254780623

254780623

2-polyprenylphenol 6-hydroxylase

GeneID in NCBI database:8209623Locus tag:CLIBASIA_02550
Protein GI in NCBI database:254780623Protein Accession:YP_003065036.1
Gene range:+(647806, 649359)Protein Length:517aa
Gene description:2-polyprenylphenol 6-hydroxylase
COG prediction:[R] Predicted unusual protein kinase
KEGG prediction:ubiB; 2-polyprenylphenol 6-hydroxylase; K03688 ubiquinone biosynthesis protein
SEED prediction:Ubiquinone biosynthesis monooxygenase UbiB
Pathway involved in KEGG:Ubiquinone and other terpenoid-quinone biosynthesis [PATH:las00130]
Subsystem involved in SEED:Ubiquinone Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM3 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------
MKEYYELFRIAWILIREGVIVSLPSDRLPPIIVFGKKIASLFVRRNIKKCQRSDRLARAMNRLGPSYVKMGQFLATRPDLIGKKLSEDLALLQDKMDFFPTNTARLSVASALKAPIEELYCEFDDPIAAASIAQVHPAVVHDINGYRKVAVKIIRPGVRKRFFRDIQVMYLIARIQEKLLPSMRRLCFSAVVRALEQVTKMEMDLRLEAAAFSEMAENTVKDQGFRVPKIDWNRTERDVITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRERRFLAEILYGFISRDYQRVADVHFEAGYVPRHHNRFSFAQAIRAIGEPIHGQSSDVISMGKLLTMLFEITELFDMMTRPELVMLQKTMVVVEGVARMLNPEFNMWVSSEPIVEEWIRDHLGAKSCVVDFQDGIKTAFRLVQAAPQLSISVEKILKSLVESSVKDKYLDFPKKESSRVYDFLNKLVLWSIFGALLYIISIMR
cHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccEEEEEEEEEccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHcccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEccEEEcccccccEEEEEccccEEHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccEEcccccHHHEEEcccccEEEEEccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
cHHHHHHHHHHHHHHHcccHHHccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccEEEEHHHHHccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHcHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEccEcHccccccEEEEEEEccccccHHHHHHHccccHHHHHHHccEEEEEEEEcccccccccccccEEEcccccEEEEEccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHcHHHHHHccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
MKEYYELFRIAWILIREGVivslpsdrlppiivFGKKIASLFVRRNIKKCQRSDRLARAMNRLGPSYVKMGQFLATRPDLIGKKLSEDLALLQDkmdffptntARLSVASALKAPIEelycefddpiaaasIAQVHPAVVHDINGYRKVAVKIirpgvrkrFFRDIQVMYLIARIQEKLLPSMRRLCFSAVVRALEQVTKMEMDLRLEAAAFSEMAENTvkdqgfrvpkidwnrterdvitmewidgvkisdteklracghdleRLSVTLVQSFLLHTlrdgffhadlhpgnlfvdskgYIVAVDMGITGRLSKRERRFLAEILYGFISRDYQRVADVhfeagyvprhhnrfSFAQAIRAIgepihgqssdvISMGKLLTMLFEITELFDMMTRPELVMLQKTMVVVEGVARmlnpefnmwvssepiVEEWIRDhlgakscvvDFQDGIKTAFRLVQAAPQLSISVEKILKSLVESSvkdkyldfpkkessRVYDFLNKLVLWSIFGALLYIISIMR
MKEYYELFRIAWILIREGVIVSLPSDRLPPIIVFGKKiaslfvrrnikkcqrsdrlaramnrlgpsyvKMGQFLATRPDLIGKKLSEDLALLQDKMDFFPTNTARLSVASALKAPIEELYCEFDDPIAAASIAQVHPAVVHDINGYRKVAvkiirpgvrkrffRDIQVMYLIARIQEKLLPSMRRLCFSAVVRALEQVTKMEMDLRLEAAAFSEMaentvkdqgfrvpkidwnrterdvitmewidgvkisdtEKLRACGHDLERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRERRFLAEILYGFISRDYQRVADVHFEAGYVPRHHNRFSFAQAIRAIGEPIHGQSSDVISMGKLLTMLFEITELFDMMTRPELVMLQKTMVVVEGVARMLNPEFNMWVSSEPIVEEWIRDHLGAKSCVVDFQDGIKTAFRLVQAAPQLSISVEKILKSLVessvkdkyldfpkkessrvYDFLNKLVLWSIFGALLYIISIMR
MKEYYELFRIAWILIREGVIVSLPSDRLPPIIVFGKKIASLFVRRNIKKCQRSDRLARAMNRLGPSYVKMGQFLATRPDLIGKKLSEDLALLQDKMDFFPTNTARLSVASALKAPIEELYCEFDDPIAAASIAQVHPAVVHDINGYRKVAVKIIRPGVRKRFFRDIQVMYLIARIQEKLLPSMRRLCFSAVVRALEQVTKMEMDLRLEAAAFSEMAENTVKDQGFRVPKIDWNRTERDVITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRERRFLAEILYGFISRDYQRVADVHFEAGYVPRHHNRFSFAQAIRAIGEPIHGQSSDVISMGKLLTMLFEITELFDMMTRPELVMLQKTMVVVEGVARMLNPEFNMWVSSEPIVEEWIRDHLGAKSCVVDFQDGIKTAFRLVQAAPQLSISVEKILKSLVESSVKDKYLDFPKKESSRVYDFLNKLVLWSIFGALLYIISIMR
MKEYYELFRIAWILIREGVIVSLPSDRLPPIIVFGKKIAS****************ARAMNRLGPSYVKMGQFLATRPDLIGKKLSEDLALLQDKMDFFPTNTARLSVASALKAPIEELYCEFDDPIAAASIAQVHPAVVHDINGYRKVAVKIIRPGVRKRFFRDIQVMYLIARIQEKLLPSMRRLCFSAVVRALEQVTKMEMDLRLEAAAFSEMAENTVKDQGFRVPKIDWNRTERDVITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRERRFLAEILYGFISRDYQRVADVHFEAGYVPRHHNRFSFAQAIRAIGEPIHGQSSDVISMGKLLTMLFEITELFDMMTRPELVMLQKTMVVVEGVARMLNPEFNMWVSSEPIVEEWIRDHLGAKSCVVDFQDGIKTAFRLVQAAPQLSISV*****************************FLNKLVLWSIFGALLYIISIMR
MKEYYELFRIAWILIREGVIVSLPSDRLPPIIVFGKKIASLFVRRNIKKCQRSDRLARAMNRLGPSYVKMGQFLATRPDLIGKKLSEDLALLQDKMDFFPTNTARLSVASALKAPIEELYCEFDDPIAAASIAQVHPAVVHDINGYRKVAVKIIRPGVRKRFFRDIQVMYLIARIQEKLLPSMRRLCFSAVVRALEQVTKMEMDLRLEAAAFSEMAENTVKDQGFRVPKIDWNRTERDVITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRERRFLAEILYGFISRDYQRVADVHFEAGYVPRHHNRFSFAQAIRAIGEPIHGQSSDVISMGKLLTMLFEITELFDMMTRPELVMLQKTMVVVEGVARMLNPEFNMWVSSEPIVEEWIRDHLGAKSCVVDFQDGIKTAFRLVQAAPQLSISVEKILKSLVESSVKDKYLDFPKKESSRVYDFLNKLVLWSIFGALLYIISIMR
MKEYYELFRIAWILIREGVIVSLPSDRLPPIIVFGKKIASLFVRRNIKKCQRSDRLARAMNRLGPSYVKMGQFLATRPDLIGKKLSEDLALLQDKMDFFPTNTARLSVASALKAPIEELYCEFDDPIAAASIAQVHPAVVHDINGYRKVAVKIIRPGVRKRFFRDIQVMYLIARIQEKLLPSMRRLCFSAVVRALEQVTKMEMDLRLEAAAFSEMAENTVKDQGFRVPKIDWNRTERDVITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRERRFLAEILYGFISRDYQRVADVHFEAGYVPRHHNRFSFAQAIRAIGEPIHGQSSDVISMGKLLTMLFEITELFDMMTRPELVMLQKTMVVVEGVARMLNPEFNMWVSSEPIVEEWIRDHLGAKSCVVDFQDGIKTAFRLVQAAPQLSISVEKILKSLVESSVKDKYLDFPKKESSRVYDFLNKLVLWSIFGALLYIISIMR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEYYELFRIAWILIREGVIVSLPSDRLPPIIVFGKKIASLFVRRNIKKCQRSDRLARAMNRLGPSYVKMGQFLATRPDLIGKKLSEDLALLQDKMDFFPTNTARLSVASALKAPIEELYCEFDDPIAAASIAQVHPAVVHDINGYRKVAVKIIRPGVRKRFFRDIQVMYLIARIQEKLLPSMRRLCFSAVVRALEQVTKMEMDLRLEAAAFSEMAENTVKDQGFRVPKIDWNRTERDVITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRERRFLAEILYGFISRDYQRVADVHFEAGYVPRHHNRFSFAQAIRAIGEPIHGQSSDVISMGKLLTMLFEITELFDMMTRPELVMLQKTMVVVEGVARMLNPEFNMWVSSEPIVEEWIRDHLGAKSCVVDFQDGIKTAFRLVQAAPQLSISVEKILKSLVESSVKDKYLDFPKKESSRVYDFLNKLVLWSIFGALLYIISIMR
