254780624

254780624

ubiquinone/menaquinone biosynthesis methyltransferase

GeneID in NCBI database:8209624Locus tag:CLIBASIA_02555
Protein GI in NCBI database:254780624Protein Accession:YP_003065037.1
Gene range:+(647012, 647809)Protein Length:265aa
Gene description:ubiquinone/menaquinone biosynthesis methyltransferase
COG prediction:[H] Methylase involved in ubiquinone/menaquinone biosynthesis
KEGG prediction:ubiE; ubiquinone/menaquinone biosynthesis methyltransferase (EC:2.1.1.-); K03183 ubiquinone/menaquinone biosynthesis methyltransferase [EC:2.1.1.-]
SEED prediction:Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-)
Pathway involved in KEGG:Ubiquinone and other terpenoid-quinone biosynthesis [PATH:las00130]
Subsystem involved in SEED:Ubiquinone Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----
MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWKCENIGSVV
ccccccccccccEEEcccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccccHHHHHHHHHccccHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHccccEEEEEEccccEEEEEEEEEEHHHHccc
ccccccccccccccccccEEccHHHHHHHHHHHHHHHHHHccHHHHHHHccHHHHHHHHHHHccccccccccEEEEccccccHHHHHHHHHcccccEEEEEcccHHHHHccHHHHHHccccccccEEEccHHHcccccccccEEEEEHcccccccHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHHccHHccEEcccHHHHHHHHHHHHccccHHHHHHHHHHcccccEEEccccHHHHHEccccccccccccc
mtkdrfdsdnnmktsygfrevpeeeKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMvtnlnprkskdyrvldvaggtGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANaetlpfeansfdactlafgirnmphITLVLQEIYRILKCGGRLLVLEFsevqgpvfkkiydmwsfkvipqlgrfiagdeepYQYLIESIRRFPNQQDFAAVISaagfsnvsftnytNGVVALHsgwkcenigsvv
mtkdrfdsdnnmktsygfrevpeeekQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTnlnprkskdyrvLDVAGGTGDVAFRiaeasdnrsqivVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALhsgwkcenigsvv
MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWKCENIGSVV
*******************EVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWKCENIGS**
**********NMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWKCENIGSVV
************KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWKCENIG***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWKCENIGSVV
MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWKCENIGSVV
MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWKCENIGSVV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target265 ubiquinone/menaquinone biosynthesis methyltransferase [
254780869 559 beta-lactamase domain-containing protein [Candidat 0.024
254780635412 hypothetical protein CLIBASIA_02610 [Candidatus Li 0.043
>gi|254780869|ref|YP_003065282.1| beta-lactamase domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 559 Back     alignment
 Score = 30.8 bits (68), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 29/56 (51%)

Query: 144 CTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIP 199
           C ++F   ++P + LV  +I  I+K    L+ +  +      +  ++D+WSF  +P
Sbjct: 39  CGVSFPKDDLPGVDLVFPDITFIMKERKNLMAIFITHAHEDHYGALHDLWSFLHVP 94

>gi|254780635|ref|YP_003065048.1| hypothetical protein CLIBASIA_02610 [Candidatus Liberibacter asiaticus str. psy62] Length = 412 Back     alignment
 Score = 30.0 bits (66), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 44/92 (47%), Gaps = 5/92 (5%)

Query: 36  RVSHRYDVMNDLMSLGLH----RFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEA 91
           R  HR + ++  ++ G H      W + + TN+    ++ Y   D+   TG    R  E 
Sbjct: 156 RKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEY 215

Query: 92  SDNRSQIVVADINNEMLSVGRD-RAFKENLQD 122
               S+I+V+D+   M + G D +A K+ ++D
Sbjct: 216 LKVVSKILVSDLEEMMKAWGPDGQATKDLMKD 247

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target265 ubiquinone/menaquinone biosynthesis methyltransferase [
315121825258 ubiquinone/menaquinone biosynthesis methyltransferase [ 1 1e-129
222147313258 ubiquinone/menaquinone biosynthesis methyltransferase [ 1 2e-98
116250140258 ubiquinone/menaquinone biosynthesis methyltransferase [ 1 4e-98
327188619507 ubiquinone/menaquinone biosynthesis methyltransferase p 1 7e-98
241207317258 ubiquinone/menaquinone biosynthesis methyltransferase [ 1 9e-98
222084646258 ubiquinone/menaquinone biosynthesis methyltransferase p 1 1e-97
190890022258 ubiquinone/menaquinone biosynthesis methyltransferase [ 1 1e-97
86356011258 ubiquinone/menaquinone biosynthesis methyltransferase [ 1 2e-97
325291754258 ubiquinone/menaquinone biosynthesis methyltransferase [ 1 8e-97
209551934258 ubiquinone/menaquinone biosynthesis methyltransferase [ 1 1e-96
>gi|315121825|ref|YP_004062314.1| ubiquinone/menaquinone biosynthesis methyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 258 Back     alignment and organism information
