254780629

254780629

putative deoxyribonucleotide triphosphate pyrophosphatase

GeneID in NCBI database:8209629Locus tag:CLIBASIA_02580
Protein GI in NCBI database:254780629Protein Accession:YP_003065042.1
Gene range:+(641234, 641908)Protein Length:224aa
Gene description:putative deoxyribonucleotide triphosphate pyrophosphatase
COG prediction:[F] Xanthosine triphosphate pyrophosphatase
KEGG prediction:putative deoxyribonucleotide triphosphate pyrophosphatase; K01516 nucleoside-triphosphatase [EC:3.6.1.15]
SEED prediction:Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Thiamine metabolism [PATH:las00730]
Subsystem involved in SEED:Heme and Siroheme Biosynthesis;
Housecleaning nucleoside triphosphate pyrophosphatases;
Heat shock dnaK gene cluster extended
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK
cccccccEEEEEEccccHHHHHHHHHHHcccEEEEHHcccccccccccccHHHHHHHHHHHHHHHHcccEEEEccEEEEEcccccccccEEHHccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEEcccccEEEEEEEEEEEEEcccccccccccccEEEEccccccHHHccHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHcc
cccccccEEEEEcccccHHHHHHHHHHHcccEEEEHHHccccccccccccHHHHHHHHHHHHHHHccccccccccccEEEcccccccEEEEcccccccccHHHHHHHHHHHHHHHHHccccHHHcccEEEEEEEEEccccccEEEEEEEccEEEEccccccccHHHHHEEcccccccHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcc
MRKLIENNIVIAShnvdkihemdslimplgIMTTSALElnliipeetgnsfeeNAMIKSLTAAknagmpalsddsglvidvldgkpgihsarwaesntgerdFDMAMQKIENALRSkfahdpafrsaHFISVLslawpdghvenfsgkvsgiivwpprgqlgfgydpifqpngydrtfgemteeeknggidsatLFSILSTDLLSHRARAFKCFVdnclridek
MRKLIENNIVIAshnvdkiheMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVLDGKpgihsarwaesntgerDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKcfvdnclridek
MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK
*****EN*IVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID**
MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK
****IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK
MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK
MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target224 putative deoxyribonucleotide triphosphate pyrophosphata
315121830223 putative deoxyribonucleotide triphosphate pyrophosphata 1 7e-93
209547616214 deoxyribonucleotide triphosphate pyrophosphatase [Rhizo 1 3e-72
15964127214 putative deoxyribonucleotide triphosphate pyrophosphata 1 1e-71
116250147214 deoxyribonucleotide triphosphate pyrophosphatase [Rhizo 1 6e-71
218661635214 putative deoxyribonucleotide triphosphate pyrophosphata 1 1e-70
159184260214 putative deoxyribonucleotide triphosphate pyrophosphata 1 2e-70
190890030214 nucleoside-triphosphatase, HAM1-like protein [Rhizobium 1 2e-70
86356018214 putative deoxyribonucleotide triphosphate pyrophosphata 1 3e-70
218459792214 putative deoxyribonucleotide triphosphate pyrophosphata 1 3e-70
150395236214 putative deoxyribonucleotide triphosphate pyrophosphata 1 3e-70
>gi|315121830|ref|YP_004062319.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 223 Back     alignment and organism information
 Score =  343 bits (881), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 161/224 (71%), Positives = 192/224 (85%), Gaps = 1/224 (0%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           MRKL+E +IVIASHN DKIHE+ +L+ PLGI+T SALEL+L++PEETG++FEENA+IK+L
Sbjct: 1   MRKLVEKSIVIASHNYDKIHEIRNLVAPLGIVTKSALELDLVVPEETGDTFEENAIIKAL 60

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
           +AA+ AG+PAL+DDSGLV+D LDGKPGI+SARWAE++TGERDF MAMQKIE  L S+ A+
Sbjct: 61  SAAQCAGIPALADDSGLVVDALDGKPGIYSARWAETSTGERDFYMAMQKIEEHLISQGAN 120

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
            P+ R AHFIS L LAWPDGHVE F G+V GIIVWPPRGQLGFGYDPIFQPNGYDRTFGE
Sbjct: 121 APSLRFAHFISALCLAWPDGHVEKFCGRVDGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRIDEK 224
           MTE+EKNG I +  + S    DL+SHRARAFKC  D+CL +DEK
Sbjct: 181 MTEKEKNGEI-TREILSRSRDDLVSHRARAFKCLFDSCLCVDEK 223