MKEYYELFRIAWILIREGVIVSLPSDRLPPIIVFGKKIASLFVRRNIKKCQRSDRLARAMNRLGPSYVKMGQFLATRPDLIGKKLSEDLALLQDKMDFFPTNTARLSVASALKAPIEELYCEFDDPIAAASIAQVHPAVVHDINGYRKVAVKIIRPGVRKRFFRDIQVMYLIARIQEKLLPSMRRLCFSAVVRALEQVTKMEMDLRLEAAAFSEMAENTVKDQGFRVPKIDWNRTERDVITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRERRFLAEILYGFISRDYQRVADVHFEAGYVPRHHNRFSFAQAIRAIGEPIHGQSSDVISMGKLLTMLFEITELFDMMTRPELVMLQKTMVVVEGVARMLNPEFNMWVSSEPIVEEWIRDHLGAKSCVVDFQDGIKTAFRLVQAAPQLSISVEKILKSLVESSVKDKYLDFPKKESSRVYDFLNKLVLWSIFGALLYIISIMR
MKEYYELFRIAWILIREGVIVSLPSDRLPPIIVFGKKIASLFVRRNIKKCQRSDRLARAMNRLGPSYVKMGQFLATRPDLIGKKLSEDLALLQDKMDFFPTNTARLSVASALKAPIEELYCEFDDPIAAASIAQVHPAVVHDINGYRKVAVKIIRPGVRKRFFRDIQVMYLIARIQEKLLPSMRRLCFSAVVRALEQVTKMEMDLRLEAAAFSEMAENTVKDQGFRVPKIDWNRTERDVITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRERRFLAEILYGFISRDYQRVADVHFEAGYVPRHHNRFSFAQAIRAIGEPIHGQSSDVISMGKLLTMLFEITELFDMMTRPELVMLQKTMVVVEGVARMLNPEFNMWVSSEPIVEEWIRDHLGAKSCVVDFQDGIKTAFRLVQAAPQLSISVEKILKSLVESSVKDKYLDFPKKESSRVYDFLNKLVLWSIFGALLYIISIMR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target517 2-polyprenylphenol 6-hydroxylase [Candidatus Liberibact
315121824504 2-polyprenylphenol 6-hydroxylase [Candidatus Liberibact 1 0.0
222084645524 2-polyprenylphenol 6-hydroxylase [Agrobacterium radioba 1 0.0
116250139524 ubiquinone biosynthesis protein [Rhizobium leguminosaru 1 0.0
222147312527 2-polyprenylphenol 6-hydroxylase [Agrobacterium vitis S 1 0.0
241207316524 2-polyprenylphenol 6-hydroxylase [Rhizobium leguminosar 1 0.0
209551933524 2-polyprenylphenol 6-hydroxylase [Rhizobium leguminosar 1 0.0
86356010524 ubiquinone biosynthesis protein [Rhizobium etli CFN 42] 1 0.0
190890021524 ubiquinone biosynthesis protein [Rhizobium etli CIAT 65 1 0.0
327188621524 ubiquinone biosynthesis protein [Rhizobium etli CNPAF51 1 0.0
15964116524 ubiquinone biosynthesis protein [Sinorhizobium meliloti 1 0.0
>gi|315121824|ref|YP_004062313.1| 2-polyprenylphenol 6-hydroxylase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 504 Back     alignment and organism information
 Score =  829 bits (2142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/504 (79%), Positives = 443/504 (87%), Gaps = 1/504 (0%)

Query: 15  IREGVIVSLPSDRLPPIIVFGKKIASLFVRRNIKKCQRSDRLARAMNRLGPSYVKMGQFL 74
           +REGV    PSD+LPPI+    ++ S  +RR I K  RSDRLARAM RLGPSYVKMGQFL
Sbjct: 1   MREGVTAYFPSDQLPPIVSLCNRVVSFVLRRRIIKYHRSDRLARAMARLGPSYVKMGQFL 60

Query: 75  ATRPDLIGKKLSEDLALLQDKMDFFPTNTARLSVASALKAPIEELYCEFDDPIAAASIAQ 134
           ATRPD++GKKLSEDLALLQDKMDFFPT TA+  V++ALK+PIEELY EF+DPIAAASIAQ
Sbjct: 61  ATRPDIVGKKLSEDLALLQDKMDFFPTRTAKFFVSAALKSPIEELYHEFNDPIAAASIAQ 120

Query: 135 VHPAVVHDINGYRKVAVKIIRPGVRKRFFRDIQVMYLIARIQEKLLPSMRRLCFSAVVRA 194
           VHPA+V DING RKVAVKIIRPG+R+RFFRDIQ MYL+ARIQE+L+PSM+RL  SA+V  
Sbjct: 121 VHPAIVDDINGCRKVAVKIIRPGIRQRFFRDIQTMYLVARIQERLIPSMKRLRLSAIVAT 180

Query: 195 LEQVTKMEMDLRLEAAAFSEMAENTVKDQGFRVPKIDWNRTERDVITMEWIDGVKISDTE 254
           LEQVTKMEMDLRLEAAAFSEMAEN  +D GFRVPK+DWNRT RDVITMEWIDG+KISDTE
Sbjct: 181 LEQVTKMEMDLRLEAAAFSEMAENIAQDHGFRVPKVDWNRTGRDVITMEWIDGIKISDTE 240

Query: 255 KLRACGHDLERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSK 314
           KLRA GHDLERLSVTL+QSFLLHTLRDGFFHADLHPGNLFVDSKG IVAVDMG+TGRL K
Sbjct: 241 KLRAAGHDLERLSVTLMQSFLLHTLRDGFFHADLHPGNLFVDSKGCIVAVDMGLTGRLGK 300

Query: 315 RERRFLAEILYGFISRDYQRVADVHFEAGYVPRHHNRFSFAQAIRAIGEPIHGQSSDVIS 374
           RERRFLAEILYGFISRDYQRVADVHFEAGYVP HHN  SFAQAIRAIGEPIHGQSSD+IS
Sbjct: 301 RERRFLAEILYGFISRDYQRVADVHFEAGYVPSHHNPASFAQAIRAIGEPIHGQSSDIIS 360

Query: 375 MGKLLTMLFEITELFDMMTRPELVMLQKTMVVVEGVARMLNPEFNMWVSSEPIVEEWIRD 434
           MGKLLTMLFEITELFDMMTR EL+MLQKTMVVVEGVARMLNPEFNMWVSSEPIV+EWIRD
Sbjct: 361 MGKLLTMLFEITELFDMMTRSELLMLQKTMVVVEGVARMLNPEFNMWVSSEPIVKEWIRD 420

Query: 435 HLGAKSCVVDFQDGIKTAFRLVQAAPQLSISVEKILKSLVESSVKDKYLDFPKKESSR-V 493
           H+G KS +VDFQDGIK A RLVQ  P LS  +EKI K+L+E+S KD +L+F K ES R +
Sbjct: 421 HIGPKSHIVDFQDGIKNAVRLVQGVPHLSAPIEKIFKALIEASEKDNFLNFSKTESPRSI 480

Query: 494 YDFLNKLVLWSIFGALLYIISIMR 517
           Y+++ KL L S+   L YIIS+M+
Sbjct: 481 YEYVGKLALLSVIIILFYIISVMQ 504


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084645|ref|YP_002543174.1| 2-polyprenylphenol 6-hydroxylase [Agrobacterium radiobacter K84] Length = 524 Back     alignment and organism information
>gi|116250139|ref|YP_765977.1| ubiquinone biosynthesis protein [Rhizobium leguminosarum bv. viciae 3841] Length = 524 Back     alignment and organism information
>gi|222147312|ref|YP_002548269.1| 2-polyprenylphenol 6-hydroxylase [Agrobacterium vitis S4] Length = 527 Back     alignment and organism information
>gi|241207316|ref|YP_002978412.1| 2-polyprenylphenol 6-hydroxylase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 524 Back     alignment and organism information
