254780628

254780628

coproporphyrinogen III oxidase

GeneID in NCBI database:8209628Locus tag:CLIBASIA_02575
Protein GI in NCBI database:254780628Protein Accession:YP_003065041.1
Gene range:+(641905, 643092)Protein Length:395aa
Gene description:coproporphyrinogen III oxidase
COG prediction:[H] Coproporphyrinogen III oxidase and related Fe-S oxidoreductases
KEGG prediction:coproporphyrinogen III oxidase; K02495 oxygen-independent coproporphyrinogen III oxidase [EC:1.3.99.22]
SEED prediction:Radical SAM family enzyme, similar to coproporphyrinogen III oxidase, oxygen-independent, clustered with nucleoside-triphosphatase RdgB
Pathway involved in KEGG:Porphyrin and chlorophyll metabolism [PATH:las00860]
Subsystem involved in SEED:Heme and Siroheme Biosynthesis;
Queuosine-Archaeosine Biosynthesis;
Heat shock dnaK gene cluster extended
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-----
MKYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV
cHHHHHHHHHccccccccEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHHccccEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccEEcccHHccccccccHHHHcccccEEEEccccEEEEcccccEEEEHHHccHHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHcccEEEEcccEEEEccccHHHHHHHHHHHcc
ccEEEEcccccccccccccEEEEEcccccccccccccHHHcccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHccccEEEEEEEcccHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHccccccHHHHHHHHHHHHHccccccEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccEEEccccEEEEccccccEEcccccEEEEccccccHHHHHHHHHcccccEEEEEccHHHcHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHcccEEEccccEEEEcccccHHHHHHHHHHcc
MKYLSAYENnmtgqgsnslgvyvhwpfcvkkcpycdfnshvrrykVGQENFIQSFLTEMQWMrqltgprsissiffgggtpsliepqNIALILDGIaknwtvssNVEItieanpssvevnnfqgyrkagvnrislGVQSLEEQSLRFLGRNHNASEAIAAIHLARNifprmsfdliyalpkqTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYkmhkdgdlvlpsenvAVDLYNLTQSITsahglhayeisnhsflgaeslhnlnywrygdyigigpgahsrvkvgSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV
MKYLSAYENNmtgqgsnslGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITieanpssvevNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERnlqrqgfiervqfsrlrctqrgmtmlDSVIANLAV
MKYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV
*******************GVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV
MKYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV
MKYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV
MKYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV
MKYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target395 coproporphyrinogen III oxidase [Candidatus Liberibacter
315121829395 coproporphyrinogen III oxidase [Candidatus Liberibacter 1 0.0
209547615401 coproporphyrinogen III oxidase [Rhizobium leguminosarum 1 1e-140
116250146400 coproporphyrinogen III oxidase [Rhizobium leguminosarum 1 1e-139
241202758400 coproporphyrinogen III oxidase [Rhizobium leguminosarum 1 1e-139
150395235381 coproporphyrinogen III oxidase [Sinorhizobium medicae W 1 1e-139
222147319393 coproporphyrinogen III oxidase [Agrobacterium vitis S4] 1 1e-139
159184259399 coproporphyrinogen III oxidase [Agrobacterium tumefacie 1 1e-138
222084654392 coproporphyrinogen III oxidase protein [Agrobacterium r 1 1e-138
325291759399 oxygen-independent coproporphyrinogen III oxidase [Agro 1 1e-138
190890029400 oxygen-independent coprophorphyrinogen III oxidase [Rhi 1 1e-138
>gi|315121829|ref|YP_004062318.1| coproporphyrinogen III oxidase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 395 Back     alignment and organism information
 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/394 (76%), Positives = 351/394 (89%)

Query: 1   MKYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ 60
           MKY  +Y +++    SN+LG+YVHWPFC KKCPYCDFNSHVRR  + Q +FI+S L EM+
Sbjct: 1   MKYSQSYGDDVVHPDSNTLGIYVHWPFCTKKCPYCDFNSHVRRRAIDQGHFIRSLLVEME 60

Query: 61  WMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN 120
           WMRQL+GPR ISS+FFGGGTPSLI+PQNI+++LD IAKNWT+ SNVEITIEANPSS E  
Sbjct: 61  WMRQLSGPRLISSVFFGGGTPSLIDPQNISILLDNIAKNWTLPSNVEITIEANPSSTEAG 120

Query: 121 NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALP 180
           +F GYRKAGVNR+SLGVQSLEE++LRFLGRNHN SEA+ AIHLAR+IFPRMSFDLIYALP
Sbjct: 121 HFLGYRKAGVNRVSLGVQSLEERALRFLGRNHNVSEAVTAIHLARDIFPRMSFDLIYALP 180

Query: 181 KQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQ 240
            Q++ QWEMELQ+ALSYAVDHLSLYQLTIEKGTLFYK+HKDGDLVLP E+++ DLYNLTQ
Sbjct: 181 GQSIKQWEMELQKALSYAVDHLSLYQLTIEKGTLFYKLHKDGDLVLPDESLSADLYNLTQ 240

Query: 241 SITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH 300
            IT  +GL++YEISNH+ LG+ESLHNL YWRYGDY+GIGPGAHSRVKV S R+A+SIEKH
Sbjct: 241 IITREYGLYSYEISNHARLGSESLHNLTYWRYGDYVGIGPGAHSRVKVDSQRIAMSIEKH 300

Query: 301 PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER 360
           PE+W+KMV KNGHA+VEKEFLSSEQQADEFLMMG+RLREGI VKDWE LAGR+LDIECER
Sbjct: 301 PENWVKMVEKNGHAIVEKEFLSSEQQADEFLMMGMRLREGIEVKDWERLAGRSLDIECER 360

Query: 361 NLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA 394
            LQ QGFIER+  SRLRCTQ GM MLD+++A+L+
Sbjct: 361 RLQEQGFIERINSSRLRCTQLGMVMLDAIVADLS 394