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209547616|ref|YP_002279533.1| deoxyribonucleotide triphosphate pyrophosphatase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 214 Back     alignment and organism information
>gi|15964127|ref|NP_384480.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Sinorhizobium meliloti 1021] Length = 214 Back     alignment and organism information
>gi|116250147|ref|YP_765985.1| deoxyribonucleotide triphosphate pyrophosphatase [Rhizobium leguminosarum bv. viciae 3841] Length = 214 Back     alignment and organism information
>gi|218661635|ref|ZP_03517565.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Rhizobium etli IE4771] Length = 214 Back     alignment and organism information
>gi|159184260|ref|NP_353358.2| putative deoxyribonucleotide triphosphate pyrophosphatase [Agrobacterium tumefaciens str. C58] Length = 214 Back     alignment and organism information
>gi|190890030|ref|YP_001976572.1| nucleoside-triphosphatase, HAM1-like protein [Rhizobium etli CIAT 652] Length = 214 Back     alignment and organism information
>gi|86356018|ref|YP_467910.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Rhizobium etli CFN 42] Length = 214 Back     alignment and organism information
>gi|218459792|ref|ZP_03499883.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Rhizobium etli Kim 5] Length = 214 Back     alignment and organism information
>gi|150395236|ref|YP_001325703.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Sinorhizobium medicae WSM419] Length = 214 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target224 putative deoxyribonucleotide triphosphate pyrophosphata
PRK00120196 PRK00120, PRK00120, dITP/XTP pyrophosphatase; Reviewed 4e-70
cd00515183 cd00515, HAM1, NTPase/HAM1 1e-51
COG0127194 COG0127, COG0127, Xanthosine triphosphate pyrophosphata 7e-51
PRK14822200 PRK14822, PRK14822, nucleoside-triphosphatase; Provisio 1e-41
TIGR00042184 TIGR00042, TIGR00042, non-canonical purine NTP pyrophos 8e-40
PRK14823191 PRK14823, PRK14823, putative deoxyribonucleoside-tripho 3e-36
PRK14824201 PRK14824, PRK14824, putative deoxyribonucleotide tripho 4e-28
PRK14821184 PRK14821, PRK14821, putative deoxyribonucleotide tripho 5e-28
PRK14826222 PRK14826, PRK14826, putative deoxyribonucleotide tripho 2e-26
PRK02491328 PRK02491, PRK02491, putative deoxyribonucleotide tripho 5e-23
PRK14825199 PRK14825, PRK14825, putative deoxyribonucleotide tripho 2e-17
KOG3222195 KOG3222, KOG3222, KOG3222, Inosine triphosphate pyropho 3e-16
pfam01725181 pfam01725, Ham1p_like, Ham1 family 2e-53
cd00985131 cd00985, Maf_Ham1, Maf_Ham1 1e-11
>gnl|CDD|178879 PRK00120, PRK00120, dITP/XTP pyrophosphatase; Reviewed Back     alignment and domain information
>gnl|CDD|29953 cd00515, HAM1, NTPase/HAM1 Back     alignment and domain information
>gnl|CDD|30476 COG0127, COG0127, Xanthosine triphosphate pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|184835 PRK14822, PRK14822, nucleoside-triphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|161677 TIGR00042, TIGR00042, non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family Back     alignment and domain information
>gnl|CDD|184836 PRK14823, PRK14823, putative deoxyribonucleoside-triphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|184837 PRK14824, PRK14824, putative deoxyribonucleotide triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|184834 PRK14821, PRK14821, putative deoxyribonucleotide triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|173287 PRK14826, PRK14826, putative deoxyribonucleotide triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|179431 PRK02491, PRK02491, putative deoxyribonucleotide triphosphate pyrophosphatase/unknown domain fusion protein; Reviewed Back     alignment and domain information
>gnl|CDD|173286 PRK14825, PRK14825, putative deoxyribonucleotide triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|38432 KOG3222, KOG3222, KOG3222, Inosine triphosphate pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|145072 pfam01725, Ham1p_like, Ham1 family Back     alignment and domain information
>gnl|CDD|73242 cd00985, Maf_Ham1, Maf_Ham1 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 224 putative deoxyribonucleotide triphosphate pyrophosphata
PRK00120197 putative deoxyribonucleotide triphosphate pyrophosphata 100.0
PRK02491328 putative deoxyribonucleotide triphosphate pyrophosphata 100.0