>gi|209551933|ref|YP_002283850.1| 2-polyprenylphenol 6-hydroxylase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 524 Back     alignment and organism information
>gi|86356010|ref|YP_467902.1| ubiquinone biosynthesis protein [Rhizobium etli CFN 42] Length = 524 Back     alignment and organism information
>gi|190890021|ref|YP_001976563.1| ubiquinone biosynthesis protein [Rhizobium etli CIAT 652] Length = 524 Back     alignment and organism information
>gi|327188621|gb|EGE55831.1| ubiquinone biosynthesis protein [Rhizobium etli CNPAF512] Length = 524 Back     alignment and organism information
>gi|15964116|ref|NP_384469.1| ubiquinone biosynthesis protein [Sinorhizobium meliloti 1021] Length = 524 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target517 2-polyprenylphenol 6-hydroxylase [Candidatus Liberibact
TIGR01982437 TIGR01982, UbiB, 2-polyprenylphenol 6-hydroxylase 1e-155
PRK04750537 PRK04750, ubiB, putative ubiquinone biosynthesis protei 6e-97
KOG1235538 KOG1235, KOG1235, KOG1235, Predicted unusual protein ki 5e-55
KOG1236565 KOG1236, KOG1236, KOG1236, Predicted unusual protein ki 2e-24
pfam03109117 pfam03109, ABC1, ABC1 family 9e-27
KOG1234363 KOG1234, KOG1234, KOG1234, ABC (ATP binding cassette) 1 1e-10
cd05144198 cd05144, RIO2_C, RIO kinase family; RIO2, C-terminal ca 1e-05
COG0478304 COG0478, COG0478, RIO-like serine/threonine protein kin 3e-05
cd05120155 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphotransf 0.002
pfam01636239 pfam01636, APH, Phosphotransferase enzyme family 0.003
COG0661517 COG0661, AarF, Predicted unusual protein kinase [Genera 1e-121
>gnl|CDD|162638 TIGR01982, UbiB, 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>gnl|CDD|179874 PRK04750, ubiB, putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>gnl|CDD|36449 KOG1235, KOG1235, KOG1235, Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>gnl|CDD|36450 KOG1236, KOG1236, KOG1236, Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>gnl|CDD|111949 pfam03109, ABC1, ABC1 family Back     alignment and domain information
>gnl|CDD|36448 KOG1234, KOG1234, KOG1234, ABC (ATP binding cassette) 1 protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|88274 cd05144, RIO2_C, RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>gnl|CDD|30826 COG0478, COG0478, RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|88612 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>gnl|CDD|145007 pfam01636, APH, Phosphotransferase enzyme family Back     alignment and domain information
>gnl|CDD|31005 COG0661, AarF, Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 517 2-polyprenylphenol 6-hydroxylase [Candidatus Liberibact
PRK04750540 ubiB putative ubiquinone biosynthesis protein UbiB; Rev 100.0
TIGR01982452 UbiB 2-polyprenylphenol 6-hydroxylase; InterPro: IPR010 100.0
COG0661517 AarF Predicted unusual protein kinase [General function 100.0
KOG1235538 consensus 100.0
KOG1236565 consensus 100.0
KOG1234363 consensus 100.0
KOG0574 502 consensus 98.49
KOG4721 904 consensus 96.96
pfam03109117 ABC1 ABC1 family. This family includes ABC1 from yeast 99.96
pfam01163186 RIO1 RIO1 family. This is a family of atypical serine k 99.22
smart00090237 RIO RIO-like kinase. 99.15
COG1718268 RIO1 Serine/threonine protein kinase involved in cell c 99.08
COG0478304 RIO-like serine/threonine protein kinase fused to N-ter 98.97
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic 98.88
KOG0661 538 consensus 98.43
KOG2268465 consensus 98.19
KOG0667586 consensus 98.01
KOG0660359 consensus 97.97
PTZ00284467 protein kinase; Provisional 97.96
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins with 97.73
KOG0659318 consensus 97.61
KOG1166974 consensus 97.53
KOG0577 948 consensus 97.52
COG2112201 Predicted Ser/Thr protein kinase [Signal transduction m 97.19
KOG1187361 consensus 97.03
KOG1989 738 consensus 96.54
KOG0586 596 consensus 94.43
TIGR01767386 MTRK 5-methylthioribose kinase; InterPro: IPR009212 Mem 94.4
KOG0666438 consensus 94.25
KOG0664449 consensus 93.76
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalytic do 99.19
cd05119187 RIO RIO kinase family, catalytic domain. The RIO kinase 99.17
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and similar pro 99.11
cd05038279 PTKc_Jak_rpt2 Catalytic (Repeat 2) Domain of the Protei 99.08
cd05123250 STKc_AGC STKc_AGC: Serine/Threonine Kinases (STKs), AGC 99.04
cd06608275 STKc_myosinIII_like Serine/threonine kinases (STKs), Cl 98.98
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic domai 98.98
cd05612291 STKc_PRKX_like STKc_PRKX_like: Serine/Threonine Kinases 98.97
cd00180256 S_TKc Serine/Threonine protein kinases, catalytic domai 98.97
cd05122253 PKc_STE Protein Kinases (PKs), STE family, catalytic (c 98.96
cd05580290 STKc_PKA STKc_PKA: Serine/Threonine Kinases (STKs), cAM 98.96
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic 98.96
cd05115257 PTKc_Zap-70 Catalytic Domain of the Protein Tyrosine Ki 98.95
cd05075272 PTKc_Axl Catalytic Domain of the Protein Tyrosine Kinas 98.94
PRK13184 933 pknD serine/threonine-protein kinase; Reviewed 98.93
