254780611

254780611

RNA polymerase factor sigma-32

GeneID in NCBI database:8209610Locus tag:CLIBASIA_02490
Protein GI in NCBI database:254780611Protein Accession:YP_003065024.1
Gene range:-(664409, 665317)Protein Length:302aa
Gene description:RNA polymerase factor sigma-32
COG prediction:[K] DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)
KEGG prediction:rpoH; RNA polymerase factor sigma-32; K03089 RNA polymerase sigma-32 factor
SEED prediction:RNA polymerase sigma factor RpoH
Pathway involved in KEGG:RNA polymerase [PATH:las03020]
Subsystem involved in SEED:Transcription initiation, bacterial sigma factors;
Heat shock dnaK gene cluster extended
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
MNRKNMSIIVNGEIGLSRYIHEIRKIPMLEKQEEYVLAKRYREHGDLSAAHRLVTSHLRLVVKIAMGYRGYGLPISEVVSEGNIGLMQAVKKFDPERGFRLATYSMWWIKAAMQEYILRSWSLVKIGTTANQKRLFFNLRRLKGHLQAITDNNLKPEQVVAIAKKLNVSESEVISMNCRLAGDESLNALINSSDKNSSQWQDWLVYDHDGQEQVLIEKEERKNRRNMLTRSMSVLNPRERRIFEARRLQENPVTLENLSSEFEVSRERVRQIEARAFKKVQESIQKQVELSSSPPLLQKPRY
cccHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcHHccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccHHHHHHHHHHHcccccccccccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
ccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHccccHcccccc
MNRKNMSIIVNGEIGLSRYIHEirkipmlekQEEYVLAKRYREHGDLSAAHRLVTSHLRLVVKIAMgyrgyglpisevvsegNIGLMQAVkkfdpergfrlATYSMWWIKAAMQEYILRSWSLVKIGTTANQKRLFFNLRRLKGHLQaitdnnlkPEQVVAIAKKLNVSESEVISMNCRLAGDESLNALINssdknssqwqDWLVYDHDGQEQVLIEKEERKNRRNMLTRSMSVLNPRERRIFEARrlqenpvtlenlssefEVSRERVRQIEARAFKKVQESIQKQVelsssppllqkpry
mnrknmsiivngeiglsryIHEIRKIPMLEKQEEYVLAKRYREHGDLSAAHRLVTSHLRLVVKIAMGYRGYGLPISEVVSEGNIGLMQavkkfdpergFRLATYSMWWIKAAMQEYILRSWSLVKIGTTANQKRLFFNLRRLKGHLQaitdnnlkpeQVVAIAKKLNVSESEVISMNCRLAGDESLNALINSSDKNSSQWQDWLVYDHDGQEQVLIekeerknrrnmltrsmsvlnprerrifearrlqenpvtlenlssefevsrERVRQIEARAFKKVQESiqkqvelsssppllqkpry
MNRKNMSIIVNGEIGLSRYIHEIRKIPMLEKQEEYVLAKRYREHGDLSAAHRLVTSHLRLVVKIAMGYRGYGLPISEVVSEGNIGLMQAVKKFDPERGFRLATYSMWWIKAAMQEYILRSWSLVKIGTTANQKRLFFNLRRLKGHLQAITDNNLKPEQVVAIAKKLNVSESEVISMNCRLAGDESLNALINSSDKNSSQWQDWLVYDHDGQEQVLIEKEERKNRRNMLTRSMSVLNPRERRIFEARRLQENPVTLENLSSEFEVSRERVRQIEARAFKKVQESIQKQVELSSSPPLLQKPRY
***************LSRYIHEIRKIPMLEKQEEYVLAKRYREHGDLSAAHRLVTSHLRLVVKIAMGYRGYGLPISEVVSEGNIGLMQAVKKFDPERGFRLATYSMWWIKAAMQEYILRSWSLVKIGTTANQKRLFFNLRRL****************VVAIAKKLNVSESEVISMNCRLAGDE*****************DWLVYDHD************KNRRNMLTRSMSVLNPRERRIFEARRLQENPVTLENLSSEFEVSRERVRQIEARAFKKVQ*********************
MNRKNMSIIVNGEIGLSRYIHEIRKIPMLEKQEEYVLAKRYREHGDLSAAHRLVTSHLRLVVKIAMGYRGYGLPISEVVSEGNIGLMQAVKKFDPERGFRLATYSMWWIKAAMQEYILRSWSLVKIGTTANQKRLFFNLRRLKGHLQAITDNNLKPEQVVAIAKKLNVSESEVISMNCRLAGDESLNALINSSDKNSSQWQDWLVYDHDGQEQVLIEKEERKNRRNMLTRSMSVLNPRERRIFEARRLQENPVTLENLSSEFEVSRERVRQIEARAFKKVQESIQKQVELSSSPPLLQKPRY
**********NGEIGLSRYIHEIRKIPMLEKQEEYVLAKRYREHGDLSAAHRLVTSHLRLVVKIAMGYRGYGLPISEVVSEGNIGLMQAVKKFDPERGFRLATYSMWWIKAAMQEYILRSWSLVKIGTTANQKRLFFNLRRLKGHLQAITDNNLKPEQVVAIAKKLNVSESEVISMNCRLAGDESLNALINS*****SQWQDWLVYDHDGQEQVLIEKEERKNRRNMLTRSMSVLNPRERRIFEARRLQENPVTLENLSSEFEVSRERVRQIEARAFKKVQESIQKQVELSSSPPLLQ****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNRKNMSIIVNGEIGLSRYIHEIRKIPMLEKQEEYVLAKRYREHGDLSAAHRLVTSHLRLVVKIAMGYRGYGLPISEVVSEGNIGLMQAVKKFDPERGFRLATYSMWWIKAAMQEYILRSWSLVKIGTTANQKRLFFNLRRLKGHLQAITDNNLKPEQVVAIAKKLNVSESEVISMNCRLAGDESLNALINSSDKNSSQWQDWLVYDHDGQEQVLIEKEERKNRRNMLTRSMSVLNPRERRIFEARRLQENPVTxxxxxxxxxxxxxxxxxxxxxAFKKVQESIQKQVELSSSPPLLQKPRY
MNRKNMSIIVNGEIGLSRYIHEIRKIPMLEKQEEYVLAKRYREHGDLSAAHRLVTSHLRLVVKIAMGYRGYGLPISEVVSEGNIGLMQAVKKFDPERGFRLATYSMWWIKAAMQEYILRSWSLVKIGTTANQKRLFFNLRRLKGHLQAITDNNLKPEQVVAIAKKLNVSESEVISMNCRLAGDESLNALINSSDKNSSQWQDWLVYDHDGQEQVLIEKEERKNRRNMLTRSMSVLNPRERRIFEARRLQENPVTLENLSSEFEVSRERVRQIEARAFKKVQESIQKQVELSSSPPLLQKPRY
MNRKNMSIIVNGEIGLSRYIHEIRKIPMLEKQEEYVLAKRYREHGDLSAAHRLVTSHLRLVVKIAMGYRGYGLPISEVVSEGNIGLMQAVKKFDPERGFRLATYSMWWIKAAMQEYILRSWSLVKIGTTANQKRLFFNLRRLKGHLQAITDNNLKPEQVVAIAKKLNVSESEVISMNCRLAGDESLNALINSSDKNSSQWQDWLVYDHDGQEQVLIEKEERKNRRNMLTRSMSVLNPRERRIFEARRLQENPVTLENLSSEFEVSRERVRQIEARAFKKVQESIQKQVELSSSPPLLQKPRY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target302 RNA polymerase factor sigma-32 [Candidatus Liberibacter
254780289682 RNA polymerase sigma factor RpoD [Candidatus Liber 5e-23
>gi|254780289|ref|YP_003064702.1| RNA polymerase sigma factor RpoD [Candidatus Liberibacter asiaticus str. psy62] Length = 682 Back     alignment
 Score = 99.8 bits (247), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 85/289 (29%), Positives = 138/289 (47%), Gaps = 49/289 (16%)