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209547615|ref|YP_002279532.1| coproporphyrinogen III oxidase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 401 Back     alignment and organism information
>gi|116250146|ref|YP_765984.1| coproporphyrinogen III oxidase [Rhizobium leguminosarum bv. viciae 3841] Length = 400 Back     alignment and organism information
>gi|241202758|ref|YP_002973854.1| coproporphyrinogen III oxidase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 400 Back     alignment and organism information
>gi|150395235|ref|YP_001325702.1| coproporphyrinogen III oxidase [Sinorhizobium medicae WSM419] Length = 381 Back     alignment and organism information
>gi|222147319|ref|YP_002548276.1| coproporphyrinogen III oxidase [Agrobacterium vitis S4] Length = 393 Back     alignment and organism information
>gi|159184259|ref|NP_353357.2| coproporphyrinogen III oxidase [Agrobacterium tumefaciens str. C58] Length = 399 Back     alignment and organism information
>gi|222084654|ref|YP_002543183.1| coproporphyrinogen III oxidase protein [Agrobacterium radiobacter K84] Length = 392 Back     alignment and organism information
>gi|325291759|ref|YP_004277623.1| oxygen-independent coproporphyrinogen III oxidase [Agrobacterium sp. H13-3] Length = 399 Back     alignment and organism information
>gi|190890029|ref|YP_001976571.1| oxygen-independent coprophorphyrinogen III oxidase [Rhizobium etli CIAT 652] Length = 400 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target395 coproporphyrinogen III oxidase [Candidatus Liberibacter
PRK09057380 PRK09057, PRK09057, coproporphyrinogen III oxidase; Pro 1e-177
PRK06582390 PRK06582, PRK06582, coproporphyrinogen III oxidase; Pro 1e-106
PRK05660378 PRK05660, PRK05660, HemN family oxidoreductase; Provisi 3e-85
PRK08898394 PRK08898, PRK08898, coproporphyrinogen III oxidase; Pro 1e-84
PRK08599377 PRK08599, PRK08599, coproporphyrinogen III oxidase; Pro 1e-80
TIGR00539360 TIGR00539, hemN_rel, putative oxygen-independent coprop 3e-75
PRK05628375 PRK05628, PRK05628, coproporphyrinogen III oxidase; Val 2e-73
PRK05799374 PRK05799, PRK05799, coproporphyrinogen III oxidase; Pro 7e-73
PRK07379400 PRK07379, PRK07379, coproporphyrinogen III oxidase; Pro 6e-64
PRK08208430 PRK08208, PRK08208, coproporphyrinogen III oxidase; Val 6e-30
COG0635416 COG0635, HemN, Coproporphyrinogen III oxidase and relat 5e-99
PRK06294370 PRK06294, PRK06294, coproporphyrinogen III oxidase; Pro 1e-58
PRK08446350 PRK08446, PRK08446, coproporphyrinogen III oxidase; Pro 6e-58
PRK05904353 PRK05904, PRK05904, coproporphyrinogen III oxidase; Pro 8e-37
smart00729216 smart00729, Elp3, Elongator protein 3, MiaB family, Rad 7e-41
PRK08207488 PRK08207, PRK08207, coproporphyrinogen III oxidase; Pro 4e-31
PRK09058449 PRK09058, PRK09058, coproporphyrinogen III oxidase; Pro 3e-27
TIGR00538455 TIGR00538, hemN, oxygen-independent coproporphyrinogen 7e-27
COG1243515 COG1243, ELP3, Histone acetyltransferase [Transcription 4e-11
cd01335204 cd01335, Radical_SAM, Radical SAM superfamily 2e-06
PRK09249453 PRK09249, PRK09249, coproporphyrinogen III oxidase; Pro 5e-27
PRK13347453 PRK13347, PRK13347, coproporphyrinogen III oxidase; Pro 6e-24
pfam04055165 pfam04055, Radical_SAM, Radical SAM superfamily 8e-17
pfam06969118 pfam06969, HemN_C, HemN C-terminal region 5e-26
PRK08629433 PRK08629, PRK08629, coproporphyrinogen III oxidase; Pro 7e-20
TIGR01211522 TIGR01211, ELP3, histone acetyltransferase, ELP3 family 4e-07
KOG2535554 KOG2535, KOG2535, KOG2535, RNA polymerase II elongator 1e-04
COG1242312 COG1242, COG1242, Predicted Fe-S oxidoreductase [Genera 1e-06
TIGR01212302 TIGR01212, TIGR01212, radical SAM protein, TIGR01212 fa 1e-06
>gnl|CDD|181629 PRK09057, PRK09057, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|180630 PRK06582, PRK06582, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|180187 PRK05660, PRK05660, HemN family oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181577 PRK08898, PRK08898, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|181496 PRK08599, PRK08599, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|129630 TIGR00539, hemN_rel, putative oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>gnl|CDD|180172 PRK05628, PRK05628, coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>gnl|CDD|180263 PRK05799, PRK05799, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|180953 PRK07379, PRK07379, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|181292 PRK08208, PRK08208, coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>gnl|CDD|30980 COG0635, HemN, Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|180518 PRK06294, PRK06294, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|181428 PRK08446, PRK08446, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|135651 PRK05904, PRK05904, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|128968 smart00729, Elp3, Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>gnl|CDD|181291 PRK08207, PRK08207, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|181630 PRK09058, PRK09058, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|129629 TIGR00538, hemN, oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>gnl|CDD|31436 COG1243, ELP3, Histone acetyltransferase [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|100105 cd01335, Radical_SAM, Radical SAM superfamily Back     alignment and domain information
>gnl|CDD|181727 PRK09249, PRK09249, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|171993 PRK13347, PRK13347, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|146602 pfam04055, Radical_SAM, Radical SAM superfamily Back     alignment and domain information
>gnl|CDD|148535 pfam06969, HemN_C, HemN C-terminal region Back     alignment and domain information
>gnl|CDD|181509 PRK08629, PRK08629, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|162253 TIGR01211, ELP3, histone acetyltransferase, ELP3 family Back     alignment and domain information
>gnl|CDD|37746 KOG2535, KOG2535, KOG2535, RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase [Chromatin structure and dynamics, Transcription] Back     alignment and domain information
>gnl|CDD|31435 COG1242, COG1242, Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|130279 TIGR01212, TIGR01212, radical SAM protein, TIGR01212 family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 395 coproporphyrinogen III oxidase [Candidatus Liberibacter
PRK09057381 coproporphyrinogen III oxidase; Provisional 100.0
PRK08599377 coproporphyrinogen III oxidase; Provisional 100.0
PRK06582390 coproporphyrinogen III oxidase; Provisional 100.0
PRK05628376 coproporphyrinogen III oxidase; Validated 100.0
PRK05799374 coproporphyrinogen III oxidase; Provisional 100.0
PRK07379399 coproporphyrinogen III oxidase; Provisional 100.0
PRK08898393 coproporphyrinogen III oxidase; Provisional 100.0
PRK08807385 consensus 100.0
PRK05660378 coproporphyrinogen III oxidase; Provisional 100.0
PRK08949378 consensus 100.0
PRK08208436 coproporphyrinogen III oxidase; Validated 100.0
PRK06294374 coproporphyrinogen III oxidase; Provisional 100.0
PRK13347453 coproporphyrinogen III oxidase; Provisional 100.0
PRK09249456 coproporphyrinogen III oxidase; Provisional 100.0