cd05063268 PTKc_EphR_A2 Catalytic Domain of the Protein Tyrosine K 98.92
cd05112256 PTKc_Itk Catalytic Domain of the Protein Tyrosine Kinas 98.91
cd06639291 STKc_myosinIIIB Serine/threonine kinases (STKs), class 98.91
cd05581279 STKc_PDK1 STKc_PDK1: Serine/Threonine Kinases (STKs), P 98.91
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH 98.91
pfam00069260 Pkinase Protein kinase domain. 98.91
cd05041251 PTKc_Fes_like Catalytic Domain of Fes-like Protein Tyro 98.9
cd06620284 PKc_MAPKK_Byr1_like Protein kinases (PKs), MAP kinase k 98.9
cd06614287 STKc_PAK Serine/threonine kinases (STKs), p21-activated 98.89
cd05113256 PTKc_Btk_Bmx Catalytic Domain of the Protein Tyrosine K 98.89
cd05114256 PTKc_Tec_Rlk Catalytic Domain of the Protein Tyrosine K 98.89
cd05059256 PTKc_Tec_like Catalytic Domain of Tec-like Protein Tyro 98.89
cd06623264 PKc_MAPKK_plant_like Protein kinases (PKs), MAP kinase 98.89
cd06605265 PKc_MAPKK Protein kinases (PKs), MAP kinase kinase (MAP 98.88
cd06659297 STKc_PAK6 Serine/threonine kinases (STKs), p21-activate 98.88
cd05095296 PTKc_DDR2 Catalytic Domain of the Protein Tyrosine Kina 98.87
cd07841298 STKc_CDK7 The catalytic domain of the Serine/Threonine 98.87
cd05079284 PTKc_Jak1_rpt2 Catalytic (Repeat 2) Domain of the Prote 98.86
cd05085250 PTKc_Fer Catalytic Domain of the Protein Tyrosine Kinas 98.86
cd06658292 STKc_PAK5 Serine/threonine kinases (STKs), p21-activate 98.86
cd06628267 STKc_MAPKKK_Byr2_like Serine/threonine kinases (STKs), 98.85
cd05067260 PTKc_Lck_Blk Catalytic Domain of the Protein Tyrosine K 98.85
smart00221225 STYKc Protein kinase; unclassified specificity. Phospho 98.85
cd05096304 PTKc_DDR1 Catalytic Domain of the Protein Tyrosine Kina 98.85
cd05065269 PTKc_EphR_B Catalytic Domain of the Protein Tyrosine Ki 98.85
cd05074273 PTKc_Tyro3 Catalytic Domain of the Protein Tyrosine Kin 98.85
cd06612256 STKc_MST1_2 Serine/threonine kinases (STKs), mammalian 98.84
cd06606259 STKc_MAPKKK Serine/threonine kinases (STKs), mitogen-ac 98.84
cd05033266 PTKc_EphR Catalytic Domain of Ephrin Receptor Protein T 98.84
cd06635317 STKc_TAO1 Serine/threonine kinases (STKs), thousand-and 98.83
cd06650333 PKc_MEK1 MEK1 (MAPKK1 or MKK1): Protein kinases (PKs), 98.83
cd05049280 PTKc_Trk Catalytic Domain of the Protein Tyrosine Kinas 98.83
cd05610 669 STKc_MASTL STKc_MASTL: Serine/Threonine Kinases (STKs), 98.83
cd00192261 PTKc Catalytic Domain of Protein Tyrosine Kinases. Prot 98.82
cd05148261 PTKc_Srm_Brk Catalytic Domain of the Protein Tyrosine K 98.82
cd06657292 STKc_PAK4 Serine/threonine kinases (STKs), p21-activate 98.82
cd06607307 STKc_TAO Serine/threonine kinases (STKs), thousand-and- 98.82
cd05097295 PTKc_DDR_like Catalytic Domain of Discoidin Domain Rece 98.82
cd06643282 STKc_SLK Serine/threonine kinases (STKs), Ste20-like ki 98.81
cd06917277 STKc_NAK1_like Serine/threonine kinases (STKs), Nak1 su 98.81
cd06649331 PKc_MEK2 MEK2 (MAPKK2 or MKK2): Protein kinases (PKs), 98.81
cd06615308 PKc_MEK MEK1/2 (MAPK kinase 1/2, MAPKK1/2 or MKK1/2): P 98.81
cd06654296 STKc_PAK1 Serine/threonine kinases (STKs), p21-activate 98.8
cd06638286 STKc_myosinIIIA Serine/threonine kinases (STKs), class 98.8
cd05625382 STKc_LATS1 STKc_LATS1: Serine/Threonine Kinases (STKs), 98.8
pfam07714258 Pkinase_Tyr Protein tyrosine kinase. 98.8
cd06627254 STKc_Cdc7_like Serine/threonine kinases (STKs), cell di 98.8
cd06621287 PKc_MAPKK_Pek1_like Protein kinases (PKs), MAP kinase k 98.8
cd05064266 PTKc_EphR_A10 Catalytic Domain of the Protein Tyrosine 98.8
cd06648285 STKc_PAK_II Serine/threonine kinases (STKs), p21-activa 98.8
cd05574315 STKc_phototropin_like STKc_phototropin_like: Serine/Thr 98.8
cd05579265 STKc_MAST_like STKc_MAST_like: Serine/Threonine Kinases 98.79
cd05032277 PTKc_InsR_like Catalytic Domain of Insulin Receptor-lik 98.79
cd05572262 STKc_cGK_PKG STKc_cGK_PKG: Serine/Threonine Kinases (ST 98.78
cd06619279 PKc_MKK5 Protein kinases (PKs), MAP kinase kinase 5 (MK 98.78
cd07846286 STKc_CDKL2_3 The catalytic domain of the Serine/Threoni 98.78
cd06656297 STKc_PAK3 Serine/threonine kinases (STKs), p21-activate 98.78
cd05068261 PTKc_Frk_like Catalytic Domain of Fyn-related kinase-li 98.78
cd06640277 STKc_MST4 Serine/threonine kinases (STKs), mammalian St 98.77
cd06637272 STKc_TNIK Serine/threonine kinases (STKs),Traf2- and Nc 98.77
cd05577277 STKc_GRK STKc_GRK: Serine/Threonine Kinases (STKs), G p 98.77
cd05614332 STKc_MSK2_N STKc_MSK2_N: Serine/Threonine Kinases (STKs 98.76
cd05595323 STKc_PKB_beta STKc_PKB_beta: Serine/Threonine Kinases ( 98.76
cd06626264 STKc_MEKK4 Serine/threonine kinases (STKs), MAP/ERK kin 98.76
cd05073260 PTKc_Hck Catalytic Domain of the Protein Tyrosine Kinas 98.76
cd06641277 STKc_MST3 Serine/threonine kinases (STKs), mammalian St 98.76
cd05573354 STKc_ROCK_NDR_like STKc_ROCK_NDR_like: Serine/Threonine 98.76
cd06655296 STKc_PAK2 Serine/threonine kinases (STKs), p21-activate 98.76
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyro 98.76
cd05630285 STKc_GRK6 STKc_GRK6: Serine/Threonine Kinases (STKs), G 98.76
cd05072261 PTKc_Lyn Catalytic Domain of the Protein Tyrosine Kinas 98.76
