNA polymerase III subunit delta'; Validated 91.74
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 91.74
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 91.67
PRK07773 868 replicative DNA helicase; Validated 91.62
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme in 91.62
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 91.62
pfam03266168 DUF265 Protein of unknown function, DUF265. 91.56
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 91.54
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 91.53
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 91.22
PRK02224 880 chromosome segregation protein; Provisional 91.16
COG4988559 CydD ABC-type transport system involved in cytochrome b 91.12
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 91.1
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 91.09
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 91.07
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 91.05
COG4525259 TauB ABC-type taurine transport system, ATPase componen 91.03
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. This m 91.02
COG4598256 HisP ABC-type histidine transport system, ATPase compon 90.91
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 90.9
PRK09536409 btuD corrinoid ABC transporter ATPase; Reviewed 90.79
TIGR01967 1320 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IP 90.75
PRK10636638 putative ABC transporter ATP-binding protein; Provision 90.73
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-b 90.71
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 90.69
pfam04851103 ResIII Type III restriction enzyme, res subunit. 90.65
COG4928 646 Predicted P-loop ATPase [General function prediction on 90.57
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 90.52
PRK08533230 flagellar accessory protein FlaH; Reviewed 90.35
PRK12678667 transcription termination factor Rho; Provisional 90.33
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 90.22
pfam00350168 Dynamin_N Dynamin family. 90.14
COG3638258 ABC-type phosphate/phosphonate transport system, ATPase 90.13
COG1855604 ATPase (PilT family) [General function prediction only] 90.12
PRK13764605 ATPase; Provisional 90.11
PRK11147632 ABC transporter ATPase component; Reviewed 90.06
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 90.02
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 90.01
PRK13900332 type IV secretion system ATPase VirB11; Provisional 97.97
PRK00411394 cdc6 cell division control protein 6; Reviewed 97.92
pfam05621302 TniB Bacterial TniB protein. This family consists of se 97.14
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 96.61
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 97.86
TIGR01448769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 91.02
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 97.85
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 97.84
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA mismat 97.69
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 97.65
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 97.5
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS family 97.26
COG1205 851 Distinct helicase family with a unique C-terminal domai 97.24
PRK04328250 hypothetical protein; Provisional 97.17
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS prot 97.16
pfam00488234 MutS_V MutS domain V. This domain is found in proteins 97.1
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS prot 97.04
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 96.92
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS prot 96.92
PRK08694468 consensus 96.8
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The MutS 96.76
PRK09165484 replicative DNA helicase; Provisional 96.73
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 96.71
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell moti 96.69
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS protein 96.68
PRK05595444 replicative DNA helicase; Provisional 96.66
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 96.65
PRK05636507 replicative DNA helicase; Provisional 96.63
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 96.61
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 96.56
PRK08082453 consensus 96.51
PRK06321472 replicative DNA helicase; Provisional 96.5
PRK07004460 replicative DNA helicase; Provisional 96.49
PRK08760476 replicative DNA helicase; Provisional 96.46
PRK07263453 consensus 96.39
PRK06749428 replicative DNA helicase; Provisional 96.38
PRK05748448 replicative DNA helicase; Provisional 96.37
PRK10875 607 recD exonuclease V subunit alpha; Provisional 96.34
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 96.29
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 96.15
PRK08840464 replicative DNA helicase; Provisional 96.06
PRK10908222 cell division protein FtsE; Provisional 95.99
COG4618580 ArpD ABC-type protease/lipase transport system, ATPase 95.93
PRK08506473 replicative DNA helicase; Provisional 95.91
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 95.89
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.69
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 95.69
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 95.59
PRK08006471 replicative DNA helicase; Provisional 95.57
COG1198 730 PriA Primosomal protein N' (replication factor Y) - sup 95.54
PRK09984262 phosphonate/organophosphate ester transporter subunit; 95.46
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 95.45
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 95.3
PRK06904472 replicative DNA helicase; Validated 95.29
cd03246173 ABCC_Protease_Secretion This family represents the ABC 95.23
PRK11000369 maltose/maltodextrin transporter ATP-binding protein; P 95.12
COG4148352 ModC ABC-type molybdate transport system, ATPase compon 95.05
COG4167267 SapF ABC-type antimicrobial peptide transport system, A 95.04
COG3842352 PotA ABC-type spermidine/putrescine transport systems, 95.04
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 95.02