TIGR00042205 TIGR00042 non-canonical purine NTP pyrophosphatase, rdg 100.0
COG0127194 Xanthosine triphosphate pyrophosphatase [Nucleotide tra 100.0
pfam01725181 Ham1p_like Ham1 family. This family consists of the HAM 100.0
cd00515183 HAM1 NTPase/HAM1. This family consists of the HAM1 prot 100.0
KOG3222195 consensus 100.0
cd00985131 Maf_Ham1 Maf_Ham1. Maf, a nucleotide binding protein, h 99.73
PRK04222191 consensus 96.73
PRK00148195 Maf-like protein; Reviewed 96.15
COG0424193 Maf Nucleotide-binding protein implicated in inhibition 96.1
PRK04719188 consensus 95.63
PRK01441207 Maf-like protein; Reviewed 95.11
PRK04425196 Maf-like protein; Reviewed 94.69
PRK01946195 consensus 94.64
PRK00648191 Maf-like protein; Reviewed 94.53
PRK03411194 consensus 94.24
PRK00884194 Maf-like protein; Reviewed 94.23
PRK00234192 Maf-like protein; Reviewed 94.22
PRK02478199 Maf-like protein; Reviewed 93.94
PRK03415197 consensus 93.9
PRK00032189 Maf-like protein; Reviewed 93.86
PRK02676196 consensus 92.93
PRK00078192 Maf-like protein; Reviewed 91.91
PRK01526205 Maf-like protein; Reviewed 91.46
PRK00238198 consensus 90.34
PRK03442213 consensus 90.41
>PRK00120 putative deoxyribonucleotide triphosphate pyrophosphatase; Reviewed Back     alignment and domain information
>PRK02491 putative deoxyribonucleotide triphosphate pyrophosphatase/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR00042 TIGR00042 non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family; InterPro: IPR002637 This family contains the Saccharomyces cerevisiae HAM1 protein P47119 from SWISSPROT and other hypothetical archaeal, bacterial and Caenorhabditis elegans proteins Back     alignment and domain information
>COG0127 Xanthosine triphosphate pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>pfam01725 Ham1p_like Ham1 family Back     alignment and domain information
>cd00515 HAM1 NTPase/HAM1 Back     alignment and domain information
>KOG3222 consensus Back     alignment and domain information
>cd00985 Maf_Ham1 Maf_Ham1 Back     alignment and domain information
>PRK04222 consensus Back     alignment and domain information
>PRK00148 Maf-like protein; Reviewed Back     alignment and domain information
>COG0424 Maf Nucleotide-binding protein implicated in inhibition of septum formation [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK04719 consensus Back     alignment and domain information
>PRK01441 Maf-like protein; Reviewed Back     alignment and domain information
>PRK04425 Maf-like protein; Reviewed Back     alignment and domain information
>PRK01946 consensus Back     alignment and domain information
>PRK00648 Maf-like protein; Reviewed Back     alignment and domain information
>PRK03411 consensus Back     alignment and domain information
>PRK00884 Maf-like protein; Reviewed Back     alignment and domain information
>PRK00234 Maf-like protein; Reviewed Back     alignment and domain information
>PRK02478 Maf-like protein; Reviewed Back     alignment and domain information
>PRK03415 consensus Back     alignment and domain information
>PRK00032 Maf-like protein; Reviewed Back     alignment and domain information
>PRK02676 consensus Back     alignment and domain information
>PRK00078 Maf-like protein; Reviewed Back     alignment and domain information
>PRK01526 Maf-like protein; Reviewed Back     alignment and domain information
>PRK00238 consensus Back     alignment and domain information
>PRK03442 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target224 putative deoxyribonucleotide triphosphate pyrophosphata
2pyu_A219 Structure Of The E. Coli Inosine Triphosphate Pyrop 3e-35
1k7k_A221 Crystal Structure Of Rdgb- Inosine Triphosphate Pyr 2e-34
2q16_A219 Structure Of The E. Coli Inosine Triphosphate Pyrop 2e-34
2e5x_A186 Structure Of Nucleotide Triphosphate Pyrophosphatas 4e-29
1v7r_A186 Structure Of Nucleotide Triphosphate Pyrophosphatas 5e-29
1vp2_A208 Crystal Structure Of A Putative Xanthosine Triphosp 2e-26
2i5d_A197 Crystal Structure Of Human Inosine Triphosphate Pyr 3e-25
2car_A196 Crystal Structure Of Human Inosine Triphosphatase L 3e-25
2mjp_A193 Structure-Based Identification Of The Biochemical F 5e-24
>gi|170292256|pdb|2PYU|A Chain A, Structure Of The E. Coli Inosine Triphosphate Pyrophosphatase Rgdb In Complex With Imp Length = 219 Back     alignment and structure
 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 68/215 (31%), Positives = 104/215 (48%), Gaps = 19/215 (8%)