Query: 7   SIIVNGEIGLSRYIHEIRKIPMLEKQE-EYVLAKRYREHGDLSAAHRLVTSHLRLVVKIA 65
           SI V   I +S + H    + M+ K E E  +AK+            +V ++LRLV+ +A
Sbjct: 415 SISVETGISISEFRH---IVSMVRKGECEASIAKK-----------EMVEANLRLVISVA 460

Query: 66  MGYRGYGLPISEVVSEGNIGLMQAVKKFDPERGFRLATYSMWWIKAAMQEYILRSWSLVK 125
             Y   GL   +++ EGNIGLM+A +KFD   G++ +TY+MWW+K A+   I      ++
Sbjct: 461 KKYTNRGLQFLDLIQEGNIGLMKAAEKFDWCLGYKFSTYAMWWVKQAITRSIADQSCTIR 520

Query: 126 IGTTANQK--RLFFNLRRLKGHLQAITDNNLKPEQVV--------AIAKKLNVSESEVIS 175
           I      K  ++    RR+   ++        PE++          + K L +++ E IS
Sbjct: 521 IPVHMRDKIHKVVRTARRMSNKIK----REPTPEEIAKKLAMPVEGVRKVLKITK-EPIS 575

Query: 176 MNCRLAGDESLNALINS-SDKNSSQWQDWLVYDHDGQEQVLIEKEERKNRRNMLTRSMSV 234
           +   + GDE  + L +   DKN+    D  +               + N R   TR ++ 
Sbjct: 576 LETPI-GDEDTSHLGDFIEDKNAVSPLDSAI---------------QANLRETTTRVLAS 619

Query: 235 LNPRERRIFEARR--LQENPVTLENLSSEFEVSRERVRQIEARAFKKVQ 281
           L PRE R+   R         TLE +  +F V+RER+RQIEA+A +K++
Sbjct: 620 LTPREERVLRMRFGIGMNTDHTLEEVGKQFCVTRERIRQIEAKAIRKLK 668

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target302 RNA polymerase factor sigma-32 [Candidatus Liberibacter
315121811300 RNA polymerase factor sigma-32 [Candidatus Liberibacter 1 1e-145
190893168302 RNA polymerase sigma factor protein (sigma-70) [Rhizobi 1 1e-124
327190963332 RNA polymerase sigma factor protein (sigma-70) [Rhizobi 1 1e-124
222086841302 alternative sigma factor RpoH [Agrobacterium radiobacte 1 1e-124
74099847302 RpoH [Rhizobium leguminosarum] Length = 302 1 1e-124
15889716300 RNA polymerase factor sigma-32 [Agrobacterium tumefacie 1 1e-123
325293796300 RNA polymerase sigma-32 factor [Agrobacterium sp. H13-3 1 1e-123
86358940302 RNA polymerase factor sigma-32 [Rhizobium etli CFN 42] 1 1e-123
116253507302 RNA polymerase factor sigma-32 [Rhizobium leguminosarum 1 1e-123
209550663302 RNA polymerase factor sigma-32 [Rhizobium leguminosarum 1 1e-123
>gi|315121811|ref|YP_004062300.1| RNA polymerase factor sigma-32 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 300 Back     alignment and organism information
 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 247/289 (85%), Positives = 269/289 (93%)