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 95.0
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 94.94
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 94.69
pfam00308219 Bac_DnaA Bacterial dnaA protein. 94.63
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 94.56
PRK10851352 sulfate/thiosulfate transporter subunit; Provisional 94.3
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 94.17
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 94.02
COG3598402 RepA RecA-family ATPase [DNA replication, recombination 93.97
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 93.97
PRK11144352 modC molybdate transporter ATP-binding protein; Provisi 93.68
pfam02572172 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/C 93.65
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 93.55
PRK09302501 circadian clock protein KaiC; Reviewed 93.18
COG1125309 OpuBA ABC-type proline/glycine betaine transport system 93.01
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 92.85
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 91.96
pfam03354 473 Terminase_1 Phage Terminase. The majority of the member 91.73
TIGR01166190 cbiO cobalt ABC transporter, ATP-binding protein; Inter 91.65
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 91.5
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/C 91.22
PRK05986190 cob(I)yrinic acid a,c-diamide adenosyltransferase; Vali 91.14
PTZ00112650 origin recognition complex 1 protein; Provisional 91.08
COG4619223 ABC-type uncharacterized transport system, ATPase compo 90.17
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 97.53
PRK13894320 conjugal transfer ATPase TrbB; Provisional 97.4
PRK10436461 hypothetical protein; Provisional 97.08
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intracell 96.57
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB; Inte 94.82
PRK13833323 conjugal transfer protein TrbB; Provisional 97.44
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 93.84
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 90.6
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 97.4
TIGR01074 677 rep ATP-dependent DNA helicase Rep; InterPro: IPR005752 93.56
pfam06745231 KaiC KaiC. This family represents a conserved region wi 96.62
pfam05970 418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 96.02
COG52714600 MDN1 AAA ATPase containing von Willebrand factor type A 95.13
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is encod 94.36
PRK08181269 transposase; Validated 94.27
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 93.78
PRK02362 736 ski2-like helicase; Provisional 93.23
PRK04301318 radA DNA repair and recombination protein RadA; Validat 93.17
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 93.08
PRK08727233 hypothetical protein; Validated 91.4
PRK00254 717 ski2-like helicase; Provisional 90.4
pfam10236274 DAP3 Mitochondrial ribosomal death-associated protein 3 96.51
TIGR00174307 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 94.1
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 93.62
TIGR01631 814 Trypano_RHS trypanosome RHS family; InterPro: IPR006518 92.02
cd03115173 SRP The signal recognition particle (SRP) mediates the 91.45
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase 91.22
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 96.29
KOG0951 1674 consensus 93.7
TIGR00929 931 VirB4_CagE type IV secretion/conjugal transfer ATPase, 96.16
PRK13767878 ATP-dependent helicase; Provisional 96.05
PRK12337492 2-phosphoglycerate kinase; Provisional 95.48
TIGR01447 753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 94.88
TIGR01271 1534 CFTR_protein cystic fibrosis transmembrane conductor re 92.07
KOG0733802 consensus 94.74
PRK05580 699 primosome assembly protein PriA; Validated 94.54
pfam04157219 EAP30 EAP30/Vps36 family. This family includes EAP30 as 94.73
TIGR01187331 potA polyamine ABC transporter, ATP-binding protein; In 93.61
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 93.53
PRK13549513 xylose transporter ATP-binding subunit; Provisional 93.52
PRK01156 895 chromosome segregation protein; Provisional 91.58
COG1201 814 Lhr Lhr-like helicases [General function prediction onl 91.12
TIGR02198321 rfaE_dom_I rfaE bifunctional protein, domain I; InterPr 92.95
COG1204 766 Superfamily II helicase [General function prediction on 92.81
pfam00580494 UvrD-helicase UvrD/REP helicase. The Rep family helicas 92.1
pfam10923267 DUF2791 Protein of unknown function (DUF2791). This is 91.56
PRK09694 878 hypothetical protein; Provisional 91.21
TIGR00630956 uvra excinuclease ABC, A subunit; InterPro: IPR004602 A 91.34
pfam04317443 DUF463 YcjX-like family, DUF463. Some members of this f 91.13
PRK10869553 recombination and repair protein; Provisional 90.6
>PRK10263 DNA translocase FtsK; Provisional Back     alignment and domain information
>COG1674 FtsK DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>pfam01580 FtsK_SpoIIIE FtsK/SpoIIIE family Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PHA00520 packaging NTPase P4 Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>KOG0060 consensus Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein; InterPro: IPR011924 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein; InterPro: IPR005968 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family; InterPro: IPR014324 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>KOG0064 consensus Back     alignment and domain information
>smart00843 Ftsk_gamma This domain directs oriented DNA translocation and forms a winged helix structure Back     alignment and domain information
>pfam09397 Ftsk_gamma Ftsk gamma domain Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>pfam10443 RNA12 RNA12 protein Back     alignment and domain information
>COG1674 FtsK DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0926 consensus Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transport system, ATP-binding protein component Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR); InterPro: IPR005291 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information