 Score =  464 bits (1194), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 214/257 (83%), Positives = 239/257 (92%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MTKDRFDSD  MKTSYGFREV EEEKQNMVNHVFSRVSHRYD+MNDLMSLGLHRFWKEAM
Sbjct: 1   MTKDRFDSDEKMKTSYGFREVLEEEKQNMVNHVFSRVSHRYDIMNDLMSLGLHRFWKEAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           VT LNP+KS  YRVLD+AGGTGDVAFRIAEASD +SQIVVADIN+ MLSVGRDR+FKENL
Sbjct: 61  VTALNPQKSVHYRVLDIAGGTGDVAFRIAEASDKKSQIVVADINSAMLSVGRDRSFKENL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
           QD ITF+EA+AE LPF++NSFD+CTLAFGIRNMPHI LVLQEIYRILK GGRLL+LEFSE
Sbjct: 121 QDNITFVEADAERLPFKSNSFDSCTLAFGIRNMPHIKLVLQEIYRILKYGGRLLILEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           VQ P+ +KIY++WSF VIPQ+G+ +AGD+EPYQYL+ESIRRFPNQQDFA +IS+A FS+V
Sbjct: 181 VQEPLLRKIYNLWSFSVIPQIGKLVAGDDEPYQYLVESIRRFPNQQDFAEIISSANFSSV 240

Query: 241 SFTNYTNGVVALHSGWK 257
           SFTNYTNG+VALHSGWK
Sbjct: 241 SFTNYTNGIVALHSGWK 257


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222147313|ref|YP_002548270.1| ubiquinone/menaquinone biosynthesis methyltransferase [Agrobacterium vitis S4] Length = 258 Back     alignment and organism information
>gi|116250140|ref|YP_765978.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 258 Back     alignment and organism information
>gi|327188619|gb|EGE55829.1| ubiquinone/menaquinone biosynthesis methyltransferase protein [Rhizobium etli CNPAF512] Length = 507 Back     alignment and organism information
>gi|241207317|ref|YP_002978413.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 258 Back     alignment and organism information
>gi|222084646|ref|YP_002543175.1| ubiquinone/menaquinone biosynthesis methyltransferase protein [Agrobacterium radiobacter K84] Length = 258 Back     alignment and organism information
>gi|190890022|ref|YP_001976564.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhizobium etli CIAT 652] Length = 258 Back     alignment and organism information
>gi|86356011|ref|YP_467903.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhizobium etli CFN 42] Length = 258 Back     alignment and organism information
>gi|325291754|ref|YP_004277618.1| ubiquinone/menaquinone biosynthesis methyltransferase [Agrobacterium sp. H13-3] Length = 258 Back     alignment and organism information
>gi|209551934|ref|YP_002283851.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 258 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target265 ubiquinone/menaquinone biosynthesis methyltransferase [
PRK00216239 PRK00216, ubiE, ubiquinone/menaquinone biosynthesis met 2e-95
TIGR01934223 TIGR01934, MenG_MenH_UbiE, ubiquinone/menaquinone biosy 3e-76
COG2226238 COG2226, UbiE, Methylase involved in ubiquinone/menaqui 2e-73
pfam01209233 pfam01209, Ubie_methyltran, ubiE/COQ5 methyltransferase 3e-69
TIGR02752231 TIGR02752, MenG_heptapren, 2-heptaprenyl-1,4-naphthoqui 6e-46
PLN02233261 PLN02233, PLN02233, ubiquinone biosynthesis methyltrans 3e-27
TIGR02072240 TIGR02072, BioC, biotin biosynthesis protein BioC 1e-07
PRK05785226 PRK05785, PRK05785, hypothetical protein; Provisional 7e-04
KOG1540296 KOG1540, KOG1540, KOG1540, Ubiquinone biosynthesis meth 5e-77
pfam0824195 pfam08241, Methyltransf_11, Methyltransferase domain 3e-15
PRK08317241 PRK08317, PRK08317, hypothetical protein; Provisional 9e-14
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent 9e-10
pfam0824298 pfam08242, Methyltransf_12, Methyltransferase domain 7e-09
KOG4300252 KOG4300, KOG4300, KOG4300, Predicted methyltransferase 9e-05
COG2227243 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy 1e-04
KOG1269364 KOG1269, KOG1269, KOG1269, SAM-dependent methyltransfer 1e-04
COG2519256 COG2519, GCD14, tRNA(1-methyladenosine) methyltransfera 0.003
KOG1541270 KOG1541, KOG1541, KOG1541, Predicted protein carboxyl m 0.003
PLN02232160 PLN02232, PLN02232, ubiquinone biosynthesis methyltrans 7e-11
PRK11873272 PRK11873, arsM, arsenite S-adenosylmethyltransferase; R 5e-05
PLN02490340 PLN02490, PLN02490, MPBQ/MSBQ methyltransferase 2e-10
COG0500257 COG0500, SmtA, SAM-dependent methyltransferases [Second 5e-06
KOG1663237 KOG1663, KOG1663, KOG1663, O-methyltransferase [Seconda 0.001
COG0144355 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Tra 0.004
COG2230283 COG2230, Cfa, Cyclopropane fatty acid synthase and rela 2e-04
>gnl|CDD|178932 PRK00216, ubiE, ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|162613 TIGR01934, MenG_MenH_UbiE, ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>gnl|CDD|32408 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|110227 pfam01209, Ubie_methyltran, ubiE/COQ5 methyltransferase family Back     alignment and domain information