Query: 1   MNRKNMSIIVNGEIGLSRYIHEIRKIPMLEKQEEYVLAKRYREHGDLSAAHRLVTSHLRL 60
           M+R+NMSI+++GEIGL RYIHEI+KIPMLEKQEEY+LAKRY EH DL+A H+LVTSHLRL
Sbjct: 1   MSRRNMSIMIDGEIGLRRYIHEIKKIPMLEKQEEYMLAKRYHEHHDLNAVHKLVTSHLRL 60

Query: 61  VVKIAMGYRGYGLPISEVVSEGNIGLMQAVKKFDPERGFRLATYSMWWIKAAMQEYILRS 120
           VVKIAMGYRGYGLPISEV+SEGNIGLMQAVKKFDPERGFRLATY +WWIKAA+QEYILRS
Sbjct: 61  VVKIAMGYRGYGLPISEVISEGNIGLMQAVKKFDPERGFRLATYGIWWIKAAIQEYILRS 120

Query: 121 WSLVKIGTTANQKRLFFNLRRLKGHLQAITDNNLKPEQVVAIAKKLNVSESEVISMNCRL 180
           WSLVKIGTTANQKRLFFNLRRLKG LQA+ D NLKPEQVV IA KLNVSE+EVISMNCRL
Sbjct: 121 WSLVKIGTTANQKRLFFNLRRLKGRLQAVNDTNLKPEQVVEIATKLNVSEAEVISMNCRL 180

Query: 181 AGDESLNALINSSDKNSSQWQDWLVYDHDGQEQVLIEKEERKNRRNMLTRSMSVLNPRER 240
           +GDESLN L+NSSDK+SSQWQD LVY+HD QEQ LI+KEERKNRRNMLTRSMS LNPRER
Sbjct: 181 SGDESLNVLMNSSDKDSSQWQDLLVYNHDSQEQTLIDKEERKNRRNMLTRSMSTLNPRER 240

Query: 241 RIFEARRLQENPVTLENLSSEFEVSRERVRQIEARAFKKVQESIQKQVE 289
           RIFEARRL ENP TLENLSSEF VSRER+RQIEARAF+KVQ S+QKQ E
Sbjct: 241 RIFEARRLNENPSTLENLSSEFAVSRERIRQIEARAFEKVQASVQKQTE 289