PRK09058447 coproporphyrinogen III oxidase; Provisional 100.0
COG0635416 HemN Coproporphyrinogen III oxidase and related Fe-S ox 100.0
PRK08446351 coproporphyrinogen III oxidase; Provisional 100.0
PRK05904353 coproporphyrinogen III oxidase; Provisional 100.0
PRK08629424 coproporphyrinogen III oxidase; Provisional 100.0
TIGR00539371 hemN_rel putative oxygen-independent coproporphyrinogen 100.0
TIGR00538462 hemN oxygen-independent coproporphyrinogen III oxidase; 100.0
PRK08207497 coproporphyrinogen III oxidase; Provisional 100.0
TIGR00433350 bioB biotin synthase; InterPro: IPR002684 Biotin syntha 98.64
smart00729216 Elp3 Elongator protein 3, MiaB family, Radical SAM. Thi 99.97
COG1243515 ELP3 Histone acetyltransferase [Transcription / Chromat 99.96
TIGR01212307 TIGR01212 radical SAM protein, TIGR01212 family; InterP 99.94
TIGR03471472 HpnJ hopanoid biosynthesis associated radical SAM prote 99.93
TIGR01211573 ELP3 histone acetyltransferase, ELP3 family; InterPro: 99.92
TIGR00089455 TIGR00089 RNA modification enzyme, MiaB family; InterPr 99.92
COG1242312 Predicted Fe-S oxidoreductase [General function predict 99.9
COG0621437 MiaB 2-methylthioadenine synthetase [Translation, ribos 99.88
TIGR01574456 miaB-methiolase tRNA-i(6)A37 thiotransferase enzyme Mia 99.87
cd01335204 Radical_SAM Radical SAM superfamily. Enzymes of this fa 99.84
TIGR01579492 MiaB-like-C MiaB-like tRNA modifying enzyme; InterPro: 99.81
COG1032490 Fe-S oxidoreductase [Energy production and conversion] 99.79
PRK07094323 biotin synthase; Provisional 99.76
TIGR01578487 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-t 99.72
PRK06256325 biotin synthase; Validated 99.63
PRK06267324 hypothetical protein; Provisional 99.62
KOG2535554 consensus 99.58
TIGR01125475 TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR011 99.57
PRK08508279 biotin synthase; Provisional 99.55
COG1031560 Uncharacterized Fe-S oxidoreductase [Energy production 99.45
TIGR02026506 BchE magnesium-protoporphyrin IX monomethyl ester anaer 99.43
COG0502335 BioB Biotin synthase and related enzymes [Coenzyme meta 99.42
COG1244358 Predicted Fe-S oxidoreductase [General function predict 99.42
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin sy 99.35
KOG2492552 consensus 99.24
PRK07360375 FO synthase subunit 2; Reviewed 99.11
COG1060370 ThiH Thiamine biosynthesis enzyme ThiH and related unch 99.09
PRK05927350 hypothetical protein; Provisional 99.0
PRK06245336 cofG FO synthase subunit 1; Reviewed 98.97
PRK05301375 pyrroloquinoline quinone biosynthesis protein PqqE; Pro 98.94
COG0535347 Predicted Fe-S oxidoreductases [General function predic 98.9
PRK00164334 moaA molybdenum cofactor biosynthesis protein A; Review 98.82
PRK05926371 hypothetical protein; Provisional 98.81
PRK13361329 molybdenum cofactor biosynthesis protein A; Provisional 98.78
PRK09234 846 fbiC FO synthase; Reviewed 98.77
COG2896322 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme 98.74
TIGR03550322 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin sy 98.74
COG1856275 Uncharacterized homolog of biotin synthetase [Function 98.72
PRK13758370 anaerobic sulfatase-maturase; Provisional 98.71
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . This entry represents the bacterial form of MoaA (molybdenum cofactor biosynthesis protein A). The MoaA protein is a member of the wider S-adenosylmethionine(SAM)-dependent enzyme family which catalyze the formation of protein and/or substrate radicals by reductive cleavage of SAM via a [4Fe-4S] cluster. Monomeric and homodimeric forms of MoaA have been observed in vivo, and it is not clear what the physiologically relevant form of the enzyme is . The core of each monomer consists of an incomplete TIM barrel, formed by the N-terminal region of the protein, containing a [4Fe-4S] cluster. The C-terminal region of the protein, which also contains a [4Fe-4S] cluster consists of a beta-sheet covering the lateral opening of the barrel, an extended loop and three alpha helices. The N-terminal [4Fe-4S] cluster is coordinated with 3 cysteines and an exchangeable SAM molecule, while the C-terminal [4Fe-4S], also coordinated with 3 cysteines, is the binding and activation site for GTP .; GO: 0046872 metal ion binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02666">TIGR02666346 moaA molybdenum cofactor biosynthesis protein A; InterP 98.67
PRK13745412 anaerobic sulfatase-maturase; Provisional 98.57
PRK09613471 thiH thiamine biosynthesis protein ThiH; Reviewed 98.17
TIGR02668324 moaA_archaeal probable molybdenum cofactor biosynthesis 98.11
COG1533297 SplB DNA repair photolyase [DNA replication, recombinat 98.09
COG1180260 PflA Pyruvate-formate lyase-activating enzyme [Posttran 98.08
TIGR02493243 PFLA pyruvate formate-lyase 1-activating enzyme; InterP 97.91
TIGR01210329 TIGR01210 conserved hypothetical protein TIGR01210; Int 97.72
COG2108353 Uncharacterized conserved protein related to pyruvate f 97.62
KOG2900380 consensus 97.35
PRK00955599 hypothetical protein; Provisional 97.35
PRK01254742 hypothetical protein; Provisional 97.28
TIGR02495220 NrdG2 anaerobic ribonucleoside-triphosphate reductase a 97.02
KOG2672360 consensus 96.26
KOG2876323 consensus 91.23
COG5014228 Predicted Fe-S oxidoreductase [General function predict 90.36
pfam06969118 HemN_C HemN C-terminal region. Members of this family a 99.86
pfam04055165 Radical_SAM Radical SAM superfamily. Radical SAM protei 99.64
PRK09240371 thiH thiamine biosynthesis protein ThiH; Reviewed 98.77
TIGR02351378 thiH thiazole biosynthesis protein ThiH; InterPro: IPR0 98.28
PRK08444353 hypothetical protein; Provisional 99.08
PRK08445348 hypothetical protein; Provisional 99.07
TIGR03470318 HpnH hopanoid biosynthesis associated radical SAM prote 98.7
COG0641378 AslB Arylsulfatase regulator (Fe-S oxidoreductase) [Gen 98.7
COG2100414 Predicted Fe-S oxidoreductase [General function predict 98.66
PRK11145246 pflA pyruvate formate lyase-activating enzyme 1; Provis 98.62
TIGR02109363 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E; Inter 98.55
PRK09234846 fbiC FO synthase; Reviewed 98.46
TIGR00423331 TIGR00423 conserved hypothetical protein TIGR00423; Int 98.28
COG0320306 LipA Lipoate synthase [Coenzyme metabolism] 98.21
COG2516339 Biotin synthase-related enzyme [General function predic 98.2
PRK12928290 lipoyl synthase; Provisional 98.2
PRK05481289 lipoyl synthase; Provisional 98.19
COG0731296 Fe-S oxidoreductases [Energy production and conversion] 98.1
COG1509369 KamA Lysine 2,3-aminomutase [Amino acid transport and m 97.75
COG0820349 Predicted Fe-S-cluster redox enzyme [General function p 97.66
PRK11194372 hypothetical protein; Provisional 97.49
TIGR00510310 lipA lipoic acid synthetase; InterPro: IPR003698 Lipoic 96.71
COG4277404 Predicted DNA-binding protein with the Helix-hairpin-he 96.28
TIGR00048378 TIGR00048 radical SAM enzyme, Cfr family; InterPro: IPR 94.92
PRK13762321 tRNA-modifying enzyme; Provisional 91.53
KOG4355547 consensus 99.05
TIGR03278404 methan_mark_10 putative methanogenesis marker protein 1 97.62
COG1625414 Fe-S oxidoreductase, related to NifB/MoaA family [Energ 97.58
PRK10076213 pyruvate formate lyase II activase; Provisional 97.35