>gnl|CDD|131799 TIGR02752, MenG_heptapren, 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>gnl|CDD|177877 PLN02233, PLN02233, ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>gnl|CDD|162684 TIGR02072, BioC, biotin biosynthesis protein BioC Back     alignment and domain information
>gnl|CDD|180257 PRK05785, PRK05785, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|36753 KOG1540, KOG1540, KOG1540, Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|149353 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|181382 PRK08317, PRK08317, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|149354 pfam08242, Methyltransf_12, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|39501 KOG4300, KOG4300, KOG4300, Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|32409 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|36483 KOG1269, KOG1269, KOG1269, SAM-dependent methyltransferases [Lipid transport and metabolism, General function prediction only] Back     alignment and domain information
>gnl|CDD|32589 COG2519, GCD14, tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|36754 KOG1541, KOG1541, KOG1541, Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>gnl|CDD|165876 PLN02232, PLN02232, ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>gnl|CDD|183351 PRK11873, arsM, arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|178108 PLN02490, PLN02490, MPBQ/MSBQ methyltransferase Back     alignment and domain information
>gnl|CDD|30846 COG0500, SmtA, SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|36876 KOG1663, KOG1663, KOG1663, O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|30493 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|32411 COG2230, Cfa, Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 265 ubiquinone/menaquinone biosynthesis methyltransferase [
TIGR01934242 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis meth 100.0
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 100.0
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 100.0
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 100.0
KOG1540296 consensus 100.0
PRK05785225 hypothetical protein; Provisional 100.0
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methylt 100.0
PRK08317241 hypothetical protein; Provisional 100.0
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 99.96
PTZ00098263 phosphoethanolamine N-methyltransferase; Provisional 99.96
TIGR02072272 BioC biotin biosynthesis protein BioC; InterPro: IPR011 99.94
PRK01683252 trans-aconitate 2-methyltransferase; Provisional 99.91
PRK11036256 putative metallothionein SmtA; Provisional 99.88
pfam02353273 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. Thi 99.88
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.87
KOG4300252 consensus 99.86
COG2230283 Cfa Cyclopropane fatty acid synthase and related methyl 99.85
KOG1270282 consensus 99.82
TIGR02021224 BchM-ChlM magnesium protoporphyrin O-methyltransferase; 99.78
PRK06202233 hypothetical protein; Provisional 99.69
COG4976287 Predicted methyltransferase (contains TPR repeat) [Gene 99.55
pfam08003315 Methyltransf_9 Protein of unknown function (DUF1698). T 99.51
TIGR00740247 TIGR00740 methyltransferase, putative; InterPro: IPR005 99.48
KOG2361264 consensus 99.45
PRK00517298 prmA ribosomal protein L11 methyltransferase; Reviewed 99.31
KOG1975389 consensus 99.28
COG2521287 Predicted archaeal methyltransferase [General function 99.28
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, ribo 99.14
TIGR00452316 TIGR00452 methyltransferase, putative; InterPro: IPR010 99.12
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU; InterPro: 99.05
pfam05891217 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransfer 99.01
KOG3178342 consensus 98.99
KOG3191209 consensus 97.95
pfam05971254 Methyltransf_10 Protein of unknown function (DUF890). T 97.88
pfam04672268 DUF574 Protein of unknown function (DUF574). Family of 97.76
COG1189245 Predicted rRNA methylase [Translation, ribosomal struct 97.57
pfam03514371 GRAS GRAS family transcription factor. Sequence analysi 92.76
PRK11873258 arsM arsenite S-adenosylmethyltransferase; Reviewed 99.97
TIGR01983275 UbiG ubiquinone biosynthesis O-methyltransferase; Inter 99.93
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzo 99.84
pfam07021193 MetW Methionine biosynthesis protein MetW. This family 99.71
pfam05148214 Methyltransf_8 Hypothetical methyltransferase. This fam 99.53
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 99.51
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 99.48
TIGR02081205 metW methionine biosynthesis protein MetW; InterPro: IP 99.47
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 99.43
KOG3045325 consensus 99.4
pfam03291327 Pox_MCEL mRNA capping enzyme. This family of enzymes ar 99.38