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190893168|ref|YP_001979710.1| RNA polymerase sigma factor protein (sigma-70) [Rhizobium etli CIAT 652] Length = 302 Back     alignment and organism information
>gi|327190963|gb|EGE58017.1| RNA polymerase sigma factor protein (sigma-70) [Rhizobium etli CNPAF512] Length = 332 Back     alignment and organism information
>gi|222086841|ref|YP_002545375.1| alternative sigma factor RpoH [Agrobacterium radiobacter K84] Length = 302 Back     alignment and organism information
>gi|74099847|gb|AAZ99132.1| RpoH [Rhizobium leguminosarum] Length = 302 Back     alignment and organism information
>gi|15889716|ref|NP_355397.1| RNA polymerase factor sigma-32 [Agrobacterium tumefaciens str. C58] Length = 300 Back     alignment and organism information
>gi|325293796|ref|YP_004279660.1| RNA polymerase sigma-32 factor [Agrobacterium sp. H13-3] Length = 300 Back     alignment and organism information
>gi|86358940|ref|YP_470832.1| RNA polymerase factor sigma-32 [Rhizobium etli CFN 42] Length = 302 Back     alignment and organism information
>gi|116253507|ref|YP_769345.1| RNA polymerase factor sigma-32 [Rhizobium leguminosarum bv. viciae 3841] Length = 302 Back     alignment and organism information
>gi|209550663|ref|YP_002282580.1| RNA polymerase factor sigma-32 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 302 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target302 RNA polymerase factor sigma-32 [Candidatus Liberibacter
PRK06596284 PRK06596, PRK06596, RNA polymerase factor sigma-32; Rev 1e-130
TIGR02392270 TIGR02392, rpoH_proteo, alternative sigma factor RpoH 1e-107
PRK07500289 PRK07500, rpoH2, RNA polymerase factor sigma-32; Review 1e-71
TIGR02394285 TIGR02394, rpoS_proteo, RNA polymerase sigma factor Rpo 4e-32
PRK05657325 PRK05657, PRK05657, RNA polymerase sigma factor RpoS; V 2e-29
TIGR02997298 TIGR02997, Sig70-cyanoRpoD, RNA polymerase sigma factor 9e-28
COG1191247 COG1191, FliA, DNA-directed RNA polymerase specialized 7e-18
PRK07921324 PRK07921, PRK07921, RNA polymerase sigma factor SigB; R 3e-17
PRK05949327 PRK05949, PRK05949, RNA polymerase sigma factor; Valida 4e-14
PRK08583257 PRK08583, PRK08583, RNA polymerase sigma factor SigB; V 2e-09
TIGR02941255 TIGR02941, Sigma_B, RNA polymerase sigma-B factor 4e-09
TIGR02850254 TIGR02850, spore_sigG, RNA polymerase sigma-G factor 2e-08
PRK06288268 PRK06288, PRK06288, RNA polymerase sigma factor WhiG; R 4e-08
PRK08215258 PRK08215, PRK08215, sporulation sigma factor SigG; Revi 1e-07
COG0568342 COG0568, RpoD, DNA-directed RNA polymerase, sigma subun 1e-62
TIGR02393238 TIGR02393, RpoD_Cterm, RNA polymerase sigma factor RpoD 3e-24
PRK07598415 PRK07598, PRK07598, RNA polymerase sigma factor SigC; V 3e-18
TIGR02980227 TIGR02980, SigBFG, RNA polymerase sigma-70 factor, sigm 6e-13
TIGR02479224 TIGR02479, FliA_WhiG, RNA polymerase sigma factor, FliA 2e-11
TIGR02885231 TIGR02885, spore_sigF, RNA polymerase sigma-F factor 4e-06
PRK07408256 PRK07408, PRK07408, RNA polymerase sigma factor SigF; R 5e-05
PRK07670251 PRK07670, PRK07670, RNA polymerase sigma factor SigD; V 2e-04
PRK05572252 PRK05572, PRK05572, sporulation sigma factor SigF; Vali 8e-04
PRK06986236 PRK06986, fliA, flagellar biosynthesis sigma factor; Va 0.002
PRK05911257 PRK05911, PRK05911, RNA polymerase sigma factor sigma-2 0.002
PRK09210367 PRK09210, PRK09210, RNA polymerase sigma factor RpoD; V 8e-21
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; Provis 1e-15
PRK07406373 PRK07406, PRK07406, RNA polymerase sigma factor RpoD; V 2e-13
PRK07405317 PRK07405, PRK07405, RNA polymerase sigma factor SigD; V 5e-11
TIGR02835234 TIGR02835, spore_sigmaE, RNA polymerase sigma-E factor 7e-11
PRK08301234 PRK08301, PRK08301, sporulation sigma factor SigE; Revi 1e-10
TIGR02846227 TIGR02846, spore_sigmaK, RNA polymerase sigma-K factor 6e-10
PRK05803233 PRK05803, PRK05803, sporulation sigma factor SigK; Revi 7e-10
TIGR02937158 TIGR02937, sigma70-ECF, RNA polymerase sigma factor, si 7e-06
pfam0454271 pfam04542, Sigma70_r2, Sigma-70 region 2 2e-14
PRK05658619 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; V 5e-13
pfam0454550 pfam04545, Sigma70_r4, Sigma-70, region 4 5e-07
cd0617155 cd06171, Sigma70_r4, Sigma70, region (SR) 4 refers to t 5e-06
PRK05658619 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; V 1e-04
PRK07406373 PRK07406, PRK07406, RNA polymerase sigma factor RpoD; V 2e-04
TIGR02937158 TIGR02937, sigma70-ECF, RNA polymerase sigma factor, si 2e-04
PRK09210367 PRK09210, PRK09210, RNA polymerase sigma factor RpoD; V 3e-04
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; Provis 3e-04
PRK07405317 PRK07405, PRK07405, RNA polymerase sigma factor SigD; V 0.003
>gnl|CDD|180635 PRK06596, PRK06596, RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>gnl|CDD|162835 TIGR02392, rpoH_proteo, alternative sigma factor RpoH Back     alignment and domain information
>gnl|CDD|181003 PRK07500, rpoH2, RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>gnl|CDD|131447 TIGR02394, rpoS_proteo, RNA polymerase sigma factor RpoS Back     alignment and domain information
>gnl|CDD|180185 PRK05657, PRK05657, RNA polymerase sigma factor RpoS; Validated Back     alignment and domain information
>gnl|CDD|163097 TIGR02997, Sig70-cyanoRpoD, RNA polymerase sigma factor, cyanobacterial RpoD-like family Back     alignment and domain information
>gnl|CDD|31384 COG1191, FliA, DNA-directed RNA polymerase specialized sigma subunit [Transcription] Back     alignment and domain information
>gnl|CDD|181169 PRK07921, PRK07921, RNA polymerase sigma factor SigB; Reviewed Back     alignment and domain information
>gnl|CDD|180321 PRK05949, PRK05949, RNA polymerase sigma factor; Validated Back     alignment and domain information
>gnl|CDD|181489 PRK08583, PRK08583, RNA polymerase sigma factor SigB; Validated Back     alignment and domain information
>gnl|CDD|131987 TIGR02941, Sigma_B, RNA polymerase sigma-B factor Back     alignment and domain information
>gnl|CDD|131897 TIGR02850, spore_sigG, RNA polymerase sigma-G factor Back     alignment and domain information
>gnl|CDD|180512 PRK06288, PRK06288, RNA polymerase sigma factor WhiG; Reviewed Back     alignment and domain information
>gnl|CDD|181296 PRK08215, PRK08215, sporulation sigma factor SigG; Reviewed Back     alignment and domain information