Query: 6   ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKN 65
              +V+A+ NV K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  AAK 
Sbjct: 21  MQKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKV 80

Query: 66  AGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFR 125
             +PA++D SGL +DVL G PGI+SAR++  +  ++     +QK+   ++          
Sbjct: 81  TALPAIADASGLAVDVLGGAPGIYSARYSGEDATDQ---KNLQKLLETMKDVPDDQ-RQA 136

Query: 126 SAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGEMTEEE 185
             H + V      D       G   G+I   P G  GFGYDPIF      +T  E+T EE
Sbjct: 137 RFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREE 196

Query: 186 KNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR 220
           K+                +SHR +A K  +D    
Sbjct: 197 KSA---------------ISHRGQALKLLLDALRN 216


>gi|23200232|pdb|1K7K|A Chain A, Crystal Structure Of Rdgb- Inosine Triphosphate Pyrophosphatase From E. Coli Length = 221 Back     alignment and structure
>gi|168177070|pdb|2Q16|A Chain A, Structure Of The E. Coli Inosine Triphosphate Pyrophosphatase Rgdb In Complex With Itp Length = 219 Back     alignment and structure
>gi|151567524|pdb|2E5X|A Chain A, Structure Of Nucleotide Triphosphate Pyrophosphatase From Pyrococcus Horikoshii Ot3 Length = 186 Back     alignment and structure
gi|40889889|pdb|1V7R|A Chain A, Structure Of Nucleotide Triphosphate Pyrophosphatase From Pyrococcus Horikoshii Ot3 Length = 186 Back     alignment and structure
>gi|56554303|pdb|1VP2|A Chain A, Crystal Structure Of A Putative Xanthosine Triphosphate PyrophosphataseHAM1 PROTEIN HOMOLOG (TM0159) FROM THERMOTOGA Maritima At 1.78 A Resolution Length = 208 Back     alignment and structure
>gi|114794739|pdb|2I5D|A Chain A, Crystal Structure Of Human Inosine Triphosphate Pyrophosphatase Length = 197 Back     alignment and structure
>gi|88192652|pdb|2CAR|A Chain A, Crystal Structure Of Human Inosine Triphosphatase Length = 196 Back     alignment and structure
gi|6980392|pdb|2MJP|A Chain A, Structure-Based Identification Of The Biochemical Function Of A Hypothetical Protein From Methanococcus Jannaschii:mj0226 Length = 193 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target224 putative deoxyribonucleotide triphosphate pyrophosphata
1k7k_A221 Hypothetical protein YGGV; MAD, His-TAG, large groove, 2e-45
1vp2_A208 Putative xanthosine triphosphate pyrophosphatase/HAM1 p 7e-27
1v7r_A186 Hypothetical protein PH1917; ntpase, structural genomic 5e-25
2car_A196 Inosine triphosphate pyrophosphatase; hydrolase, inosin 5e-24
1b78_A193 Pyrophosphatase; structural genomics, hyperthermal prot 4e-23
>1k7k_A Hypothetical protein YGGV; MAD, His-TAG, large groove, disordered Se-Met, structural genomics, putative ribosomal protein, PSI; HET: MSE; 1.50A {Escherichia coli} SCOP: c.51.4.1 PDB: 2q16_A* 2pyu_A* Length = 221 Back     alignment and structure
 Score =  177 bits (449), Expect = 2e-45
 Identities = 74/218 (33%), Positives = 108/218 (49%), Gaps = 28/218 (12%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M+K     +V+A+ NV K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+ 
Sbjct: 23  MQK-----VVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKAR 77

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK   +PA++DDSGL +DVL G PGI+SAR++  +         +QK+   ++     
Sbjct: 78  HAAKVTALPAIADDSGLAVDVLGGAPGIYSARYSGED---ATDQKNLQKLLETMKDV--- 131

Query: 121 DPAFRSAHFISVLSLAW--PDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTF 178
               R A F  VL       D       G   G+I   P G  GFGYDPIF      +T 
Sbjct: 132 PDDQRQARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTA 191

Query: 179 GEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
            E+T EEK+                +SHR +A K  +D
Sbjct: 192 AELTREEKS---------------AISHRGQALKLLLD 214


>1vp2_A Putative xanthosine triphosphate pyrophosphatase/HAM1 protein homolog; TM0159; 1.78A {Thermotoga maritima} SCOP: c.51.4.1 Length = 208 Back     alignment and structure
>1v7r_A Hypothetical protein PH1917; ntpase, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; HET: CIT; 1.40A {Pyrococcus horikoshii OT3} SCOP: c.51.4.1 PDB: 2dvn_A* 2dvo_A* 2dvp_A 2ehk_A 2zti_A 2e5x_A* Length = 186 Back     alignment and structure
>2car_A Inosine triphosphate pyrophosphatase; hydrolase, inosine triphosphate pyrophosphohydrolase, inosine triphosphatase deficiency, ITP, IMP; 1.09A {Homo sapiens} SCOP: c.51.4.1 PDB: 2j4e_A* 2i5d_A Length = 196 Back     alignment and structure
>1b78_A Pyrophosphatase; structural genomics, hyperthermal protein; 2.20A {Methanococcus jannaschii} SCOP: c.51.4.1 PDB: 2mjp_A* Length = 193 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target224 putative deoxyribonucleotide triphosphate pyrophosphata
1k7k_A221 Hypothetical protein YGGV; MAD, His-TAG, large groove, 100.0
1vp2_A208 Putative xanthosine triphosphate pyrophosphatase/HAM1 p 100.0
1v7r_A186 Hypothetical protein PH1917; ntpase, structural genomic 100.0
1b78_A193 Pyrophosphatase; structural genomics, hyperthermal prot 100.0
2car_A196 Inosine triphosphate pyrophosphatase; hydrolase, inosin 100.0
2p5x_A230 ASMTL, N-acetylserotonin O-methyltransferase-like prote 96.1
1ex2_A189 Protein MAF; structural genomics, PSI, protein structur 95.64
>1k7k_A Hypothetical protein YGGV; MAD, His-TAG, large groove, disordered Se-Met, structural genomics, putative ribosomal protein, PSI; HET: MSE; 1.50A {Escherichia coli} SCOP: c.51.4.1 PDB: 2q16_A* 2pyu_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=428.85  Aligned_cols=198  Identities=36%  Similarity=0.539  Sum_probs=177.2