KOG1271227 consensus 99.23
PRK09329285 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 99.23
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 99.21
pfam12147311 Hydrolase_5 Putative lysophospholipase. This domain is 99.03
pfam05219265 DREV DREV methyltransferase. This family contains DREV 99.03
TIGR03438301 probable methyltransferase. This model represents a dis 98.69
KOG2899288 consensus 98.68
pfam06080201 DUF938 Protein of unknown function (DUF938). This famil 98.62
pfam07942268 N2227 N2227-like protein. This family features sequence 98.49
pfam01234261 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family. 98.44
TIGR03439319 methyl_EasF probable methyltransferase domain, EasF fam 98.2
), spermine synthase () and putrescine N-methyltransferase () . The Thermotoga maritima spermidine synthase monomer consists of two domains: an N-terminal domain composed of six beta-strands, and a Rossmann-like C- terminal domain . The larger C-terminal catalytic core domain consists of a seven-stranded beta-sheet flanked by nine alpha helices. This domain resembles a topology observed in a number of nucleotide and dinucleotide-binding enzymes, and in S-adenosyl-L-methionine (AdoMet)- dependent methyltransferase (MTases) . ; GO: 0003824 catalytic activity." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00417">TIGR00417284 speE spermidine synthase; InterPro: IPR001045 Synonym(s 98.17
PTZ00146296 fibrillarin; Provisional 98.0
PRK04266226 fibrillarin; Provisional 97.9
pfam11968220 DUF3321 Protein of unknown function (DUF3321). This fam 97.77
pfam03059277 NAS Nicotianamine synthase protein. Nicotianamine synth 97.63
COG4798238 Predicted methyltransferase [General function predictio 97.45
pfam03492331 Methyltransf_7 SAM dependent carboxyl methyltransferase 97.35
PRK11727326 putative SAM-dependent methyltransferase; Provisional 97.28
KOG2798369 consensus 96.81
PRK13341726 recombination factor protein RarA/unknown domain fusion 96.63
PRK08507275 prephenate dehydrogenase; Validated 94.6
COG4301321 Uncharacterized conserved protein [Function unknown] 93.7
KOG2918335 consensus 92.66
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.97
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Provisio 99.63
KOG1541270 consensus 99.42
COG4123248 Predicted O-methyltransferase [General function predict 99.33
pfam05401201 NodS Nodulation protein S (NodS). This family consists 99.32
KOG1331293 consensus 99.24
pfam06325294 PrmA Ribosomal protein L11 methyltransferase (PrmA). Th 99.18
COG1041347 Predicted DNA modification methylase [DNA replication, 99.03
TIGR00406330 prmA ribosomal protein L11 methyltransferase; InterPro: 98.89
PRK00107216 gidB glucose-inhibited division protein B; Reviewed 98.72
pfam02527184 GidB rRNA small subunit methyltransferase G. This is a 98.53
COG0357215 GidB Predicted S-adenosylmethionine-dependent methyltra 98.53
TIGR00138197 gidB methyltransferase GidB; InterPro: IPR003682 GidB ( 98.29
PRK01581363 speE spermidine synthase; Validated 98.15
KOG1709271 consensus 97.62
KOG1099294 consensus 96.91
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, ribo 96.21
PRK11783716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 96.18
TIGR00478240 tly hemolysin A; InterPro: IPR004538 Hemolysins are exo 96.15
KOG0024354 consensus 95.84
KOG2198375 consensus 95.74
pfam05711249 TylF Macrocin-O-methyltransferase (TylF). This family c 90.5
KOG1227351 consensus 90.17
smart00828224 PKS_MT Methyltransferase in polyketide synthase (PKS) e 99.94
pfam0824195 Methyltransf_11 Methyltransferase domain. Members of th 99.82
pfam0824298 Methyltransf_12 Methyltransferase domain. Members of th 99.78
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 99.76
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.62
pfam05175170 MTS Methyltransferase small domain. This domain is foun 99.6
PRK11207198 tellurite resistance protein TehB; Provisional 99.54
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 99.54
KOG3010261 consensus 99.47
PRK06922679 hypothetical protein; Provisional 99.45
PRK08287186 cobalt-precorrin-6Y C(15)-methyltransferase; Validated 99.44
COG4106257 Tam Trans-aconitate methyltransferase [General function 99.43
pfam01135205 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransf 99.42
PRK01544 503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 99.41
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] 99.41
PRK13942214 protein-L-isoaspartate O-methyltransferase; Provisional 99.4
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 99.39
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase and rel 99.37
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provisional 99.36
pfam03848192 TehB Tellurite resistance protein TehB. 99.29