>gnl|CDD|30914 COG0568, RpoD, DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) [Transcription] Back     alignment and domain information
>gnl|CDD|162836 TIGR02393, RpoD_Cterm, RNA polymerase sigma factor RpoD, C-terminal domain Back     alignment and domain information
>gnl|CDD|181056 PRK07598, PRK07598, RNA polymerase sigma factor SigC; Validated Back     alignment and domain information
>gnl|CDD|163094 TIGR02980, SigBFG, RNA polymerase sigma-70 factor, sigma-B/F/G subfamily Back     alignment and domain information
>gnl|CDD|162877 TIGR02479, FliA_WhiG, RNA polymerase sigma factor, FliA/WhiG family Back     alignment and domain information
>gnl|CDD|131931 TIGR02885, spore_sigF, RNA polymerase sigma-F factor Back     alignment and domain information
>gnl|CDD|180965 PRK07408, PRK07408, RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>gnl|CDD|181075 PRK07670, PRK07670, RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>gnl|CDD|180137 PRK05572, PRK05572, sporulation sigma factor SigF; Validated Back     alignment and domain information
>gnl|CDD|180784 PRK06986, fliA, flagellar biosynthesis sigma factor; Validated Back     alignment and domain information
>gnl|CDD|135656 PRK05911, PRK05911, RNA polymerase sigma factor sigma-28; Reviewed Back     alignment and domain information
>gnl|CDD|181701 PRK09210, PRK09210, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|180310 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|180964 PRK07406, PRK07406, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|180963 PRK07405, PRK07405, RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>gnl|CDD|131882 TIGR02835, spore_sigmaE, RNA polymerase sigma-E factor Back     alignment and domain information
>gnl|CDD|181367 PRK08301, PRK08301, sporulation sigma factor SigE; Reviewed Back     alignment and domain information
>gnl|CDD|131893 TIGR02846, spore_sigmaK, RNA polymerase sigma-K factor Back     alignment and domain information
>gnl|CDD|180266 PRK05803, PRK05803, sporulation sigma factor SigK; Reviewed Back     alignment and domain information
>gnl|CDD|163078 TIGR02937, sigma70-ECF, RNA polymerase sigma factor, sigma-70 family Back     alignment and domain information
>gnl|CDD|146937 pfam04542, Sigma70_r2, Sigma-70 region 2 Back     alignment and domain information
>gnl|CDD|180186 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|146939 pfam04545, Sigma70_r4, Sigma-70, region 4 Back     alignment and domain information
>gnl|CDD|100119 cd06171, Sigma70_r4, Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>gnl|CDD|180186 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|180964 PRK07406, PRK07406, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|163078 TIGR02937, sigma70-ECF, RNA polymerase sigma factor, sigma-70 family Back     alignment and domain information
>gnl|CDD|181701 PRK09210, PRK09210, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|180310 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|180963 PRK07405, PRK07405, RNA polymerase sigma factor SigD; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 302 RNA polymerase factor sigma-32 [Candidatus Liberibacter
TIGR02997336 Sig70-cyanoRpoD RNA polymerase sigma factor, cyanobacte 100.0
PRK06596284 RNA polymerase factor sigma-32; Reviewed 100.0
TIGR02392279 rpoH_proteo alternative sigma factor RpoH; InterPro: IP 100.0
TIGR02394292 rpoS_proteo RNA polymerase sigma factor RpoS; InterPro: 100.0
PRK05657328 RNA polymerase sigma factor RpoS; Validated 100.0
PRK07500289 rpoH2 RNA polymerase factor sigma-32; Reviewed 100.0
PRK09210368 RNA polymerase sigma factor RpoD; Validated 100.0
PRK07921320 RNA polymerase sigma factor SigB; Reviewed 100.0
PRK07405318 RNA polymerase sigma factor SigD; Validated 100.0
PRK05901398 RNA polymerase sigma factor; Provisional 100.0
PRK05949327 RNA polymerase sigma factor; Validated 100.0
PRK07406385 RNA polymerase sigma factor RpoD; Validated 100.0
PRK07598410 RNA polymerase sigma factor SigC; Validated 100.0
PRK05658620 RNA polymerase sigma factor RpoD; Validated 100.0
COG0568342 RpoD DNA-directed RNA polymerase, sigma subunit (sigma7 100.0
PRK08215257 sporulation sigma factor SigG; Reviewed 100.0
PRK08583257 RNA polymerase sigma factor SigB; Validated 100.0
PRK07408256 RNA polymerase sigma factor SigF; Reviewed 100.0
PRK05572251 sporulation sigma factor SigF; Validated 100.0
PRK06288261 RNA polymerase sigma factor WhiG; Reviewed 100.0
PRK07122263 RNA polymerase sigma factor SigF; Reviewed 100.0
PRK05911257 RNA polymerase sigma factor sigma-28; Reviewed 100.0
PRK07670250 RNA polymerase sigma factor SigD; Validated 100.0
PRK05803228 sporulation sigma factor SigK; Reviewed 100.0
PRK08301239 sporulation sigma factor SigE; Reviewed 100.0
TIGR02885231 spore_sigF RNA polymerase sigma-F factor; InterPro: IPR 100.0
COG1191247 FliA DNA-directed RNA polymerase specialized sigma subu 100.0
TIGR02941256 Sigma_B RNA polymerase sigma-B factor; InterPro: IPR014 100.0
TIGR02846228 spore_sigmaK RNA polymerase sigma-K factor; InterPro: I 100.0
TIGR02850254 spore_sigG RNA polymerase sigma-G factor; InterPro: IPR 100.0
TIGR02835234 spore_sigmaE RNA polymerase sigma-E factor; InterPro: I 99.97
PRK08295209 RNA polymerase factor sigma-70; Validated 99.97
PRK11922231 RNA polymerase sigma factor; Provisional 99.8
PRK12531194 RNA polymerase sigma factor; Provisional 99.8
PRK12534187 RNA polymerase sigma factor; Provisional 99.79
PRK12519194 RNA polymerase sigma factor; Provisional 99.78
PRK09652192 RNA polymerase sigma factor RpoE; Provisional 99.78
PRK11923193 algU RNA polymerase sigma factor AlgU; Provisional 99.78
PRK09641187 RNA polymerase sigma factor SigW; Provisional 99.78
PRK12513194 RNA polymerase sigma factor; Provisional 99.77
PRK09646194 RNA polymerase sigma factor SigK; Reviewed 99.77
PRK13919187 putative RNA polymerase sigma E protein; Provisional 99.77
PRK06811185 RNA polymerase factor sigma-70; Validated 99.76
PRK09648187 RNA polymerase sigma factor SigD; Reviewed 99.76
PRK05602186 RNA polymerase sigma factor; Reviewed 99.75
PRK12543190 RNA polymerase sigma factor; Provisional 99.73
PRK11924180 RNA polymerase sigma factor; Provisional 99.73
PRK12514179 RNA polymerase sigma factor; Provisional 99.73
PRK12526206 RNA polymerase sigma factor; Provisional 99.73
PRK12524196 RNA polymerase sigma factor; Provisional 99.72
PRK12515189 RNA polymerase sigma factor; Provisional 99.72