Q ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHCCCEEEEHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECHHHHHHHH
Q ss_conf             65677799984992279999997300791997244478856666765545677876533113456307852012434342
Q gi|254780629|r    3 KLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVL   82 (224)
Q Consensus         3 ~~~~~kii~aT~N~~K~~E~~~iL~~~~i~~~~~~~~~~~~peE~g~tf~eNA~~KA~~~~~~~~~pvlaDDSGL~vdaL   82 (224)
                      ++.|+||+|||+|+||++|++.+|.+++++++++.++++++|+|++.||.+||++||+++++.++.|||||||||||+||
T Consensus        20 ~~~M~kI~~aT~N~~K~~E~~~iL~~~~i~i~~~~~~~i~~~eE~g~t~~enA~~KA~~~~~~~~~pvl~DDSGL~idAL   99 (221)
T 1k7k_A           20 QGHMQKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVTALPAIADDSGLAVDVL   99 (221)
T ss_dssp             --CCEEEEESCCCHHHHHHHHHHHGGGTEEEEETTTTTCCCCCCCCSSHHHHHHHHHHHHHHHHSSCEEEEEEEEEEGGG
T ss_pred             HCCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEECCCEEEEEEC
T ss_conf             57887899993998899999997313397898645509887567760068888998999987338986962626999851


Q ss_pred             HCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEECCC--CCCCEEEEEEEEEEEEEECCCCC
Q ss_conf             0144514344304578868889999998877752135677765068998620132--34210456433324998264117
Q gi|254780629|r   83 DGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAW--PDGHVENFSGKVSGIIVWPPRGQ  160 (224)
Q Consensus        83 ~G~PGvySaR~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~R~A~f~~~~~~~~--~~~~~~~f~G~~~G~I~~~prG~  160 (224)
                      ||+|||||+||+++..++...   +.+++..+..   ....+|+|+|+|++++++  +++.+++|+|.|+|+|+.+|||+
T Consensus       100 ~g~PGvysar~~~~~~~d~~~---~~~~l~~l~~---~~~~~r~a~f~~~~~~~~~~~~~~~~~f~G~~~G~I~~~prG~  173 (221)
T 1k7k_A          100 GGAPGIYSARYSGEDATDQKN---LQKLLETMKD---VPDDQRQARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGT  173 (221)
T ss_dssp             TTCBGGGSTTTTCTTCCHHHH---HHHHHHHTTT---SCGGGCEEEEEEEEEEESSTTCSSCEEEEEEEEEEECSSCCCC
T ss_pred             CCCCCHHHHHHHHHCCCHHHH---HHHHHHHHHC---CCCCCCEEEEEEEEEEECCCCCCEEEEEEEEEEEEEEECCCCC
T ss_conf             799701328887665878999---9999998637---9802024899999999726889807999999856996455589


Q ss_pred             CCCCCCEEEEECCCCCCHHHCCHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             8857231366569984777689878501212322233233435258999999999999876
Q gi|254780629|r  161 LGFGYDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI  221 (224)
Q Consensus       161 ~GFGyDpIF~p~g~~kT~aEm~~~eKn~~~~~~~~~~~~~~~~iSHR~~Al~kl~~~l~~~  221 (224)
                      +||||||||+|+|+++|||||+.+|||+               ||||++|+++|+++|...
T Consensus       174 ~GFGyDpIFip~g~~kTfaEm~~~eKn~---------------iSHR~~Al~kl~~~Lk~~  219 (221)
T 1k7k_A          174 GGFGYDPIFFVPSEGKTAAELTREEKSA---------------ISHRGQALKLLLDALRNG  219 (221)
T ss_dssp             SSSTTGGGEEEGGGTEEGGGSCHHHHHH---------------HSHHHHHHHHHHHHHHCC
T ss_pred             CCCCCCEEEEECCCCCCHHHCCHHHHHH---------------CCHHHHHHHHHHHHHHHC
T ss_conf             9848782688799997653299989666---------------098999999999999855