PRK07402196 precorrin-6B methylase; Provisional 99.29
pfam08704309 GCD14 tRNA methyltransferase complex GCD14 subunit. GCD 99.28
TIGR02469135 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylat 99.26
KOG1269364 consensus 99.25
KOG2940325 consensus 99.24
PRK00312213 pcm protein-L-isoaspartate O-methyltransferase; Reviewe 99.24
PRK13943317 protein-L-isoaspartate O-methyltransferase; Provisional 99.24
pfam01170171 UPF0020 Putative RNA methylase family UPF0020. This dom 99.2
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provi 99.12
pfam01596204 Methyltransf_3 O-methyltransferase. Members of this fam 99.11
pfam00891239 Methyltransf_2 O-methyltransferase. This family include 99.05
pfam02390199 Methyltransf_4 Putative methyltransferase. This is a fa 99.03
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransferase [P 99.03
PRK00121229 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed 99.01
COG4122219 Predicted O-methyltransferase [General function predict 98.99
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosom 98.99
COG0220227 Predicted S-adenosylmethionine-dependent methyltransfer 98.96
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 98.94
PRK12335289 tellurite resistance protein TehB; Provisional 98.93
KOG1499346 consensus 98.85
PRK10901428 16S rRNA methyltransferase B; Provisional 98.85
TIGR00091216 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; Inter 98.85
pfam09243275 Rsm22 Mitochondrial small ribosomal subunit Rsm22. Rsm2 98.78
TIGR00477239 tehB tellurite resistance protein TehB; InterPro: IPR00 98.76
KOG2904328 consensus 98.72
) (PCMT) (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyzes the transfer of a methyl group from S- adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerization of normal L-aspartyl and L- asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00080">TIGR00080228 pimt protein-L-isoaspartate O-methyltransferase; InterP 98.7
PRK11933 471 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Revi 98.67
TIGR00537183 hemK_rel_arch methylase, putative; InterPro: IPR004557 98.63
pfam03141 506 DUF248 Putative methyltransferase. Members of this fami 98.63
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Methylate 98.62
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.62
pfam01189277 Nol1_Nop2_Fmu NOL1/NOP2/sun family. 98.62
KOG1661237 consensus 98.59
COG0500257 SmtA SAM-dependent methyltransferases [Secondary metabo 98.59
pfam02384312 N6_Mtase N-6 DNA Methylase. Restriction-modification (R 98.58
PRK04457262 spermidine synthase; Provisional 98.56
TIGR00563487 rsmB ribosomal RNA small subunit methyltransferase B; I 98.53
pfam01739194 CheR CheR methyltransferase, SAM binding domain. CheR p 98.52
TIGR00479434 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; Inter 98.49
COG1352268 CheR Methylase of chemotaxis methyl-accepting proteins 98.48
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translation, 98.47
TIGR00438192 rrmJ ribosomal RNA large subunit methyltransferase J; I 98.47
KOG1663237 consensus 98.47
COG1092393 Predicted SAM-dependent methyltransferases [General fun 98.46
pfam10294171 Methyltransf_16 Putative methyltransferase. 98.41
PRK10611287 chemotaxis methyltransferase CheR; Provisional 98.38
KOG1500 517 consensus 98.36
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism] 98.36
COG0421282 SpeE Spermidine synthase [Amino acid transport and meta 98.35
COG2520341 Predicted methyltransferase [General function predictio 98.33
pfam05724203 TPMT Thiopurine S-methyltransferase (TPMT). This family 98.31
PRK03612516 spermidine synthase; Provisional 98.3
PRK00811283 spermidine synthase; Provisional 98.29
pfam01564240 Spermine_synth Spermine/spermidine synthase. Spermine a 98.27
PRK10909198 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional 98.26
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associated met 98.17
KOG2915314 consensus 98.17
pfam10672286 Methyltrans_SAM S-adenosylmethionine-dependent methyltr 98.16
pfam01728176 FtsJ FtsJ-like methyltransferase. This family consists 98.16
pfam08123205 DOT1 Histone methylation protein DOT1. The DOT1 domain 98.14
COG0742187 N6-adenine-specific methylase [DNA replication, recombi 98.09
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal structu 98.09
PRK01544503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 98.05
pfam03602181 Cons_hypoth95 Conserved hypothetical protein 95. 97.98
pfam01269229 Fibrillarin Fibrillarin. 97.96
KOG3987288 consensus 97.86
KOG1122460 consensus 97.8
KOG2352 482 consensus 97.72
TIGR00446284 nop2p NOL1/NOP2/sun family putative RNA methylase; Inte 97.72
PRK13255218 thiopurine S-methyltransferase; Reviewed 97.68
pfam02005 375 TRM N2,N2-dimethylguanosine tRNA methyltransferase. Thi 97.43