TIGR03365238 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesi 96.66
COG0602212 NrdG Organic radical activating enzymes [Posttranslatio 94.83
TIGR02491158 NrdG anaerobic ribonucleoside-triphosphate reductase ac 92.01
PRK11121154 nrdG anaerobic ribonucleotide reductase-activating prot 91.91
COG2238147 RPS19A Ribosomal protein S19E (S16A) [Translation, ribo 94.92
PRK09333150 30S ribosomal protein S19e; Provisional 94.61
PRK03902142 manganese transport transcriptional regulator; Provisio 93.76
PRK11512144 DNA-binding transcriptional repressor MarR; Provisional 93.75
PRK11050155 manganese transport regulator MntR; Provisional 93.5
pfam01090140 Ribosomal_S19e Ribosomal protein S19e. 92.98
PRK10870176 transcriptional repressor MprA; Provisional 92.76
smart0052996 HTH_DTXR Helix-turn-helix diphteria tox regulatory elem 92.57
PTZ00095169 40S ribosomal protein S19; Provisional 91.89
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resistanc 90.95
COG0656280 ARA1 Aldo/keto reductases, related to diketogulonate re 93.07
COG1964475 Predicted Fe-S oxidoreductases [General function predic 92.52
TIGR02402 564 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase 90.8
>PRK09057 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08599 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK06582 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05628 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK05799 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK07379 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08898 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08807 consensus Back     alignment and domain information
>PRK05660 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08949 consensus Back     alignment and domain information
>PRK08208 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK06294 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK13347 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09249 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09058 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05904 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08629 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase; InterPro: IPR004559 Experimentally determined examples of oxygen-independent coproporphyrinogen III oxidase, an enzyme that replaces HemF function under anaerobic conditions, belong to a family of proteins called HemN (IPR004558 from INTERPRO) Back     alignment and domain information
>TIGR00538 hemN oxygen-independent coproporphyrinogen III oxidase; InterPro: IPR004558 This family represents HemN, the oxygen-independent coproporphyrinogen III oxidase that replaces HemF function under anaerobic conditions Back     alignment and domain information
>PRK08207 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR00433 bioB biotin synthase; InterPro: IPR002684 Biotin synthase 2 Back     alignment and domain information
>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01212 TIGR01212 radical SAM protein, TIGR01212 family; InterPro: IPR005911 This uncharacterised protein family shows significant similarity to IPR005910 from INTERPRO, a longer protein that is a histone acetyltransferase at its C-terminus and is a subunit of RNA polymerase II (in yeast) Back     alignment and domain information
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family; InterPro: IPR005910 Histone acetylation is carried out by a class of enzymes known as histone acetyltransferases (HATs), which catalyse the transfer of an acetyl group from acetyl-CoA to the lysine E-amino groups on the N-terminal tails of histones Back     alignment and domain information
>TIGR00089 TIGR00089 RNA modification enzyme, MiaB family; InterPro: IPR005839 This entry represents a family defined on the basis of sequence similarity Back     alignment and domain information
>COG1242 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0621 MiaB 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01574 miaB-methiolase tRNA-i(6)A37 thiotransferase enzyme MiaB; InterPro: IPR006463 These sequences are homologs of the MiaB enzyme responsible for the modification of the isopentenylated adenine-37 base of most bacterial and eukaryotic tRNAs that read codons beginning with uracil (all except tRNA(I,V) Ser) Back     alignment and domain information
>cd01335 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>TIGR01579 MiaB-like-C MiaB-like tRNA modifying enzyme; InterPro: IPR006467 This clade of sequences is closely related to MiaB, a modifier of isopentenylated adenosine-37 of certain eukaryotic and bacterial tRNAs (see IPR006463 from INTERPRO) Back     alignment and domain information
>COG1032 Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>TIGR01578 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-type; InterPro: IPR006466 This clade of sequences is closely related to MiaB, a modifier of isopentenylated adenosine-37 of certain eukaryotic and bacterial tRNAs (see IPR006463 from INTERPRO) Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>PRK06267 hypothetical protein; Provisional Back     alignment and domain information
>KOG2535 consensus Back     alignment and domain information
>TIGR01125 TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR01125; InterPro: IPR005840 This is a family of mainly hypothetical proteins of unknown function Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>COG1031 Uncharacterized Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase; InterPro: IPR011772 This entry respresents the cobalamin-dependent oxidative cyclase responsible for forming the distinctive E-ring of the chlorin ring system under anaerobic conditions Back     alignment and domain information
>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>COG1244 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>KOG2492 consensus Back     alignment and domain information
>PRK07360 FO synthase subunit 2; Reviewed Back     alignment and domain information
>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK05927 hypothetical protein; Provisional Back     alignment and domain information
>PRK06245 cofG FO synthase subunit 1; Reviewed Back     alignment and domain information
>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional Back     alignment and domain information
>COG0535 Predicted Fe-S oxidoreductases [General function prediction only] Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>PRK05926 hypothetical protein; Provisional Back     alignment and domain information
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>TIGR03550 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit Back     alignment and domain information
>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown] Back     alignment and domain information
>PRK13758 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>TIGR02666 moaA molybdenum cofactor biosynthesis protein A; InterPro: IPR013483 The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cisdithiolene moiety to molybdopterin (MPT) Back     alignment and domain information