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotransfe 98.75
cd06609274 STKc_MST3_like Serine/threonine kinases (STKs), mammali 98.75
cd06645267 STKc_MAP4K3 Serine/threonine kinases (STKs), mitogen-ac 98.74
cd05571323 STKc_PKB STKc_PKB: Serine/Threonine Kinases (STKs), Pro 98.74
cd05633279 STKc_GRK3 STKc_GRK3: Serine/Threonine Kinases (STKs), G 98.74
cd05042269 PTKc_Aatyk Catalytic Domain of the Protein Tyrosine Kin 98.74
cd05092280 PTKc_TrkA Catalytic Domain of the Protein Tyrosine Kina 98.73
cd05609305 STKc_MAST STKc_MAST: Serine/Threonine Kinases (STKs), M 98.73
cd07836284 STKc_Pho85 The catalytic domain of the Serine/Threonine 98.73
cd06613261 STKc_MAP4K3_like Serine/threonine kinases (STKs), mitog 98.73
cd05051296 PTKc_DDR Catalytic Domain of the Protein Tyrosine Kinas 98.73
cd07867317 STKc_CDC2L6 The catalytic domain of Cyclin-Dependent pr 98.73
cd05080283 PTKc_Tyk2_rpt2 Catalytic (Repeat 2) Domain of the Prote 98.73
cd05608280 STKc_GRK1 STKc_GRK1: Serine/Threonine Kinases (STKs), G 98.73
cd05611260 STKc_Rim15_like STKc_Rim15_like: Serine/Threonine Kinas 98.72
PTZ00263329 protein kinase A catalytic subunit; Provisional 98.72
cd05069260 PTKc_Yes Catalytic Domain of the Protein Tyrosine Kinas 98.72
cd06652265 STKc_MEKK2 Serine/threonine kinases (STKs), MAP/ERK kin 98.72
cd07875364 STKc_JNK1 The catalytic domain of the Serine/Threonine 98.72
cd06653264 STKc_MEKK3_like_1 Serine/threonine kinases (STKs), MAP/ 98.72
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (Repeat 2) Domain of the 98.72
cd06625263 STKc_MEKK3_like Serine/threonine kinases (STKs), MAP/ER 98.72
cd05066267 PTKc_EphR_A Catalytic Domain of the Protein Tyrosine Ki 98.71
cd05118283 STKc_CMGC The catalytic domain of CMGC family Serine/Th 98.71
cd07830283 STKc_MAK_like The catalytic domain of Male germ cell-As 98.71
cd06642277 STKc_STK25_YSK1 Serine/threonine kinases (STKs), STK25 98.71
cd05082256 PTKc_Csk Catalytic Domain of the Protein Tyrosine Kinas 98.7
cd06622286 PKc_MAPKK_PBS2_like Protein kinases (PKs), MAP kinase k 98.7
cd05626381 STKc_LATS2 STKc_LATS2: Serine/Threonine Kinases (STKs), 98.7
cd07850353 STKc_JNK The catalytic domain of the Serine/Threonine K 98.7
cd06633313 STKc_TAO3 Serine/threonine kinases (STKs), thousand-and 98.7
cd07839284 STKc_CDK5 The catalytic domain of the Serine/Threonine 98.7
cd05575323 STKc_SGK STKc_SGK: Serine/Threonine Kinases (STKs), Ser 98.7
cd05583288 STKc_MSK_N STKc_MSK_N: Serine/Threonine Kinases (STKs), 98.7
cd05628363 STKc_NDR1 STKc_NDR1: Serine/Threonine Kinases (STKs), N 98.7
cd05584323 STKc_p70S6K STKc_p70S6K: Serine/Threonine Kinases (STKs 98.7
cd05601330 STKc_CRIK STKc_CRIK: Serine/Threonine Kinases (STKs), C 98.7
cd05039256 PTKc_Csk_like Catalytic Domain of C-terminal Src kinase 98.7
cd05116257 PTKc_Syk Catalytic Domain of the Protein Tyrosine Kinas 98.7
cd07860284 STKc_CDK2_3 The catalytic domain of the Serine/Threonin 98.7
cd05034261 PTKc_Src_like Catalytic Domain of Src kinase-like Prote 98.7
cd05631285 STKc_GRK4 STKc_GRK4: Serine/Threonine Kinases (STKs), G 98.7
cd07876359 STKc_JNK2 The catalytic domain of the Serine/Threonine 98.69
cd05598376 STKc_LATS STKc_LATS: Serine/Threonine Kinases (STKs), L 98.69
cd05629377 STKc_NDR_like_fungal STKc_NDR_like_fungal: Serine/Threo 98.69
cd07848287 STKc_CDKL5 The catalytic domain of the Serine/Threonine 98.69
cd05632285 STKc_GRK5 STKc_GRK5: Serine/Threonine Kinases (STKs), G 98.69
cd06610266 STKc_OSR1_SPAK Serine/threonine kinases (STKs), oxidati 98.68
cd05052263 PTKc_Abl Catalytic Domain of the Protein Tyrosine Kinas 98.68
cd05605285 STKc_GRK4_like STKc_GRK4_like: Serine/Threonine Kinases 98.68
cd05586330 STKc_Sck1_like STKc_Sck1_like: Serine/Threonine Kinases 98.68
cd06646267 STKc_MAP4K5 Serine/threonine kinases (STKs), mitogen-ac 98.68
cd05110303 PTKc_HER4 Catalytic Domain of the Protein Tyrosine Kina 98.68
cd06630268 STKc_MEKK1 Serine/threonine kinases (STKs), MAP/ERK kin 98.68
cd05098307 PTKc_FGFR1 Catalytic Domain of the Protein Tyrosine Kin 98.68
cd07870291 STKc_PFTAIRE2 The catalytic domain of the Serine/Threon 98.68
cd05086268 PTKc_Aatyk2 Catalytic Domain of the Protein Tyrosine Ki 98.68
cd05046275 PTK_CCK4 Catalytic Domain of the Protein Tyrosine Kinas 98.68
cd05090283 PTKc_Ror1 Catalytic Domain of the Protein Tyrosine Kina 98.67
cd05606278 STKc_beta_ARK STKc_beta_ARK: Serine/Threonine Kinases ( 98.67
cd06651266 STKc_MEKK3 Serine/threonine kinases (STKs), MAP/ERK kin 98.67
cd05590320 STKc_nPKC_eta STKc_nPKC_eta: Serine/Threonine Kinases ( 98.67
cd07851343 STKc_p38 The catalytic domain of the Serine/Threonine K 98.67
cd07834330 STKc_MAPK The catalytic domain of the Serine/Threonine 98.67
cd05570318 STKc_PKC STKc_PKC: Serine/Threonine Kinases (STKs), Pro 98.67
PTZ00024325 cyclin-dependent protein kinase; Provisional 98.67
cd06611280 STKc_SLK_like Serine/threonine kinases (STKs), Ste20-li 98.66
cd05587324 STKc_cPKC STKc_cPKC: Serine/Threonine Kinases (STKs), C 98.66
cd07847286 STKc_CDKL1_4 The catalytic domain of the Serine/Threoni 98.66
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic Domain of the Protein Tyro 98.66
cd06629272 STKc_MAPKKK_Bck1_like Serine/threonine kinases (STKs), 98.66