PRK11783 716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 97.4
PRK00536262 speE spermidine synthase; Provisional 97.39
pfam06962140 rRNA_methylase Putative rRNA methylase. This family con 97.37
pfam05185447 PRMT5 PRMT5 arginine-N-methyltransferase. The human hom 97.32
COG4262508 Predicted spermidine synthase with an N-terminal membra 97.27
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 97.18
PRK09880343 L-idonate 5-dehydrogenase; Provisional 97.13
PRK00050309 mraW S-adenosyl-methyltransferase MraW; Provisional 97.01
pfam01795310 Methyltransf_5 MraW methylase family. Members of this f 97.0
COG0286489 HsdM Type I restriction-modification system methyltrans 96.89
PRK04338 376 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Pro 96.84
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 96.83
COG5459 484 Predicted rRNA methylase [Translation, ribosomal struct 96.77
KOG3115249 consensus 96.65
PRK10083339 putative dehydrogenase; Provisional 96.58
KOG1253 525 consensus 96.35
COG4076252 Predicted RNA methylase [General function prediction on 96.33
KOG3201201 consensus 96.24
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh 96.16
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 96.16
TIGR01177358 TIGR01177 conserved hypothetical protein TIGR01177; Int 96.12
PRK13771332 putative alcohol dehydrogenase; Provisional 96.06
KOG2539491 consensus 96.06
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 95.88
COG1063350 Tdh Threonine dehydrogenase and related Zn-dependent de 95.79
KOG0822649 consensus 95.76
KOG4058199 consensus 95.67
PRK09422338 alcohol dehydrogenase; Provisional 95.59
COG3897218 Predicted methyltransferase [General function predictio 95.4
TIGR00095210 TIGR00095 putative methyltransferase; InterPro: IPR0043 95.34
PRK13256226 thiopurine S-methyltransferase; Reviewed 95.2
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Tr 95.13
pfam07091248 FmrO Ribosomal RNA methyltransferase (FmrO). This famil 95.05
pfam00107131 ADH_zinc_N Zinc-binding dehydrogenase. 95.02
pfam04989202 CmcI Cephalosporin hydroxylase. Members of this family 94.98
KOG4589232 consensus 94.75
TIGR00692341 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L- 94.57
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 94.47
KOG1269364 consensus 94.38
TIGR02817338 adh_fam_1 zinc-binding alcohol dehydrogenase family pro 94.07
PRK07417 280 arogenate dehydrogenase; Reviewed 94.04
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 94.02
KOG1596317 consensus 93.59
KOG1562337 consensus 92.91
KOG2793248 consensus 92.33
pfam11312288 DUF3115 Protein of unknown function (DUF3115). This euk 92.03
pfam03141506 DUF248 Putative methyltransferase. Members of this fami 91.79
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 91.27
PRK11760356 putative RNA 2'-O-ribose methyltransferase; Provisional 90.31
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provisional 90.05
pfam09445165 Methyltransf_15 RNA cap guanine-N2 methyltransferase. R 98.72
TIGR00755277 ksgA dimethyladenosine transferase; InterPro: IPR011530 98.72
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 98.49
PRK05031363 tRNA (uracil-5-)-methyltransferase; Validated 98.39
PRK03522375 rumB 23S rRNA methyluridine methyltransferase; Reviewed 98.38
PTZ00338296 dimethyladenosine transferase; Provisional 98.36
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylation) [ 98.31
pfam05958353 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. Thi 98.27
KOG3420185 consensus 98.18
KOG0820315 consensus 98.16
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA replic 98.15
PRK13168440 rumA 23S rRNA 5-methyluridine methyltransferase; Review 98.15
COG2265432 TrmA SAM-dependent methyltransferases related to tRNA ( 98.14
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.04
pfam00398258 RrnaAD Ribosomal RNA adenine dimethylase. 98.01
PRK00274267 ksgA dimethyladenosine transferase; Reviewed 97.98
KOG2187534 consensus 97.94
pfam04816204 DUF633 Family of unknown function (DUF633). This family 97.73
COG0275314 Predicted S-adenosylmethionine-dependent methyltransfer 97.69
KOG2730263 consensus 97.57
PHA02056279 putative methyltransferase 97.1
COG2384226 Predicted SAM-dependent methyltransferase [General func 96.47
TIGR02143361 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: 96.37
KOG1501 636 consensus 96.34
TIGR00536311 hemK_fam methyltransferase, HemK family; InterPro: IPR0 96.14
TIGR02085386 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase R 94.28
pfam04445235 DUF548 Protein of unknown function (DUF548). Protein of 90.63
COG4627185 Uncharacterized protein conserved in bacteria [Function 97.53
PRK11524 284 putative methyltransferase; Provisional 95.21