>PRK13745 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>PRK09613 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A; InterPro: IPR013485 This entry consists of archaeal proteins which are predicted to be functionally equivalent to MoaA (molybdenum cofactor biosynthesis protein A) from bacteria (see IPR013483 from INTERPRO) Back     alignment and domain information
>COG1533 SplB DNA repair photolyase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1180 PflA Pyruvate-formate lyase-activating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02493 PFLA pyruvate formate-lyase 1-activating enzyme; InterPro: IPR012838 Members of this family are iron-sulphur proteins with a radical-SAM domain Back     alignment and domain information
>TIGR01210 TIGR01210 conserved hypothetical protein TIGR01210; InterPro: IPR005909 This family of exclusively archaeal proteins has no characterised close homologs Back     alignment and domain information
>COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme [General function prediction only] Back     alignment and domain information
>KOG2900 consensus Back     alignment and domain information
>PRK00955 hypothetical protein; Provisional Back     alignment and domain information
>PRK01254 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02495 NrdG2 anaerobic ribonucleoside-triphosphate reductase activating protein; InterPro: IPR012840 This enzyme is a member of the radical-SAM family Back     alignment and domain information
>KOG2672 consensus Back     alignment and domain information
>KOG2876 consensus Back     alignment and domain information
>COG5014 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>pfam06969 HemN_C HemN C-terminal region Back     alignment and domain information
>pfam04055 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>TIGR02351 thiH thiazole biosynthesis protein ThiH; InterPro: IPR012726 Members of this protein family are the ThiH proteins involved in thiamine biosynthesis Back     alignment and domain information
>PRK08444 hypothetical protein; Provisional Back     alignment and domain information
>PRK08445 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH Back     alignment and domain information
>COG0641 AslB Arylsulfatase regulator (Fe-S oxidoreductase) [General function prediction only] Back     alignment and domain information
>COG2100 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK11145 pflA pyruvate formate lyase-activating enzyme 1; Provisional Back     alignment and domain information
>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E; InterPro: IPR011843 This entry describes coenzyme PQQ biosynthesis protein E, a gene required for the biosynthesis of pyrrolo-quinoline-quinone (coenzyme PQQ) Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>TIGR00423 TIGR00423 conserved hypothetical protein TIGR00423; InterPro: IPR005244 This entry describes a family of conserved hypothetical proteins with no known function Back     alignment and domain information
>COG0320 LipA Lipoate synthase [Coenzyme metabolism] Back     alignment and domain information
>COG2516 Biotin synthase-related enzyme [General function prediction only] Back     alignment and domain information
>PRK12928 lipoyl synthase; Provisional Back     alignment and domain information
>PRK05481 lipoyl synthase; Provisional Back     alignment and domain information
>COG0731 Fe-S oxidoreductases [Energy production and conversion] Back     alignment and domain information
>COG1509 KamA Lysine 2,3-aminomutase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0820 Predicted Fe-S-cluster redox enzyme [General function prediction only] Back     alignment and domain information
>PRK11194 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00510 lipA lipoic acid synthetase; InterPro: IPR003698 Lipoic acid is a covalently bound disulphide-containing cofactor required for function of the pyruvate dehydrogenase, alpha-ketoglutarate dehydrogenase, and glycine cleavage enzyme complexes of Escherichia coli Back     alignment and domain information
>COG4277 Predicted DNA-binding protein with the Helix-hairpin-helix motif [General function prediction only] Back     alignment and domain information
>TIGR00048 TIGR00048 radical SAM enzyme, Cfr family; InterPro: IPR004383 This family of conserved hypothetical proteins groups bacterial proteins of unknown function Back     alignment and domain information
>PRK13762 tRNA-modifying enzyme; Provisional Back     alignment and domain information
>KOG4355 consensus Back     alignment and domain information
>TIGR03278 methan_mark_10 putative methanogenesis marker protein 10 Back     alignment and domain information
>COG1625 Fe-S oxidoreductase, related to NifB/MoaA family [Energy production and conversion] Back     alignment and domain information
>PRK10076 pyruvate formate lyase II activase; Provisional Back     alignment and domain information
>TIGR03365 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE Back     alignment and domain information
>COG0602 NrdG Organic radical activating enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02491 NrdG anaerobic ribonucleoside-triphosphate reductase activating protein; InterPro: IPR012837 This enzyme is a member of the radical-SAM protein and utilises S-adenosyl methionine, an iron-sulphur cluster and a reductant (dihydroflavodoxin ) to produce a glycine-centred radical in the class III (anaerobic) ribonucleotide triphosphate reductase (NrdD, IPR009161 from INTERPRO) Back     alignment and domain information
>PRK11121 nrdG anaerobic ribonucleotide reductase-activating protein; Provisional Back     alignment and domain information
>COG2238 RPS19A Ribosomal protein S19E (S16A) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09333 30S ribosomal protein S19e; Provisional Back     alignment and domain information
>PRK03902 manganese transport transcriptional regulator; Provisional Back     alignment and domain information
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>PRK11050 manganese transport regulator MntR; Provisional Back     alignment and domain information
>pfam01090 Ribosomal_S19e Ribosomal protein S19e Back     alignment and domain information
>PRK10870 transcriptional repressor MprA; Provisional Back     alignment and domain information
>smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element Back     alignment and domain information
>PTZ00095 40S ribosomal protein S19; Provisional Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>COG1964 Predicted Fe-S oxidoreductases [General function prediction only] Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase; InterPro: IPR012768 Members of this family are the trehalose biosynthetic enzyme malto-oligosyltrehalose trehalohydrolase, formally known as 4-alpha-D-{(1->4)-alpha-D-glucano}trehalose trehalohydrolase (3 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target395 coproporphyrinogen III oxidase [Candidatus Liberibacter
1olt_A457 Coproporphyrinogen Iii Oxidase (Hemn) From Escheric 1e-48
gi|40889237|pdb|1OLT|A Chain A, Coproporphyrinogen Iii Oxidase (Hemn) From Escherichia Coli Is A Radical Sam Enzyme. Length = 457 Back     alignment and structure
 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 86/405 (21%), Positives = 163/405 (40%), Gaps = 25/405 (6%)