cd05111279 PTK_HER3 Pseudokinase Domain of the Protein Tyrosine Ki 98.66
cd05593325 STKc_PKB_gamma STKc_PKB_gamma: Serine/Threonine Kinases 98.66
cd05613290 STKc_MSK1_N STKc_MSK1_N: Serine/Threonine Kinases (STKs 98.66
cd05057279 PTKc_EGFR_like Catalytic Domain of Epidermal Growth Fac 98.66
cd05603321 STKc_SGK2 STKc_SGK2: Serine/Threonine Kinases (STKs), S 98.65
cd05591321 STKc_nPKC_epsilon STKc_nPKC_epsilon: Serine/Threonine K 98.65
cd07865310 STKc_CDK9 The catalytic domain of the Serine/Threonine 98.65
cd05047270 PTKc_Tie Catalytic Domain of Tie Protein Tyrosine Kinas 98.65
cd05060257 PTKc_Syk_like Catalytic Domain of Spleen Tyrosine Kinas 98.64
cd07880343 STKc_p38gamma_MAPK12 The catalytic domain of the Serine 98.64
cd07842315 STKc_CDK8_like The catalytic domain of Cyclin-Dependent 98.64
cd07864302 STKc_CDK12 The catalytic domain of the Serine/Threonine 98.64
cd05044270 PTKc_c-ros Catalytic Domain of the Protein Tyrosine Kin 98.64
cd07840287 STKc_CDK9_like The catalytic domain of Cyclin-Dependent 98.64
cd05599364 STKc_NDR_like STKc_NDR_like: Serine/Threonine Kinases ( 98.64
cd05058262 PTKc_Met_Ron Catalytic Domain of the Protein Tyrosine K 98.64
cd07833288 STKc_CDKL The catalytic domain of Cyclin-Dependent prot 98.64
cd05602325 STKc_SGK1 STKc_SGK1: Serine/Threonine Kinases (STKs), S 98.63
cd05624331 STKc_MRCK_beta STKc_MRCK_beta: Serine/Threonine Kinases 98.63
cd05084252 PTKc_Fes Catalytic Domain of the Protein Tyrosine Kinas 98.63
cd06634308 STKc_TAO2 Serine/threonine kinases (STKs), thousand-and 98.63
cd05615323 STKc_cPKC_alpha STKc_cPKC_alpha: Serine/Threonine Kinas 98.63
cd05070260 PTKc_Fyn_Yrk Catalytic Domain of the Protein Tyrosine K 98.63
cd07831282 STKc_MOK The catalytic domain of the Serine/Threonine K 98.63
cd06636282 STKc_MAP4K4_6 Serine/threonine kinases (STKs), mitogen- 98.63
cd07829282 STKc_CDK_like The catalytic domain of Cyclin-Dependent 98.63
cd07861285 STKc_CDK1_euk The catalytic domain of the Serine/Threon 98.63
cd05585312 STKc_YPK1_like STKc_YPK1_like: Serine/Threonine Kinases 98.63
cd05062277 PTKc_IGF-1R Catalytic Domain of the Protein Tyrosine Ki 98.63
cd06632258 STKc_MEKK1_plant Serine/threonine kinases (STKs), plant 98.62
cd05050288 PTKc_Musk Catalytic Domain of the Protein Tyrosine Kina 98.62
cd05616323 STKc_cPKC_beta STKc_cPKC_beta: Serine/Threonine Kinases 98.62
cd07873301 STKc_PCTAIRE1 The catalytic domain of the Serine/Threon 98.62
cd07835283 STKc_CDK1_like The catalytic domain of Cyclin-Dependent 98.62
cd06644292 STKc_STK10_LOK Serine/threonine kinases (STKs), STK10 s 98.61
cd07843293 STKc_CDC2L1 The catalytic domain of the Serine/Threonin 98.61
cd05088303 PTKc_Tie2 Catalytic Domain of the Protein Tyrosine Kina 98.61
cd05056270 PTKc_FAK Catalytic Domain of the Protein Tyrosine Kinas 98.61
cd05623332 STKc_MRCK_alpha STKc_MRCK_alpha: Serine/Threonine Kinas 98.61
PTZ00266484 NIMA-related protein kinase; Provisional 98.61
cd05582318 STKc_RSK_N STKc_RSK_N: Serine/Threonine Kinases (STKs), 98.61
cd05619316 STKc_nPKC_theta STKc_nPKC_theta: Serine/Threonine Kinas 98.6
cd07878343 STKc_p38beta_MAPK11 The catalytic domain of the Serine/ 98.6
cd05589324 STKc_PKN STKc_PKN: Serine/Threonine Kinases (STKs), Pro 98.6
cd05597331 STKc_DMPK_like STKc_DMPK_like: Serine/Threonine Kinases 98.6
cd05091283 PTKc_Ror2 Catalytic Domain of the Protein Tyrosine Kina 98.6
cd07868317 STKc_CDK8 The catalytic domain of the Serine/Threonine 98.6
cd05061288 PTKc_InsR Catalytic Domain of the Protein Tyrosine Kina 98.59
PRK10359232 lipopolysaccharide core biosynthesis protein; Provision 98.59
cd05594324 STKc_PKB_alpha STKc_PKB_alpha: Serine/Threonine Kinases 98.59
cd05083254 PTKc_Chk Catalytic Domain of the Protein Tyrosine Kinas 98.59
cd07844291 STKc_PCTAIRE_like The catalytic domain of PCTAIRE-like 98.58
cd07845309 STKc_CDK10 The catalytic domain of the Serine/Threonine 98.58
cd05620316 STKc_nPKC_delta STKc_nPKC_delta: Serine/Threonine Kinas 98.58
cd05578258 STKc_Yank1 STKc_Yank1: Serine/Threonine Kinases (STKs), 98.58
cd07871288 STKc_PCTAIRE3 The catalytic domain of the Serine/Threon 98.58
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinas 98.57
cd07855336 STKc_ERK5 The catalytic domain of the Serine/Threonine 98.56
cd06647293 STKc_PAK_I Serine/threonine kinases (STKs), p21-activat 98.56
cd05053294 PTKc_FGFR Catalytic Domain of the Protein Tyrosine Kina 98.56
cd05055302 PTKc_PDGFR Catalytic Domain of the Protein Tyrosine Kin 98.56
cd07832286 STKc_CCRK The catalytic domain of the Serine/Threonine 98.55
cd07869303 STKc_PFTAIRE1 The catalytic domain of the Serine/Threon 98.55
cd05040257 PTKc_Ack_like Catalytic Domain of the Protein Tyrosine 98.55
cd05089297 PTKc_Tie1 Catalytic Domain of the Protein Tyrosine Kina 98.55
cd07874355 STKc_JNK3 The catalytic domain of the Serine/Threonine 98.55
cd05592316 STKc_nPKC_theta_delta STKc_nPKC_theta_delta: Serine/Thr 98.55
cd07877345 STKc_p38alpha_MAPK14 The catalytic domain of the Serine 98.54
cd07837295 STKc_CdkB_plant The catalytic domain of the Serine/Thre 98.54
cd07853372 STKc_NLK The catalytic domain of the Serine/Threonine K 98.54
cd07852337 STKc_MAPK15 The catalytic domain of the Serine/Threonin 98.54
