254780612

254780612

putative transmembrane protein

GeneID in NCBI database:8209611Locus tag:CLIBASIA_02495
Protein GI in NCBI database:254780612Protein Accession:YP_003065025.1
Gene range:+(662814, 664325)Protein Length:503aa
Gene description:putative transmembrane protein
COG prediction:none
KEGG prediction:putative transmembrane protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500---
MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWENRSNN
ccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHccccccccccHHHHHHHHHHHccccHHHHHHHHHcccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccccccHHHHHHHccccccccccHHHHccccHHHHHHHHcccccccccccccccccccccccccHHHHcccccccEEEEcccccccccccccccEEEEEccccccEEEEEEEEEEEEEcccccccccEEEEEEEcccccEEEEEEEEccccccccHHHEEEEEEccccccccccccccccEEcccccccccccccEEEEEcccEEEEEEcccccHHHHHHHHHcccccEEEEEEEccccEEEEEEcccccHHHHHHHHHHHHHHHHcc
cccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccccHHHHHHHHHHHHHHHHHHcccHHEccccccEEcHHHHccccccccccccccccccccHHHHEcccccccccccccHHHHHHHcHHHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccEEEEcccEEEEccccccccccEEEcccccccHHHHHHcccccEcccccccccccccccccEEEEEccccccccccccccccccHHcccccccEEEEEEcccccccccccEEEEEEEEEccccccccEEEEEEEcccccEEEEEEEEEcccccccccEEEEEEEEcccccccccEEcccEEEcccHHccccccEEEEEEEcccEEEEEEcccHHHHHHHHHHHHccccEEEEEEEccccEEEEEEEccccHHHHHHHHHHHHHHHccc
MVDFILVIQRAvdnlpentperrSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQkslhtskqdkesdipkssvtskenifleprlRSISSILRSNKHKKLANILSVqgksrtntnlspknfSCRLREILSFSVntqheydssvspvaaiehdksrlrrgklagifsfptgsifWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSysigkskgsiTHFLRresldggnvdkknvfsgirpKITRRlledgsevdvgpstipvadfantsniafknyiggdenstfvlgkkeieegnpligegrvfinkgrgqssilSGKILWSLQQEKSqglkglvikgdipmidnAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRIsmrktdnspsvlidsnifviSKNSYLIslkgseedpfrnskileeyrfidipityrsgQKILFTidkgkkgaDIFKSAIMQWENRSNN
MVDFILVIQravdnlpentperrshiyehARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKqnqkslhtskqdkesdipkssvtskenifleprlrsissilrsnkhKKLANIlsvqgksrtntnlspkNFSCRLREILSFSVNTqheydssvspvaaiehdksrlrrGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLrresldggnvdkknvfsgirpkitrrlledgsevdVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRIsmrktdnspsvlidsnifVISKNSYLIslkgseedpfrnsKILEEYrfidipityrsgqKILFTIDKGKKGADIFKSAimqwenrsnn
MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPrlrsissilrsNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWENRSNN
*VDFILVIQRAVDN**********HIYEHARNSVARRLES**************NKLEQAILQV***********************************************************************************************************************************************ALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKG********************************LLE*******************************************************************LSGKIL******************DIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDL*****************SNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWEN****
MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEK**********************TSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWENRSNN
*VDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGK*****N*SP*N**C****ILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPST*********SNI****YI*****************GNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWENRS**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPxxxxxxxxxxxxxxxxxxxxxxxxSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWENRSNN
MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWENRSNN
MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWENRSNN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target503 putative transmembrane protein [Candidatus Liberibacter
315121812500 putative transmembrane protein [Candidatus Liberibacter 1 1e-158
116253508851 transmembrane protein [Rhizobium leguminosarum bv. vici 1 4e-27
116253508 851 transmembrane protein [Rhizobium leguminosarum bv. vici 1 4e-15
241206035841 hypothetical protein Rleg_3345 [Rhizobium leguminosarum 1 4e-26
241206035 841 hypothetical protein Rleg_3345 [Rhizobium leguminosarum 1 2e-15
190893169837 hypothetical protein RHECIAT_CH0003587 [Rhizobium etli 1 8e-26
190893169 837 hypothetical protein RHECIAT_CH0003587 [Rhizobium etli 1 3e-15
327190965837 hypothetical protein RHECNPAF_3500073 [Rhizobium etli C 1 9e-26
327190965 837 hypothetical protein RHECNPAF_3500073 [Rhizobium etli C 1 3e-15
209550664836 hypothetical protein Rleg2_3088 [Rhizobium leguminosaru 1 9e-26
>gi|315121812|ref|YP_004062301.1| putative transmembrane protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 500 Back     alignment and organism information
 Score =  564 bits (1454), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 294/504 (58%), Positives = 382/504 (75%), Gaps = 8/504 (1%)