>1vp2_A Putative xanthosine triphosphate pyrophosphatase/HAM1 protein homolog; TM0159; 1.78A {Thermotoga maritima} SCOP: c.51.4.1 Back     alignment and structure
>1v7r_A Hypothetical protein PH1917; ntpase, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; HET: CIT; 1.40A {Pyrococcus horikoshii OT3} SCOP: c.51.4.1 PDB: 2dvn_A* 2dvo_A* 2dvp_A 2ehk_A 2zti_A 2e5x_A* Back     alignment and structure
>1b78_A Pyrophosphatase; structural genomics, hyperthermal protein; 2.20A {Methanocaldococcus jannaschii} SCOP: c.51.4.1 PDB: 2mjp_A* Back     alignment and structure
>2car_A Inosine triphosphate pyrophosphatase; hydrolase, inosine triphosphate pyrophosphohydrolase, inosine triphosphatase deficiency, ITP, IMP; 1.09A {Homo sapiens} SCOP: c.51.4.1 PDB: 2j4e_A* 2i5d_A Back     alignment and structure
>2p5x_A ASMTL, N-acetylserotonin O-methyltransferase-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 2.00A {Homo sapiens} Back     alignment and structure
>1ex2_A Protein MAF; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: SUC PO4; 1.85A {Bacillus subtilis} SCOP: c.51.4.2 PDB: 1exc_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 224 putative deoxyribonucleotide triphosphate pyrophosphata
d1k7ka_209 c.51.4.1 (A:) Hypothetical protein YggV {Escherichia co 1e-33
d1v7ra_186 c.51.4.1 (A:) XTP pyrophosphatase {Archaeon Pyrococcus 2e-26
d1vp2a_189 c.51.4.1 (A:) Putative inosine/xanthosine triphosphate 5e-26
d2cara1194 c.51.4.1 (A:1-194) Inosine triphosphate pyrophosphatase 3e-24
d1b78a_184 c.51.4.1 (A:) XTP pyrophosphatase {Archaeon Methanococc 1e-23
>d1k7ka_ c.51.4.1 (A:) Hypothetical protein YggV {Escherichia coli [TaxId: 562]} Length = 209 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Anticodon-binding domain-like
superfamily: ITPase-like
family: ITPase (Ham1)
domain: Hypothetical protein YggV
species: Escherichia coli [TaxId: 562]
 Score =  136 bits (343), Expect = 1e-33
 Identities = 72/216 (33%), Positives = 107/216 (49%), Gaps = 24/216 (11%)

Query: 1   MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSL 60
           M+K     +V+A+ NV K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+ 
Sbjct: 13  MQK-----VVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKAR 67

Query: 61  TAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAH 120
            AAK   +PA++DDSGL +DVL G PGI+SAR++  +         +QK+   ++     
Sbjct: 68  HAAKVTALPAIADDSGLAVDVLGGAPGIYSARYSGEDA---TDQKNLQKLLETMKDV-PD 123

Query: 121 DPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFGE 180
           D      H + V      D       G   G+I   P G  GFGYDPIF      +T  E
Sbjct: 124 DQRQARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAE 183

Query: 181 MTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           +T EEK+                +SHR +A K  +D
Sbjct: 184 LTREEKS---------------AISHRGQALKLLLD 204


>d1v7ra_ c.51.4.1 (A:) XTP pyrophosphatase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 186 Back     information, alignment and structure
>d1vp2a_ c.51.4.1 (A:) Putative inosine/xanthosine triphosphate pyrophosphatase TM0159 {Thermotoga maritima [TaxId: 2336]} Length = 189 Back     information, alignment and structure
>d2cara1 c.51.4.1 (A:1-194) Inosine triphosphate pyrophosphatase, ITPase {Human (Homo sapiens) [TaxId: 9606]} Length = 194 Back     information, alignment and structure
>d1b78a_ c.51.4.1 (A:) XTP pyrophosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 184 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target224 putative deoxyribonucleotide triphosphate pyrophosphata
d1k7ka_209 Hypothetical protein YggV {Escherichia coli [TaxId: 562 100.0
d1vp2a_189 Putative inosine/xanthosine triphosphate pyrophosphatas 100.0
d1v7ra_186 XTP pyrophosphatase {Archaeon Pyrococcus horikoshii [Ta 100.0
d2cara1194 Inosine triphosphate pyrophosphatase, ITPase {Human (Ho 100.0
d1b78a_184 XTP pyrophosphatase {Archaeon Methanococcus jannaschii 100.0
d1ex2a_185 Maf protein {Bacillus subtilis [TaxId: 1423]} 96.1
d2amha1201 Maf homologue Tb11.01.5890 {Trypanosoma brucei [TaxId: 91.01
>d1k7ka_ c.51.4.1 (A:) Hypothetical protein YggV {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Anticodon-binding domain-like
superfamily: ITPase-like
family: ITPase (Ham1)
domain: Hypothetical protein YggV
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=425.84  Aligned_cols=195  Identities=37%  Similarity=0.559  Sum_probs=175.6