Query: 5   SAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQ 64
            A+   +       L +YVH PFC K C +C  N  V R +   + ++ +   E+     
Sbjct: 39  QAFLQAVARYPERPLSLYVHIPFCHKLCYFCGCNKIVTRQQHKADQYLDALEQEIVHRAP 98

Query: 65  LTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQG 124
           L   R +S + +GGGTP+ +    I+ ++  + +N+  +++ EI+IE +P  +E++    
Sbjct: 99  LFAGRHVSQLHWGGGTPTYLNKAQISRLMKLLRENFQFNADAEISIEVDPREIELDVLDH 158

Query: 125 YRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFP-RMSFDLIYALPKQT 183
            R  G NR+S+GVQ   ++  R + R  +     A ++ AR I     + DLIY LPKQT
Sbjct: 159 LRAEGFNRLSMGVQDFNKEVQRLVNREQDEEFIFALLNHAREIGFTSTNIDLIYGLPKQT 218

Query: 184 MTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSIT 243
              +   L+R      D LS++       T+F    K  D  LPS    +D+   T +  
Sbjct: 219 PESFAFTLKRVAELNPDRLSVFNYAHLP-TIFAAQRKIKDADLPSPQQKLDILQETIAFL 277

Query: 244 SAHGLHAYEISNHSFLGAE------------SLHNLNYWRYGDYIGIGPGAHSRVKVGSH 291
           +  G     + + +    E            +          D +G+G  A S +     
Sbjct: 278 TQSGYQFIGMDHFARPDDELAVAQREGVLHRNFQGYTTQGDTDLLGMGVSAISMIGDCYA 337

Query: 292 RVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           +      K  + + + V + G+A+     L+ +      ++  L     +     E    
Sbjct: 338 QNQ----KELKQYYQQVDEQGNALWRGIALTRDDCIRRDVIKSLICNFRLDYSPIEQQWD 393

Query: 352 RNLDIEC------ERNLQRQGFIERVQFSRLRCTQRGMTMLDSVI 390
                           L + G ++  +   ++ T +G  ++ ++ 
Sbjct: 394 LLFADYFAEDLKLLAPLAKDGLVDVDEKG-IQVTAKGRLLIRNIC 437


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target395 coproporphyrinogen III oxidase [Candidatus Liberibacter
1olt_A457 Oxygen-independent coproporphyrinogen III oxidase; heme 5e-75
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM radica 9e-05
>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4S cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2 Length = 457 Back     alignment and structure
 Score =  276 bits (707), Expect = 5e-75
 Identities = 90/404 (22%), Positives = 168/404 (41%), Gaps = 21/404 (5%)

Query: 5   SAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQ 64
            A+   +       L +YVH PFC K C +C  N  V R +   + ++ +   E+     
Sbjct: 39  QAFLQAVARYPERPLSLYVHIPFCHKLCYFCGCNKIVTRQQHKADQYLDALEQEIVHRAP 98

Query: 65  LTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQG 124
           L   R +S + +GGGTP+ +    I+ ++  + +N+  +++ EI+IE +P  +E++    
Sbjct: 99  LFAGRHVSQLHWGGGTPTYLNKAQISRLMKLLRENFQFNADAEISIEVDPREIELDVLDH 158

Query: 125 YRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSFDLIYALPKQT 183
            R  G NR+S+GVQ   ++  R + R  +     A ++ AR I F   + DLIY LPKQT
Sbjct: 159 LRAEGFNRLSMGVQDFNKEVQRLVNREQDEEFIFALLNHAREIGFTSTNIDLIYGLPKQT 218

Query: 184 MTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSIT 243
              +   L+R      D LS++       T+F    K  D  LPS    +D+   T +  
Sbjct: 219 PESFAFTLKRVAELNPDRLSVFNYAHL-PTIFAAQRKIKDADLPSPQQKLDILQETIAFL 277

Query: 244 SAHGLHAY----------EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV 293
           +  G              E++     G    +   Y   GD   +G G  +   +G    
Sbjct: 278 TQSGYQFIGMDHFARPDDELAVAQREGVLHRNFQGYTTQGDTDLLGMGVSAISMIGDCY- 336

Query: 294 AISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRN 353
               +K  + + + V + G+A+     L+ +      ++  L     +     E      
Sbjct: 337 -AQNQKELKQYYQQVDEQGNALWRGIALTRDDCIRRDVIKSLICNFRLDYSPIEQQWDLL 395

Query: 354 L------DIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIA 391
                  D++    L + G ++  +   ++ T +G  ++ ++  
Sbjct: 396 FADYFAEDLKLLAPLAKDGLVDVDE-KGIQVTAKGRLLIRNICM 438


>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Length = 348 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target395 coproporphyrinogen III oxidase [Candidatus Liberibacter
1olt_A457 Oxygen-independent coproporphyrinogen III oxidase; heme 100.0
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM radica 99.9
2qgq_A304 Protein TM_1862; alpha-beta protein, structural genomic 99.88
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, FES c 99.63
3c8f_A245 Pyruvate formate-lyase 1-activating enzyme; adoMet radi 98.98
2yx0_A342 Radical SAM enzyme; predicted tRNA modification enzyme, 98.67
1tv8_A340 MOAA, molybdenum cofactor biosynthesis protein A; TIM b 98.59
2z2u_A311 UPF0026 protein MJ0257; metal binding protein; 2.40A {M 98.44
2a5h_A416 L-lysine 2,3-aminomutase; radical SAM, four-iron-four-s 98.21
3can_A182 Pyruvate-formate lyase-activating enzyme; structural ge 97.77
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, DNA-b 95.21
2h09_A155 Transcriptional regulator MNTR; transcription regulator 95.07
2v7f_A150 RPS19, RPS19E SSU ribosomal protein S19E; diamond black 93.79
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A {Sul 93.73
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-helix, 93.22
2fxa_A207 Protease production regulatory protein HPR; protease po 92.93
3oop_A143 LIN2960 protein; protein structure initiative, PSI-2, s 92.23
1r7j_A95 Conserved hypothetical protein SSO10A; winged helix-tur 91.58
3ech_A142 MEXR, multidrug resistance operon repressor; winged hel 91.32
3g3z_A145 NMB1585, transcriptional regulator, MARR family; transc 90.98
3cjn_A162 Transcriptional regulator, MARR family; structural geno 90.91
2fa5_A162 Transcriptional regulator MARR/EMRR family; multiple an 90.87
3bj6_A152 Transcriptional regulator, MARR family; helix-turn-heli 90.35
3e6m_A161 MARR family transcriptional regulator; APC88769, silici 90.11
1qwg_A251 PSL synthase;, (2R)-phospho-3-sulfolactate synthase; be 91.78
3cta_A230 Riboflavin kinase; structural genomics, transferase, PS 91.27
>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4S cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2 Back     alignment and structure
Probab=100.00  E-value=0  Score=655.22  Aligned_cols=382  Identities=23%  Similarity=0.368  Sum_probs=352.6