Query: 1   MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRLPKEILERQFNKLEQA 60
           MVDF+LVIQRAVDNL ENTPE RSHIYE AR +V+R+LESM PR P++ILERQ +KLE+A
Sbjct: 1   MVDFVLVIQRAVDNLSENTPEMRSHIYERARVAVSRQLESMNPRTPRDILERQLSKLEKA 60

Query: 61  ILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSISSILRSNKHKKLANILS 120
           ILQVE++N+K      +D+    PKS V SK+N+FL  RL SISSILR+ K K+  +I+S
Sbjct: 61  ILQVERKNKKFPRALDKDRVLLAPKSHVNSKKNVFLTSRLTSISSILRNRKRKRTVDIVS 120

Query: 121 VQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAAIEHDKSRLRRGKLAGIF 180
            +G  +T T+  P     +LR+IL  S N Q   ++ +  + +IE++K+RLRR KL   F
Sbjct: 121 TKGNKKTTTH-RP----YQLRDILHLSSNVQQGSNAQILSMESIEYNKNRLRRDKLLRKF 175

Query: 181 SFPTG-SIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLIILLGMAIGVSYSIGKSK 239
           S  +  SIF+ + +YF NK R  +SFY+AL E+H FK  VFL++ LGM +G+SYS  ++K
Sbjct: 176 SVSSSRSIFFLLQSYFSNKIRVFISFYTALLEYHFFKQSVFLVVFLGMMMGLSYSFWQNK 235

Query: 240 GSITHFLRRESLDGGNVDKKNVFS-GIRPKITRRLLEDGSEVDVGPSTIPVADFANTSNI 298
            S +H L  + L+  + +KK + + G RPKITRRLL +GSEVD+G +     + +NTSN+
Sbjct: 236 VSFSHILENKILNRDSDNKKVLHALGSRPKITRRLLANGSEVDMGTAISSPINSSNTSNV 295

Query: 299 AFKNYI-GGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQSSILSGKILWSLQQEKSQ 357
            FKN+I   D+  + +L +K+    NP+  +GRVFIN+G G+SSI +G I WSLQ+EK+Q
Sbjct: 296 FFKNHIDSNDQAVSHILERKKSGTENPIDEDGRVFINQGSGRSSIFAGNIFWSLQKEKTQ 355

Query: 358 GLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMFSFPKESQDAVVDLRRISM 417
           GLKGLVIKGDIP I+NAFSAS+TLKCNADI+LS+TH+MEI FSFPKESQ+++VDLR+ISM
Sbjct: 356 GLKGLVIKGDIPTINNAFSASITLKCNADIALSVTHLMEITFSFPKESQNSIVDLRQISM 415

Query: 418 RKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKILEEYRFIDIPITYRSGQKIL 477
           RKT+NSPS+LIDSNIF ISKNSYLISLKG  ED  RNSKILEEYR+IDIPITY SGQKI 
Sbjct: 416 RKTENSPSILIDSNIFRISKNSYLISLKGDAEDFLRNSKILEEYRWIDIPITYHSGQKIT 475

Query: 478 FTIDKGKKGADIFKSAIMQWENRS 501
            TIDKGK G+D+FKSA+M W++ S
Sbjct: 476 LTIDKGKVGSDVFKSAVMDWKDHS 499


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116253508|ref|YP_769346.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 851 Back     alignment and organism information
>gi|116253508|ref|YP_769346.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 851 Back     alignment and organism information
>gi|241206035|ref|YP_002977131.1| hypothetical protein Rleg_3345 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 841 Back     alignment and organism information
>gi|241206035|ref|YP_002977131.1| hypothetical protein Rleg_3345 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 841 Back     alignment and organism information
>gi|190893169|ref|YP_001979711.1| hypothetical protein RHECIAT_CH0003587 [Rhizobium etli CIAT 652] Length = 837 Back     alignment and organism information
>gi|190893169|ref|YP_001979711.1| hypothetical protein RHECIAT_CH0003587 [Rhizobium etli CIAT 652] Length = 837 Back     alignment and organism information
>gi|327190965|gb|EGE58019.1| hypothetical protein RHECNPAF_3500073 [Rhizobium etli CNPAF512] Length = 837 Back     alignment and organism information
>gi|327190965|gb|EGE58019.1| hypothetical protein RHECNPAF_3500073 [Rhizobium etli CNPAF512] Length = 837 Back     alignment and organism information
>gi|209550664|ref|YP_002282581.1| hypothetical protein Rleg2_3088 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 836 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target503 putative transmembrane protein [Candidatus Liberibacter
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 5e-04
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
 Score = 41.1 bits (95), Expect = 5e-04
 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 19/46 (41%)

Query: 354 EKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADIS---LSITHVME 396
           EK Q LK L              AS  LK  AD S   L+I   ME
Sbjct: 18  EK-QALKKL-------------QAS--LKLYADDSAPALAIKATME 47


Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00