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHCCCEEEEHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECHHHHHHHHHC
Q ss_conf             67779998499227999999730079199724447885666676554567787653311345630785201243434201
Q gi|254780629|r    5 IENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVLDG   84 (224)
Q Consensus         5 ~~~kii~aT~N~~K~~E~~~iL~~~~i~~~~~~~~~~~~peE~g~tf~eNA~~KA~~~~~~~~~pvlaDDSGL~vdaL~G   84 (224)
                      .|++|+|||+|+||++|++.+|.+++++++++.++++++|+|+|.||.|||++||+++++.++.||||||||||||||+|
T Consensus        12 ~M~kI~~aT~N~~K~~E~~~iL~~~~i~v~~~~~~~i~e~eE~g~t~~enA~~KA~~~~~~~~~pvl~DDsGL~idaL~g   91 (209)
T d1k7ka_          12 HMQKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVTALPAIADDSGLAVDVLGG   91 (209)
T ss_dssp             CCEEEEESCCCHHHHHHHHHHHGGGTEEEEETTTTTCCCCCCCCSSHHHHHHHHHHHHHHHHSSCEEEEEEEEEEGGGTT
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCEEEEHHHCCCCCHHHCCHHHHHHHHHHHHHHHHCCCCCCEECCCEEEHHHHCC
T ss_conf             78789999398889999999751259779854660998633304067777778887765314687433141676433438


Q ss_pred             CCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEECCC--CCCCEEEEEEEEEEEEEECCCCCCC
Q ss_conf             44514344304578868889999998877752135677765068998620132--3421045643332499826411788
Q gi|254780629|r   85 KPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAW--PDGHVENFSGKVSGIIVWPPRGQLG  162 (224)
Q Consensus        85 ~PGvySaR~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~R~A~f~~~~~~~~--~~~~~~~f~G~~~G~I~~~prG~~G  162 (224)
                      +|||||+||++....+...   +..++..+..   .....|+|+|+|++++++  +++.+.+|+|.|+|.|+.+|||++|
T Consensus        92 ~PGvys~r~~~~~~~~~~~---~~~~l~~~~~---~~~~~r~a~f~~~~~~~~~~~~~~~~~f~G~~~G~I~~~~~G~~G  165 (209)
T d1k7ka_          92 APGIYSARYSGEDATDQKN---LQKLLETMKD---VPDDQRQARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGG  165 (209)
T ss_dssp             CBGGGSTTTTCTTCCHHHH---HHHHHHHTTT---SCGGGCEEEEEEEEEEESSTTCSSCEEEEEEEEEEECSSCCCCSS
T ss_pred             CCCCCCHHHHCCCCCHHHH---HHHHHHHHCC---CCHHHHHHHCEEEEEEECCCCCCCEEEEEEEECCEEEECCCCCCC
T ss_conf             7677544354136878899---9987766515---765566342178999843678982588998866588526788888


Q ss_pred             CCCCEEEEECCCCCCHHHCCHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             5723136656998477768987850121232223323343525899999999999987
Q gi|254780629|r  163 FGYDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLR  220 (224)
Q Consensus       163 FGyDpIF~p~g~~kT~aEm~~~eKn~~~~~~~~~~~~~~~~iSHR~~Al~kl~~~l~~  220 (224)
                      |||||||+|+|+++|||||+.+|||+               ||||++|+++|+++|+.
T Consensus       166 FGyDpIFip~g~~kTfaEm~~~eKn~---------------iSHR~~A~~kl~~~Lk~  208 (209)
T d1k7ka_         166 FGYDPIFFVPSEGKTAAELTREEKSA---------------ISHRGQALKLLLDALRN  208 (209)
T ss_dssp             STTGGGEEEGGGTEEGGGSCHHHHHH---------------HSHHHHHHHHHHHHHHC
T ss_pred             CCCCEEEEECCCCCCHHHCCHHHHHH---------------CCHHHHHHHHHHHHHHC
T ss_conf             99773588789996664499999665---------------29999999999999657