PRK13699227 putative methylase; Provisional 93.99
PRK01747 660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 94.77
COG1565370 Uncharacterized conserved protein [Function unknown] 93.64
pfam02636240 DUF185 Uncharacterized ACR, COG1565. This family contai 93.48
TIGR01444142 fkbM_fam methyltransferase, FkbM family; InterPro: IPR0 92.78
KOG2920282 consensus 92.06
pfam06859110 Bin3 Bicoid-interacting protein 3 (Bin3). This family r 93.22
pfam05430124 DUF752 Protein of unknown function (DUF752). This famil 92.57
PRK13699227 putative methylase; Provisional 92.61
PRK11524284 putative methyltransferase; Provisional 92.55
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1540 consensus Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase; InterPro: IPR014122 MenG is a generic term for a methyltransferase that catalyses the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC; InterPro: IPR011814 This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulphur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable) Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK11036 putative metallothionein SmtA; Provisional Back     alignment and domain information
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>KOG4300 consensus Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1270 consensus Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase; InterPro: IPR010251 Chlorophyll and bacteriochlorophyll are essential photosynthetic pigments involved in oxygenic and non-oxygenic photosythesis respectively Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>pfam08003 Methyltransf_9 Protein of unknown function (DUF1698) Back     alignment and domain information
>TIGR00740 TIGR00740 methyltransferase, putative; InterPro: IPR005271 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG2361 consensus Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>KOG1975 consensus Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00452 TIGR00452 methyltransferase, putative; InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU; InterPro: IPR014088 Members of this protein family include S-adenosylmethionine-dependent C-20 methyltransferase (BchU), part of the pathway of bacteriochlorophyll c production in photosynthetic green sulphur bacteria Back     alignment and domain information
>pfam05891 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransferase Back     alignment and domain information
>KOG3178 consensus Back     alignment and domain information
>KOG3191 consensus Back     alignment and domain information
>pfam05971 Methyltransf_10 Protein of unknown function (DUF890) Back     alignment and domain information
>pfam04672 DUF574 Protein of unknown function (DUF574) Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam03514 GRAS GRAS family transcription factor Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase; InterPro: IPR010233 This entry represents an O-methyltransferase, which is believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and mitochondria (COQ3) , Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>pfam07021 MetW Methionine biosynthesis protein MetW Back     alignment and domain information
>pfam05148 Methyltransf_8 Hypothetical methyltransferase Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>KOG3045 consensus Back     alignment and domain information
>pfam03291 Pox_MCEL mRNA capping enzyme Back     alignment and domain information
>KOG1271 consensus Back     alignment and domain information
>PRK09329 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam12147 Hydrolase_5 Putative lysophospholipase Back     alignment and domain information
>pfam05219 DREV DREV methyltransferase Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>KOG2899 consensus Back     alignment and domain information
>pfam06080 DUF938 Protein of unknown function (DUF938) Back     alignment and domain information
>pfam07942 N2227 N2227-like protein Back     alignment and domain information
>pfam01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>TIGR00417 speE spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>pfam11968 DUF3321 Protein of unknown function (DUF3321) Back     alignment and domain information
>pfam03059 NAS Nicotianamine synthase protein Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>pfam03492 Methyltransf_7 SAM dependent carboxyl methyltransferase Back     alignment and domain information
>PRK11727 putative SAM-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG2798 consensus Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>COG4301 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2918 consensus Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>KOG1541 consensus Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>pfam05401 NodS Nodulation protein S (NodS) Back     alignment and domain information