cd06631265 STKc_YSK4 Serine/threonine kinases (STKs), yeast Sps1/S 98.54
cd05621370 STKc_ROCK2 STKc_ROCK2: Serine/Threonine Kinases (STKs), 98.54
cd07879342 STKc_p38delta_MAPK13 The catalytic domain of the Serine 98.54
cd05101304 PTKc_FGFR2 Catalytic Domain of the Protein Tyrosine Kin 98.53
cd05604325 STKc_SGK3 STKc_SGK3: Serine/Threonine Kinases (STKs), S 98.53
cd05596370 STKc_ROCK STKc_ROCK: Serine/Threonine Kinases (STKs), R 98.53
cd05607277 STKc_GRK7 STKc_GRK7: Serine/Threonine Kinases (STKs), G 98.53
cd05093288 PTKc_TrkB Catalytic Domain of the Protein Tyrosine Kina 98.52
cd06624268 STKc_ASK Serine/threonine kinases (STKs), apoptosis sig 98.52
cd07866311 STKc_BUR1 The catalytic domain of the Serine/Threonine 98.52
cd05617327 STKc_aPKC_zeta STKc_aPKC_zeta: Serine/Threonine Kinases 98.51
cd07849336 STKc_ERK1_2_like The catalytic domain of Extracellular 98.51
cd05094291 PTKc_TrkC Catalytic Domain of the Protein Tyrosine Kina 98.51
cd05588329 STKc_aPKC STKc_aPKC: Serine/Threonine Kinases (STKs), A 98.51
cd05618329 STKc_aPKC_iota STKc_aPKC_iota: Serine/Threonine Kinases 98.5
cd06618296 PKc_MKK7 Protein kinases (PKs), MAP kinase kinase 7 (MK 98.5
cd05622371 STKc_ROCK1 STKc_ROCK1: Serine/Threonine Kinases (STKs), 98.5
cd05108316 PTKc_EGFR Catalytic Domain of the Protein Tyrosine Kina 98.49
cd07859338 STKc_TDY_MAPK_plant The catalytic domain of the Serine/ 98.49
cd07872309 STKc_PCTAIRE2 The catalytic domain of the Serine/Threon 98.48
cd07863288 STKc_CDK4 The catalytic domain of the Serine/Threonine 98.47
cd07838287 STKc_CDK4_6_like The catalytic domain of Cyclin-Depende 98.47
cd05045285 PTKc_RET Catalytic Domain of the Protein Tyrosine Kinas 98.47
cd05109279 PTKc_HER2 Catalytic Domain of the Protein Tyrosine Kina 98.47
cd05036277 PTKc_ALK_LTK Catalytic Domain of the Protein Tyrosine K 98.46
cd05043280 PTK_Ryk Pseudokinase Domain of the Receptor related to 98.46
cd06616288 PKc_MKK4 Protein kinases (PKs), MAP kinase kinase 4 (MK 98.45
cd07854342 STKc_MAPK4_6 The catalytic domain of the Serine/Threoni 98.43
cd05576237 STKc_RPK118_like STKc_RPK118_like: Serine/Threonine Kin 98.43
cd05099314 PTKc_FGFR4 Catalytic Domain of the Protein Tyrosine Kin 98.43
cd05100334 PTKc_FGFR3 Catalytic Domain of the Protein Tyrosine Kin 98.4
cd07862290 STKc_CDK6 The catalytic domain of the Serine/Threonine 98.38
cd07856328 STKc_Sty1_Hog1 The catalytic domain of the Serine/Threo 98.37
KOG0594323 consensus 98.37
pfam06176229 WaaY Lipopolysaccharide core biosynthesis protein (WaaY 98.36
cd07858337 STKc_TEY_MAPK_plant The catalytic domain of the Serine/ 98.36
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (Repeat 1) Domain of th 98.36
cd05071262 PTKc_Src Catalytic Domain of the Protein Tyrosine Kinas 98.35
cd07857332 STKc_MPK1 The catalytic domain of the Serine/Threonine 98.32
KOG0583370 consensus 98.31
cd06617280 PKc_MKK3_6 Protein kinases (PKs), MAP kinase kinase 3 ( 98.28
cd05037259 PTK_Jak_rpt1 Pseudokinase (Repeat 1) Domain of the Prot 98.17
cd05077262 PTK_Jak1_rpt1 Pseudokinase (Repeat 1) Domain of the Pro 98.15
KOG0595429 consensus 98.15
KOG0605550 consensus 98.07
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, 97.95
KOG4250 732 consensus 97.95
KOG0193678 consensus 97.94
KOG0600560 consensus 97.93
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (Repeat 1) Domain of the Pro 97.92
pfam01636239 APH Phosphotransferase enzyme family. This family consi 97.91
KOG0610459 consensus 97.88
KOG0581364 consensus 97.88
KOG0198313 consensus 97.84
KOG0032382 consensus 97.76
KOG1163341 consensus 97.7
KOG4236888 consensus 97.6
KOG1164322 consensus 97.49
KOG0575 592 consensus 97.48
KOG0585 576 consensus 97.4
KOG0587 953 consensus 97.29
COG2334331 Putative homoserine kinase type II (protein kinase fold 97.29
KOG0593396 consensus 97.24
KOG0197468 consensus 97.16
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. ETNK 97.08
KOG0663419 consensus 97.06
PRK06149 972 hypothetical protein; Provisional 97.06
KOG0588 786 consensus 96.87
KOG0658364 consensus 96.65
KOG0615475 consensus 96.59
KOG0201 467 consensus 96.55
KOG0984282 consensus 96.43
COG0515384 SPS1 Serine/threonine protein kinase [General function 96.37
KOG0591375 consensus 96.23
KOG0598357 consensus 96.21
cd05156302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The ChoK 96.16
KOG1006361 consensus 96.09
KOG3653534 consensus 95.93
KOG0199 1039 consensus 95.92
KOG2686366 consensus 95.69
KOG0983391 consensus 95.17
pfam10707199 YrbL-PhoP_reg PhoP regulatory network protein YrbL. Thi 94.51
COG5072488 ALK1 Serine/threonine kinase of the haspin family [Cell 94.36
PRK11768326 serine/threonine protein kinase; Provisional 94.33
KOG1035 1351 consensus 94.32
KOG0599411 consensus 92.84
pfam07914413 DUF1679 Protein of unknown function (DUF1679). The regi 92.57
KOG4717 864 consensus 91.39
PRK09605536 O-sialoglycoprotein endopeptidase/protein kinase; Revie 98.89
COG3642204 Mn2+-dependent serine/threonine protein kinase [Signal 98.68
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is part 98.11
KOG06081034 consensus 97.85
pfam06293206 Kdo Lipopolysaccharide kinase (Kdo/WaaP) family. These 97.81