PRK12537184 RNA polymerase sigma factor; Provisional 99.71
PRK12538233 RNA polymerase sigma factor; Provisional 99.71
PRK09643197 RNA polymerase sigma factor SigM; Reviewed 99.71
PRK09638177 RNA polymerase sigma factor SigY; Reviewed 99.7
PRK12512184 RNA polymerase sigma factor; Provisional 99.7
PRK09647222 RNA polymerase sigma factor SigE; Reviewed 99.68
PRK12539184 RNA polymerase sigma factor; Provisional 99.64
PRK09415177 RNA polymerase factor sigma C; Reviewed 99.64
PRK12518175 RNA polymerase sigma factor; Provisional 99.64
PRK09640188 RNA polymerase sigma factor SigX; Reviewed 99.63
PRK12536178 RNA polymerase sigma factor; Provisional 99.62
TIGR02859198 spore_sigH RNA polymerase sigma-H factor; InterPro: IPR 99.59
PRK12535195 RNA polymerase sigma factor; Provisional 99.56
PRK09649185 RNA polymerase sigma factor SigC; Reviewed 99.55
pfam07638185 Sigma70_ECF ECF sigma factor. These proteins are probab 99.54
TIGR02948187 SigW_bacill RNA polymerase sigma-W factor; InterPro: IP 99.32
TIGR02952171 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02952 f 99.25
PRK08241 341 RNA polymerase factor sigma-70; Validated 99.13
TIGR02954173 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 f 99.0
TIGR02999194 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family 98.72
TIGR02939192 RpoE_Sigma70 RNA polymerase sigma factor RpoE; InterPro 98.55
TIGR02947193 SigH_actino RNA polymerase sigma-70 factor, TIGR02947 f 90.59
TIGR02393240 RpoD_Cterm RNA polymerase sigma factor RpoD; InterPro: 100.0
TIGR02980229 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subf 100.0
PRK06986234 fliA flagellar biosynthesis sigma factor; Validated 100.0
PRK12427229 flagellar biosynthesis sigma factor; Provisional 100.0
TIGR02479227 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG family 100.0
PRK06759154 RNA polymerase factor sigma-70; Validated 99.93
TIGR02937162 sigma70-ECF RNA polymerase sigma factor, sigma-70 famil 99.92
PRK12542185 RNA polymerase sigma factor; Provisional 99.67
PRK12544207 RNA polymerase sigma factor; Provisional 99.59
PRK12522173 RNA polymerase sigma factor; Provisional 99.57
PRK12520191 RNA polymerase sigma factor; Provisional 99.56
PRK12532195 RNA polymerase sigma factor; Provisional 99.56
PRK12533217 RNA polymerase sigma factor; Provisional 99.56
TIGR02984190 Sig-70_plancto1 RNA polymerase sigma-70 factor, Plancto 99.55
PRK12545201 RNA polymerase sigma factor; Provisional 99.54
PRK09645171 RNA polymerase sigma factor SigL; Provisional 99.51
PRK12517188 RNA polymerase sigma factor; Provisional 99.5
PRK09637181 RNA polymerase sigma factor SigZ; Provisional 99.47
PRK12516190 RNA polymerase sigma factor; Provisional 99.47
PRK09644165 RNA polymerase sigma factor SigM; Provisional 99.46
PRK12541161 RNA polymerase sigma factor; Provisional 99.46
COG1595182 RpoE DNA-directed RNA polymerase specialized sigma subu 99.45
PRK09642160 RNA polymerase sigma factor SigW; Reviewed 99.44
PRK12530191 RNA polymerase sigma factor; Provisional 99.43
PRK12546188 RNA polymerase sigma factor; Provisional 99.43
PRK07037183 extracytoplasmic-function sigma-70 factor; Validated 99.41
PRK12547164 RNA polymerase sigma factor; Provisional 99.39
PRK09639166 RNA polymerase sigma factor SigX; Provisional 99.39
PRK09651172 RNA polymerase sigma factor FecI; Provisional 99.37
PRK12540181 RNA polymerase sigma factor; Provisional 99.31
TIGR02985167 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bactero 99.25
PRK12523172 RNA polymerase sigma factor; Reviewed 99.24
PRK12511182 RNA polymerase sigma factor; Provisional 99.23
PRK12528167 RNA polymerase sigma factor; Provisional 99.07
PRK12525168 RNA polymerase sigma factor; Provisional 99.02
PRK12529178 RNA polymerase sigma factor; Provisional 98.94
PRK09636 289 RNA polymerase sigma factor SigJ; Provisional 98.78
TIGR02989163 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirell 98.69
PRK09635 290 sigI RNA polymerase sigma factor SigI; Provisional 98.5
TIGR02983165 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E 98.41
TIGR02957 287 SigX4 RNA polymerase sigma-70 factor, TIGR02957 family; 98.1
PRK09191 261 two-component response regulator; Provisional 94.07
PRK08311237 putative RNA polymerase sigma factor SigI; Reviewed 99.69
pfam0454271 Sigma70_r2 Sigma-70 region 2. Region 2 of sigma-70 is t 99.11
TIGR02895225 spore_sigI RNA polymerase sigma-I factor; InterPro: IPR 98.56
PRK09047161 RNA polymerase factor sigma-70; Validated 99.42
PRK12527159 RNA polymerase sigma factor; Reviewed 99.27
pfam0454550 Sigma70_r4 Sigma-70, region 4. Region 4 of sigma-70 lik 98.99
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C- 98.76
PRK06930170 positive control sigma-like factor; Validated 98.46
TIGR03001249 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxococcale 98.37
pfam0828154 Sigma70_r4_2 Sigma-70, region 4. Region 4 of sigma-70 l 98.15
TIGR02233106 Myxo_sigma_rel Myxococcus probable DNA-binding regulato 97.96
PRK00118105 putative DNA-binding protein; Validated 97.74
PRK03975139 tfx putative transcriptional regulator; Provisional 97.71
pfam04297101 UPF0122 Putative helix-turn-helix protein, YlxM / p13 l 97.7
TIGR02959170 SigZ RNA polymerase sigma factor, SigZ family; InterPro 97.48
TIGR00721142 tfx DNA-binding protein, Tfx family; InterPro: IPR00464 97.45
TIGR02960 329 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family; 97.38
TIGR02950162 SigM_subfam RNA polymerase sigma factor, SigM family; I 97.28
PRK09958204 DNA-binding transcriptional activator EvgA; Provisional 97.18
pfam0019658 GerE Bacterial regulatory proteins, luxR family. 97.12
COG3413215 Predicted DNA binding protein [General function predict 97.08
PRK09483216 response regulator; Provisional 96.95
smart0042158 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulon (ac 96.92
PRK10840216 transcriptional regulator RcsB; Provisional 96.9
PRK10403215 transcriptional regulator NarP; Provisional 96.84
PRK12469475 RNA polymerase factor sigma-54; Provisional 96.82
PRK10651216 transcriptional regulator NarL; Provisional 96.82
PRK09935210 transcriptional regulator FimZ; Provisional 96.81
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR-like 96.8
pfam07374100 DUF1492 Protein of unknown function (DUF1492). This fam 96.79
TIGR03020247 EpsA transcriptional regulator EpsA. Proteins in this f 96.74