>KOG1331 consensus Back     alignment and domain information
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase; InterPro: IPR004498 Ribosomal protein L11 methyltransferase (2 Back     alignment and domain information
>PRK00107 gidB glucose-inhibited division protein B; Reviewed Back     alignment and domain information
>pfam02527 GidB rRNA small subunit methyltransferase G Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00138 gidB methyltransferase GidB; InterPro: IPR003682 GidB (glucose-inhibited division protein B) appears to be present and in a single copy in all complete eubacterial genomes so far Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>KOG1709 consensus Back     alignment and domain information
>KOG1099 consensus Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR00478 tly hemolysin A; InterPro: IPR004538 Hemolysins are exotoxins that attack blood cell membranes and cause cell rupture Back     alignment and domain information
>KOG0024 consensus Back     alignment and domain information
>KOG2198 consensus Back     alignment and domain information
>pfam05711 TylF Macrocin-O-methyltransferase (TylF) Back     alignment and domain information
>KOG1227 consensus Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>pfam08241 Methyltransf_11 Methyltransferase domain Back     alignment and domain information
>pfam08242 Methyltransf_12 Methyltransferase domain Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>pfam05175 MTS Methyltransferase small domain Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>KOG3010 consensus Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>pfam03848 TehB Tellurite resistance protein TehB Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>pfam08704 GCD14 tRNA methyltransferase complex GCD14 subunit Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; InterPro: IPR014008 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>KOG1269 consensus Back     alignment and domain information
>KOG2940 consensus Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>pfam01170 UPF0020 Putative RNA methylase family UPF0020 Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>pfam01596 Methyltransf_3 O-methyltransferase Back     alignment and domain information
>pfam00891 Methyltransf_2 O-methyltransferase Back     alignment and domain information
>pfam02390 Methyltransf_4 Putative methyltransferase Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>pfam02475 Met_10 Met-10+ like-protein Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>KOG1499 consensus Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00091 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; InterPro: IPR004395 This predicted S-adenosylmethionine-dependent methyltransferase is found in a single copy in most Bacteria Back     alignment and domain information
>pfam09243 Rsm22 Mitochondrial small ribosomal subunit Rsm22 Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB; InterPro: IPR004537 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>KOG2904 consensus Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate O-methyltransferase; InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>TIGR00537 hemK_rel_arch methylase, putative; InterPro: IPR004557 These proteins exhibit homology to the Saccharomyces cerevisiae (yeast) ORF YDR140w (FYV9) Back     alignment and domain information
>pfam03141 DUF248 Putative methyltransferase Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>pfam01189 Nol1_Nop2_Fmu NOL1/NOP2/sun family Back     alignment and domain information
>KOG1661 consensus Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>pfam02384 N6_Mtase N-6 DNA Methylase Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase B; InterPro: IPR004573 This family consists of bacterial sequences related to Escherichia coli rsmB, an rRNA SAM-dependent methyltransferase Back     alignment and domain information
>pfam01739 CheR CheR methyltransferase, SAM binding domain Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; InterPro: IPR001566 This protein family was first proposed to be RNA methyltransferases by homology to the TrmA family Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00438 rrmJ ribosomal RNA large subunit methyltransferase J; InterPro: IPR004512 The ribosomal RNA large subunit methyltransferase J 2 Back     alignment and domain information
>KOG1663 consensus Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>pfam10294 Methyltransf_16 Putative methyltransferase Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>KOG1500 consensus Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information