Q ss_pred             HHHHHHCCCCCCCEEEEEECCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCC
Q ss_conf             89988428898854999940651183765773024578866288999999999999987618950589996288888789
Q gi|254780628|r    6 AYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIE   85 (395)
Q Consensus         6 ~~~~~~~~~~~~~l~lYihiPFC~~~C~yC~f~~~~~~~~~~~~~y~~~l~~Ei~~~~~~~~~~~~~~iy~GGGTPs~l~   85 (395)
                      ++.+.+...+.+|||||||||||+++|+||+|++.+.+.....++|+++|.+||+..+...++.++++|||||||||+|+
T Consensus        40 ~~~~~l~~~~~~plsLYiHIPFC~~~C~yC~~~~~~~~~~~~~~~Yl~~L~~Ei~~~a~~~~~~~v~~i~~GGGTpt~L~  119 (457)
T 1olt_A           40 AFLQAVARYPERPLSLYVHIPFCHKLCYFCGCNKIVTRQQHKADQYLDALEQEIVHRAPLFAGRHVSQLHWGGGTPTYLN  119 (457)
T ss_dssp             HHHHHHTTCTTSCEEEEEEECEESSCCTTCCSSCEECSCTHHHHHHHHHHHHHHHHHGGGGTTCCEEEEEEEESCGGGSC
T ss_pred             HHHHHHHCCCCCCEEEEEECCCCCCCCCCCCCCEECCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCC
T ss_conf             99999850999964999970898988999998245588866199999999999999655638997459998287504489


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             99999999766404764443321133210410023477663034541143234332013455422443134789999863
Q gi|254780628|r   86 PQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLAR  165 (395)
Q Consensus        86 ~~~l~~ll~~i~~~~~~~~~~e~t~E~~P~~~~~~~l~~l~~~Gv~RiS~GvQs~~~~~l~~~~R~~~~~~~~~~~~~~~  165 (395)
                      ++++++|++.+++.|++.+++|+|+|++|.+++.++++.|+++||||+||||||||+++|+++||.|+.+++.++++.++
T Consensus       120 ~~~l~~l~~~l~~~f~~~~~~e~tiE~~P~~~~~~~l~~l~~~G~nRiSlGvQsfd~~vlk~i~R~~~~e~~~~~i~~~r  199 (457)
T 1olt_A          120 KAQISRLMKLLRENFQFNADAEISIEVDPREIELDVLDHLRAEGFNRLSMGVQDFNKEVQRLVNREQDEEFIFALLNHAR  199 (457)
T ss_dssp             HHHHHHHHHHHHHHSCEEEEEEEEEEECSSSCCTHHHHHHHHTTCCEEEEEEECCCHHHHHHHTCCCCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHCCCCHHHHHHHHHHHH
T ss_conf             99999999999986477877079998259987176799997379987996078697798856214673888999999999


Q ss_pred             CC-CCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEEEEEEECCCEEHHHHHCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             02-44433321000258543221112788753180012346468825960001454498021103567889998655788
Q gi|254780628|r  166 NI-FPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITS  244 (395)
Q Consensus       166 ~~-~~~v~iDli~GlPgqt~e~~~~~l~~~~~l~p~~is~Y~l~i~~~t~l~~~~~~~~~~~p~~~~~~~~~~~a~e~L~  244 (395)
                      ++ +.+||+||||||||||.++|.+||+.+++++||||++|+|.+.|+|. ..+...++..+|++++..+||+.+.+.|.
T Consensus       200 ~~g~~~i~~DLI~GlPgqt~e~~~~tl~~~~~l~pd~i~~y~~~~~p~~~-~~q~~~~~~~lp~~~~~~~~~~~a~~~L~  278 (457)
T 1olt_A          200 EIGFTSTNIDLIYGLPKQTPESFAFTLKRVAELNPDRLSVFNYAHLPTIF-AAQRKIKDADLPSPQQKLDILQETIAFLT  278 (457)
T ss_dssp             HTTCCSCEEEEEESCTTCCHHHHHHHHHHHHHHCCSEEEEEECCCCTTTS-GGGGGSCGGGSCCHHHHHHHHHHHHHHHH
T ss_pred             HHHCCEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECEECCCHH-HHHHCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             84054372331577998337788889988884089811343110078427-76632222354202799999999999999


Q ss_pred             HCCCCCCCCCCHHHHHH----------HHCCCCCCCCC--CCEEECCCCCCCCCCCCCCEEEEEEECCCHHHHHHHHCCC
Q ss_conf             70962423674343101----------10133211244--4123204320011578861578654247025778775389
Q gi|254780628|r  245 AHGLHAYEISNHSFLGA----------ESLHNLNYWRY--GDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNG  312 (395)
Q Consensus       245 ~~GY~~Yeis~fak~~~----------~s~hn~~Yw~~--~d~iG~G~GA~S~l~~~~~~~~~~~~~~~~~Y~~~i~~~~  312 (395)
                      ++||.+|++++|+||+.          .++|+++||..  .++||||+||+|++++.    .++|.+++++|.+++++++
T Consensus       279 ~~GY~~~~~~~fak~~d~l~~a~~~g~l~r~~~~y~~~~~~~~iGlG~sA~S~~~~~----~~~N~~~l~~Y~~~i~~g~  354 (457)
T 1olt_A          279 QSGYQFIGMDHFARPDDELAVAQREGVLHRNFQGYTTQGDTDLLGMGVSAISMIGDC----YAQNQKELKQYYQQVDEQG  354 (457)
T ss_dssp             HTTCEEEETTEEECTTSHHHHHHHHTCCEECSSCEESCCSCEEEEESTTCEEEETTE----EEEECSSHHHHHHHHHHHS
T ss_pred             HCCHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCEEECCCE----EEEECCCHHHHHHHHHHCC
T ss_conf             778354212331278725567876374432313411268830750477662103880----0474056799999998479