PRK10360196 DNA-binding transcriptional activator UhpA; Provisional 96.74
PRK10188240 DNA-binding transcriptional activator SdiA; Provisional 96.68
pfam0496753 HTH_10 HTH DNA binding domain. 96.67
PRK11475205 DNA-binding transcriptional activator BglJ; Provisional 96.65
COG2739105 Uncharacterized protein conserved in bacteria [Function 96.64
TIGR03541232 reg_near_HchA LuxR family transcriptional regulatory, c 96.62
PRK09390202 fixJ response regulator FixJ; Provisional 96.62
PRK06704228 RNA polymerase factor sigma-70; Validated 96.59
COG2197211 CitB Response regulator containing a CheY-like receiver 96.53
TIGR01637139 phage_arpU phage transcriptional regulator, ArpU family 96.45
COG4566202 TtrR Response regulator [Signal transduction mechanisms 96.33
pfam02001100 DUF134 Protein of unknown function DUF134. This family 96.32
PRK13870234 transcriptional regulator TraR; Provisional 96.28
COG1356143 tfx Transcriptional regulator [DNA replication, recombi 96.24
PRK10100216 DNA-binding transcriptional regulator CsgD; Provisional 96.12
PRK05932461 RNA polymerase factor sigma-54; Reviewed 95.82
PRK04217110 hypothetical protein; Provisional 95.73
PRK04841903 transcriptional regulator MalT; Provisional 95.54
TIGR03209142 P21_Cbot clostridium toxin-associated regulator BotR. S 94.86
COG134299 Predicted DNA-binding proteins [General function predic 94.83
COG277165 CsgD DNA-binding HTH domain-containing proteins [Transc 94.64
PRK13558674 bacterio-opsin activator; Provisional 94.28
COG1508444 RpoN DNA-directed RNA polymerase specialized sigma subu 93.81
pfam05263130 DUF722 Protein of unknown function (DUF722). This famil 93.42
pfam0172665 LexA_DNA_bind LexA DNA binding domain. This is the DNA 92.99
pfam0137188 Trp_repressor Trp repressor protein. This protein binds 92.69
COG3355126 Predicted transcriptional regulator [Transcription] 92.46
PRK0138199 Trp operon repressor; Provisional 91.29
pfam09862113 DUF2089 Protein of unknown function(DUF2089). This doma 90.49
PRK09863 585 putative frv operon regulatory protein; Provisional 90.3
pfam0014037 Sigma70_r1_2 Sigma-70 factor, region 1.2. 98.07
PRK09954362 hypothetical protein; Provisional 95.95
pfam0453978 Sigma70_r3 Sigma-70 region 3. Region 3 forms a discrete 98.02
TIGR02612150 mob_myst_A mobile mystery protein A; InterPro: IPR01343 91.71
PRK05658 620 RNA polymerase sigma factor RpoD; Validated 97.91
TIGR02943194 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02943 f 97.66
COG2390321 DeoR Transcriptional regulator, contains sigma factor-r 95.53
PRK11564426 stationary phase inducible protein CsiE; Provisional 93.12
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 91.47
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-ter 90.29
COG1510177 Predicted transcriptional regulators [Transcription] 93.05
PRK12423202 LexA repressor; Provisional 91.68
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an autogenou 90.88
pfam04552160 Sigma54_DBD Sigma-54, DNA binding domain. This DNA bind 90.33
>TIGR02997 Sig70-cyanoRpoD RNA polymerase sigma factor, cyanobacterial RpoD-like family Back     alignment and domain information
>PRK06596 RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>TIGR02392 rpoH_proteo alternative sigma factor RpoH; InterPro: IPR012759 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>TIGR02394 rpoS_proteo RNA polymerase sigma factor RpoS; InterPro: IPR012761 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK05657 RNA polymerase sigma factor RpoS; Validated Back     alignment and domain information
>PRK07500 rpoH2 RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>PRK09210 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>PRK07921 RNA polymerase sigma factor SigB; Reviewed Back     alignment and domain information
>PRK07405 RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>PRK05901 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK05949 RNA polymerase sigma factor; Validated Back     alignment and domain information
>PRK07406 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>PRK07598 RNA polymerase sigma factor SigC; Validated Back     alignment and domain information
>PRK05658 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>COG0568 RpoD DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) [Transcription] Back     alignment and domain information
>PRK08215 sporulation sigma factor SigG; Reviewed Back     alignment and domain information
>PRK08583 RNA polymerase sigma factor SigB; Validated Back     alignment and domain information
>PRK07408 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>PRK05572 sporulation sigma factor SigF; Validated Back     alignment and domain information
>PRK06288 RNA polymerase sigma factor WhiG; Reviewed Back     alignment and domain information
>PRK07122 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>PRK05911 RNA polymerase sigma factor sigma-28; Reviewed Back     alignment and domain information
>PRK07670 RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>PRK05803 sporulation sigma factor SigK; Reviewed Back     alignment and domain information
>PRK08301 sporulation sigma factor SigE; Reviewed Back     alignment and domain information
>TIGR02885 spore_sigF RNA polymerase sigma-F factor; InterPro: IPR014236 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>COG1191 FliA DNA-directed RNA polymerase specialized sigma subunit [Transcription] Back     alignment and domain information
>TIGR02941 Sigma_B RNA polymerase sigma-B factor; InterPro: IPR014288 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>TIGR02846 spore_sigmaK RNA polymerase sigma-K factor; InterPro: IPR014209 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>TIGR02850 spore_sigG RNA polymerase sigma-G factor; InterPro: IPR014212 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>TIGR02835 spore_sigmaE RNA polymerase sigma-E factor; InterPro: IPR014200 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK08295 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK11922 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12531 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12534 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12519 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09652 RNA polymerase sigma factor RpoE; Provisional Back     alignment and domain information