KOG3087229 consensus 97.69
PTZ00267478 NIMA-related protein kinase; Provisional 97.49
PRK01723240 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 97.38
KOG0670752 consensus 96.0
KOG1151775 consensus 95.63
cd05164222 PIKKc Phosphoinositide 3-kinase-related protein kinase 95.53
KOG1165449 consensus 95.39
smart00146202 PI3Kc Phosphoinositide 3-kinase, catalytic domain. Phos 94.94
COG4857408 Predicted kinase [General function prediction only] 94.72
KOG2345302 consensus 94.59
KOG0579 1187 consensus 94.49
KOG1027903 consensus 94.32
cd00142219 PI3Kc_like Phosphoinositide 3-kinase (PI3K)-like family 93.97
KOG0903847 consensus 92.4
PRK09188365 serine/threonine protein kinase; Provisional 91.03
pfam12260205 PIP49_C Pancreatitis induced protein 49 C terminal. Thi 90.58
cd05600333 STKc_Sid2p_Dbf2p STKc_Sid2p_Dbf2p: Serine/Threonine Kin 98.77
cd05627360 STKc_NDR2 STKc_NDR2: Serine/Threonine Kinases (STKs), N 98.67
PTZ00283 496 serine/threonine protein kinase; Provisional 98.47
KOG0582 516 consensus 97.77
KOG0592 604 consensus 97.22
KOG0616355 consensus 96.75
KOG0694694 consensus 96.74
KOG0668338 consensus 96.3
cd05054337 PTKc_VEGFR Catalytic Domain of the Protein Tyrosine Kin 98.58
cd05103343 PTKc_VEGFR2 Catalytic Domain of the Protein Tyrosine Ki 98.37
cd05102338 PTKc_VEGFR3 Catalytic Domain of the Protein Tyrosine Ki 98.32
cd05106374 PTKc_CSF-1R Catalytic Domain of the Protein Tyrosine Ki 98.32
cd05104375 PTKc_Kit Catalytic Domain of the Protein Tyrosine Kinas 98.29
PRK09550398 mtnK methylthioribose kinase; Reviewed 97.79
cd05166353 PI3Kc_II Phosphoinositide 3-kinase (PI3K), class II, ca 97.35
pfam01633208 Choline_kinase Choline/ethanolamine kinase. Choline kin 97.31
PRK12396409 5-methylribose kinase; Reviewed 97.22
cd05176353 PI3Kc_C2_alpha Phosphoinositide 3-kinase (PI3K), class 97.17
cd00895354 PI3Kc_C2_beta Phosphoinositide 3-kinase (PI3K), class I 97.12
cd00896350 PI3Kc_III Phosphoinositide 3-kinase (PI3K), class III, 97.0
cd05153296 HomoserineK_II Homoserine Kinase, type II. Homoserine k 96.96
cd05177354 PI3Kc_C2_gamma Phosphoinositide 3-kinase (PI3K), class 96.81
cd05174361 PI3Kc_IA_delta Phosphoinositide 3-kinase (PI3K), class 96.75
cd00891352 PI3Kc Phosphoinositide 3-kinase (PI3K), catalytic domai 96.62
COG3173321 Predicted aminoglycoside phosphotransferase [General fu 96.59
cd00894365 PI3Kc_IB_gamma Phosphoinositide 3-kinase (PI3K), class 95.63
cd05168293 PI4Kc_III_beta Phosphoinositide 4-kinase (PI4K), Type I 95.26
COG0510269 ycfN Thiamine kinase and related kinases [Coenzyme tran 95.03
cd05175366 PI3Kc_IA_alpha Phosphoinositide 3-kinase (PI3K), class 94.64
cd05165366 PI3Kc_I Phosphoinositide 3-kinase (PI3K), class I, cata 94.3
cd05173362 PI3Kc_IA_beta Phosphoinositide 3-kinase (PI3K), class I 94.04
cd00892237 PIKKc_ATR ATR (Ataxia telangiectasia and Rad3-related), 93.39
cd05170307 PIKKc_SMG1 Suppressor of morphogenetic effect on genita 93.13
pfam00454233 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase. So 93.1
smart00587196 CHK ZnF_C4 abd HLH domain containing kinases domain. su 93.02
cd05172235 PIKKc_DNA-PK DNA-dependent protein kinase (DNA-PK), cat 92.91
cd05171279 PIKKc_ATM Ataxia telangiectasia mutated (ATM), catalyti 92.84
cd05169280 PIKKc_TOR TOR (Target of rapamycin), catalytic domain; 92.66
pfam02958293 DUF227 Domain of unknown function (DUF227). This family 91.92
COG3281438 Ble Uncharacterized protein, probably involved in treha 91.9
PRK10271188 thiK thiamine kinase; Provisional 90.47
KOG0611 668 consensus 98.45
KOG2270520 consensus 98.38
KOG0192362 consensus 98.29
KOG0597 808 consensus 97.58
KOG10951025 consensus 97.41
KOG1094807 consensus 97.14
KOG0194474 consensus 95.9
KOG0696683 consensus 94.47
pfam03881287 Fructosamin_kin Fructosamine kinase. This family includ 98.37
KOG0578550 consensus 97.14
COG3001286 Uncharacterized protein conserved in bacteria [Function 95.91
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). The APH 98.13
cd05152276 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH2' is 97.68
PRK05231319 homoserine kinase; Provisional 96.53
cd05107401 PTKc_PDGFR_beta Catalytic Domain of the Protein Tyrosin 97.88
cd05105400 PTKc_PDGFR_alpha Catalytic Domain of the Protein Tyrosi 97.67
PRK06148 1015 hypothetical protein; Provisional 97.83
KOG1167418 consensus 97.83
KOG0196996 consensus 96.71
PTZ00296439 choline kinase; Provisional 93.88
KOG0603612 consensus 97.48
KOG0612 1317 consensus 97.42
KOG46451509 consensus 96.09
PRK12274198 serine/threonine protein kinase; Provisional 97.4
KOG2269531 consensus 96.79
TIGR02721262 ycfN_thiK thiamine kinase; InterPro: IPR014093 Members 96.06
PRK09902216 hypothetical protein; Provisional 92.98
KOG0665369 consensus 92.31
KOG0671415 consensus 91.03
KOG0596677 consensus 96.91
KOG0589426 consensus 96.1
COG50322105 TEL1 Phosphatidylinositol kinase and protein kinases of 94.99
cd05167311 PI4Kc_III_alpha Phosphoinositide 4-kinase (PI4K), Type 96.25
cd00893289 PI4Kc_III Phosphoinositide 4-kinase (PI4K), Type III, c 95.79
KOG09021803 consensus 93.38
KOG0906843 consensus 95.44
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information