Q ss_pred             CCCCCEEECCHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHH------HHHHHHHCCCEEEEECCEEEECHHHHHHH
Q ss_conf             633322454999989999999656237998889998838996499------99999987994985598999956758989
Q gi|254780628|r  313 HAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIE------CERNLQRQGFIERVQFSRLRCTQRGMTML  386 (395)
Q Consensus       313 ~p~~~~~~Ls~~e~~~e~l~~~LR~~~Gid~~~~~~~fg~~~~~~------~~~~L~~~Gli~~~~~~~l~lT~~G~~~~  386 (395)
                      +|+.++..+|.+|++++++|++||+..|||.+.|+++||.++...      .+++|+++||++ .+++++++|++|++|+
T Consensus       355 ~~~~~g~~ls~~d~~r~~ii~~L~~~~~ld~~~~~~~fg~~~~~~f~~~~~~L~~l~~~GLv~-~~~~~i~lT~~Gr~l~  433 (457)
T 1olt_A          355 NALWRGIALTRDDCIRRDVIKSLICNFRLDYSPIEQQWDLLFADYFAEDLKLLAPLAKDGLVD-VDEKGIQVTAKGRLLI  433 (457)
T ss_dssp             CCEEEEEECCHHHHHHHHHHHHHHHHSEEEHHHHHHHTTCCHHHHTHHHHHHHHHHHHTTSEE-ECSSEEEECTTTGGGH
T ss_pred             CCHHCCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEE-EECCEEEECHHHHHHH
T ss_conf             952403468988999999999899838928799999979788898799999999999789899-9899999998489999


Q ss_pred             HHHHHHH
Q ss_conf             9999986
Q gi|254780628|r  387 DSVIANL  393 (395)
Q Consensus       387 d~I~~~l  393 (395)
                      |+|+..|
T Consensus       434 ~~I~~~F  440 (457)
T 1olt_A          434 RNICMCF  440 (457)
T ss_dssp             HHHHHTT
T ss_pred             HHHHHHH
T ss_conf             9999999



>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>2qgq_A Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8} Back     alignment and structure
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
>3c8f_A Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A* Back     alignment and structure
>2yx0_A Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii} Back     alignment and structure
>1tv8_A MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} SCOP: c.1.28.3 PDB: 1tv7_A* 2fb3_A* 2fb2_A* Back     alignment and structure
>2z2u_A UPF0026 protein MJ0257; metal binding protein; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>2a5h_A L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, S-adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale} Back     alignment and structure
>3can_A Pyruvate-formate lyase-activating enzyme; structural genomics, PSI, MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>2v7f_A RPS19, RPS19E SSU ribosomal protein S19E; diamond blackfan anemia small ribosomal subunit; 1.15A {Pyrococcus abyssi} SCOP: a.4.5.84 Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, structural genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled coil, structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} PDB: 1lnw_A 3mex_A Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structural genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, structural genomics, PSI-2; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} Back     alignment and structure
>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Back     alignment and structure
>3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 395 coproporphyrinogen III oxidase [Candidatus Liberibacter
d1olta_441 c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III 1e-54
>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Length = 441 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Radical SAM enzymes
family: Oxygen-independent coproporphyrinogen III oxidase HemN
domain: Oxygen-independent coproporphyrinogen III oxidase HemN
species: Escherichia coli [TaxId: 562]
 Score =  207 bits (527), Expect = 1e-54
 Identities = 82/406 (20%), Positives = 163/406 (40%), Gaps = 25/406 (6%)

Query: 5   SAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQ 64
            A+   +       L +YVH PFC K C +C  N  V R +   + ++ +   E+     
Sbjct: 36  QAFLQAVARYPERPLSLYVHIPFCHKLCYFCGCNKIVTRQQHKADQYLDALEQEIVHRAP 95

Query: 65  LTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVNNFQG 124
           L   R +S + +GGGTP+ +    I+ ++  + +N+  +++ EI+IE +P  +E++    
Sbjct: 96  LFAGRHVSQLHWGGGTPTYLNKAQISRLMKLLRENFQFNADAEISIEVDPREIELDVLDH 155

Query: 125 YRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRM-SFDLIYALPKQT 183
            R  G NR+S+GVQ   ++  R + R  +     A ++ AR I     + DLIY LPKQT
Sbjct: 156 LRAEGFNRLSMGVQDFNKEVQRLVNREQDEEFIFALLNHAREIGFTSTNIDLIYGLPKQT 215

Query: 184 MTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSIT 243
              +   L+R      D LS++           +     D  LPS    +D+   T +  
Sbjct: 216 PESFAFTLKRVAELNPDRLSVFNYAHLPTIFAAQRKIK-DADLPSPQQKLDILQETIAFL 274

Query: 244 SAHGLHAYEISNHSFLGAE------------SLHNLNYWRYGDYIGIGPGAHSRVKVGSH 291
           +  G     + + +    E            +          D +G+G  A S +     
Sbjct: 275 TQSGYQFIGMDHFARPDDELAVAQREGVLHRNFQGYTTQGDTDLLGMGVSAISMIGDCYA 334

Query: 292 RVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAG 351
           +    ++++ +       + G+A+     L+ +      ++  L     +     E    
Sbjct: 335 QNQKELKQYYQQVD----EQGNALWRGIALTRDDCIRRDVIKSLICNFRLDYSPIEQQWD 390

Query: 352 RNL------DIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIA 391
                    D++    L + G ++  +   ++ T +G  ++ ++  
Sbjct: 391 LLFADYFAEDLKLLAPLAKDGLVDVDE-KGIQVTAKGRLLIRNICM 435


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target395 coproporphyrinogen III oxidase [Candidatus Liberibacter
d1olta_441 Oxygen-independent coproporphyrinogen III oxidase HemN 100.0
d1r30a_312 Biotin synthase {Escherichia coli [TaxId: 562]} 99.71
d1tv8a_327 Molybdenum cofactor biosynthesis protein A MoaA {Staphy 98.17
d1r7ja_90 Sso10a (SSO10449) {Archaeon Sulfolobus solfataricus [Ta 94.17
d2v7fa1149 Ribosomal protein S19e {Pyrococcus abyssi [TaxId: 29292 93.77
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acidophil 91.79
d2a61a1139 Transcriptional regulator TM0710 {Thermotoga maritima [ 90.14
d1qwga_