>PRK11923 algU RNA polymerase sigma factor AlgU; Provisional Back     alignment and domain information
>PRK09641 RNA polymerase sigma factor SigW; Provisional Back     alignment and domain information
>PRK12513 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09646 RNA polymerase sigma factor SigK; Reviewed Back     alignment and domain information
>PRK13919 putative RNA polymerase sigma E protein; Provisional Back     alignment and domain information
>PRK06811 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK09648 RNA polymerase sigma factor SigD; Reviewed Back     alignment and domain information
>PRK05602 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>PRK12543 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK11924 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12514 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12526 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12524 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12515 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12537 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12538 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09643 RNA polymerase sigma factor SigM; Reviewed Back     alignment and domain information
>PRK09638 RNA polymerase sigma factor SigY; Reviewed Back     alignment and domain information
>PRK12512 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09647 RNA polymerase sigma factor SigE; Reviewed Back     alignment and domain information
>PRK12539 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09415 RNA polymerase factor sigma C; Reviewed Back     alignment and domain information
>PRK12518 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09640 RNA polymerase sigma factor SigX; Reviewed Back     alignment and domain information
>PRK12536 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02859 spore_sigH RNA polymerase sigma-H factor; InterPro: IPR014218 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK12535 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09649 RNA polymerase sigma factor SigC; Reviewed Back     alignment and domain information
>pfam07638 Sigma70_ECF ECF sigma factor Back     alignment and domain information
>TIGR02948 SigW_bacill RNA polymerase sigma-W factor; InterPro: IPR014294 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>TIGR02952 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02952 family; InterPro: IPR014298 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK08241 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>TIGR02954 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 family; InterPro: IPR014300 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family; InterPro: IPR011517 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>TIGR02939 RpoE_Sigma70 RNA polymerase sigma factor RpoE; InterPro: IPR014286 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>TIGR02947 SigH_actino RNA polymerase sigma-70 factor, TIGR02947 family; InterPro: IPR014293 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>TIGR02393 RpoD_Cterm RNA polymerase sigma factor RpoD; InterPro: IPR012760 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily; InterPro: IPR014322 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK06986 fliA flagellar biosynthesis sigma factor; Validated Back     alignment and domain information
>PRK12427 flagellar biosynthesis sigma factor; Provisional Back     alignment and domain information
>TIGR02479 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG family; InterPro: IPR012845 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK06759 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family; InterPro: IPR014284 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK12542 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12544 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12522 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12520 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12532 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12533 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02984 Sig-70_plancto1 RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1; InterPro: IPR014326 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK12545 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09645 RNA polymerase sigma factor SigL; Provisional Back     alignment and domain information
>PRK12517 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09637 RNA polymerase sigma factor SigZ; Provisional Back     alignment and domain information
>PRK12516 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09644 RNA polymerase sigma factor SigM; Provisional Back     alignment and domain information
>PRK12541 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>COG1595 RpoE DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription] Back     alignment and domain information
>PRK09642 RNA polymerase sigma factor SigW; Reviewed Back     alignment and domain information
>PRK12530 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12546 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK07037 extracytoplasmic-function sigma-70 factor; Validated Back     alignment and domain information
>PRK12547 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09639 RNA polymerase sigma factor SigX; Provisional Back     alignment and domain information
>PRK09651 RNA polymerase sigma factor FecI; Provisional Back     alignment and domain information
>PRK12540 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1; InterPro: IPR014327 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK12523 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>PRK12511 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12528 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12525 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12529 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09636 RNA polymerase sigma factor SigJ; Provisional Back     alignment and domain information
>TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family; InterPro: IPR014331 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK09635 sigI RNA polymerase sigma factor SigI; Provisional Back     alignment and domain information
>TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family; InterPro: IPR014325 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information