>d1vp2a_ c.51.4.1 (A:) Putative inosine/xanthosine triphosphate pyrophosphatase TM0159 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v7ra_ c.51.4.1 (A:) XTP pyrophosphatase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cara1 c.51.4.1 (A:1-194) Inosine triphosphate pyrophosphatase, ITPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b78a_ c.51.4.1 (A:) XTP pyrophosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ex2a_ c.51.4.2 (A:) Maf protein {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2amha1 c.51.4.2 (A:7-207) Maf homologue Tb11.01.5890 {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 224 putative deoxyribonucleotide triphosphate pyrophos
1k7k_A_221 (A:) Hypothetical protein YGGV; MAD, His-TAG, larg 1e-45
1v7r_A_186 (A:) Hypothetical protein PH1917; ntpase, structur 4e-44
2car_A_196 (A:) Inosine triphosphate pyrophosphatase; hydrola 2e-42
1vp2_A_208 (A:) Putative xanthosine triphosphate pyrophosphat 4e-42
1b78_A_193 (A:) Pyrophosphatase; structural genomics, hyperth 2e-41
>1k7k_A (A:) Hypothetical protein YGGV; MAD, His-TAG, large groove, disordered Se-Met, structural genomics, putative ribosomal protein, PSI; HET: MSE; 1.50A {Escherichia coli}Length = 221 Back     alignment and structure
 Score =  177 bits (449), Expect = 1e-45
 Identities = 72/217 (33%), Positives = 105/217 (48%), Gaps = 23/217 (10%)

Query: 2   RKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLT 61
            +     +V+A+ NV K+ E+ SL+   G+   +  +L +   EETG +F ENA++K+  
Sbjct: 19  FQGHXQKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARH 78

Query: 62  AAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFDMAMQKIENALRSKFAHD 121
           AAK   +PA++DDSGL +DVL G PGI+SAR++     +      +QK+    +      
Sbjct: 79  AAKVTALPAIADDSGLAVDVLGGAPGIYSARYSGE---DATDQKNLQKLLETXKDVPDDQ 135

Query: 122 PAFRSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGFGYDPIFQPNGYDRTFG 179
              R A F  VL       D       G   G+I   P G  GFGYDPIF      +T  
Sbjct: 136 ---RQARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAA 192

Query: 180 EMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVD 216
           E+T EEK+                +SHR +A K  +D
Sbjct: 193 ELTREEKS---------------AISHRGQALKLLLD 214


>1v7r_A (A:) Hypothetical protein PH1917; ntpase, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; HET: CIT; 1.40A {Pyrococcus horikoshii OT3}Length = 186 Back     alignment and structure
>2car_A (A:) Inosine triphosphate pyrophosphatase; hydrolase, inosine triphosphate pyrophosphohydrolase, inosine triphosphatase deficiency, ITP, IMP; 1.09A {Homo sapiens}Length = 196 Back     alignment and structure
>1vp2_A (A:) Putative xanthosine triphosphate pyrophosphatase/HAM1 protein homolog; TM0159; 1.78A {Thermotoga maritima}Length = 208 Back     alignment and structure
>1b78_A (A:) Pyrophosphatase; structural genomics, hyperthermal protein; 2.20A {Methanococcus jannaschii}Length = 193 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target224 putative deoxyribonucleotide triphosphate pyrophosphata
1k7k_A_221 Hypothetical protein YGGV; MAD, His-TAG, large gro 100.0
1vp2_A_208 Putative xanthosine triphosphate pyrophosphatase/H 100.0
1v7r_A_186 Hypothetical protein PH1917; ntpase, structural ge 100.0
2car_A_196 Inosine triphosphate pyrophosphatase; hydrolase, i 100.0
1b78_A_193 Pyrophosphatase; structural genomics, hyperthermal 100.0
2p5x_A_230 ASMTL, N-acetylserotonin O-methyltransferase-like 94.49
1ex2_A_189 Protein MAF; structural genomics, PSI, protein str 93.89
2amh_A_207 Septum formation protein MAF homologue, putative; 93.03
>1k7k_A (A:) Hypothetical protein YGGV; MAD, His-TAG, large groove, disordered Se-Met, structural genomics, putative ribosomal protein, PSI; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=429.61  Aligned_cols=195  Identities=37%  Similarity=0.558  Sum_probs=178.2

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHCCCEEEEHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECHHHHHHHHHCC
Q ss_conf             77799984992279999997300791997244478856666765545677876533113456307852012434342014
Q gi|254780629|r    6 ENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVLDGK   85 (224)
Q Consensus         6 ~~kii~aT~N~~K~~E~~~iL~~~~i~~~~~~~~~~~~peE~g~tf~eNA~~KA~~~~~~~~~pvlaDDSGL~vdaL~G~   85 (224)
                      .++|+|||+|+||++|++.+|.+++++++++.++++++|||||.||++||+.||++++++++.|||||||||||+||||+
T Consensus        23 ~mki~~aT~N~~K~~E~~~iL~~~~iei~~l~~~~~~~~ee~g~t~~enA~~KA~~~~~~~~~pviaDDSGL~i~aL~g~  102 (221)
T 1k7k_A           23 XQKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVTALPAIADDSGLAVDVLGGA  102 (221)
T ss_dssp             CEEEEESCCCHHHHHHHHHHHGGGTEEEEETTTTTCCCCCCCCSSHHHHHHHHHHHHHHHHSSCEEEEEEEEEEGGGTTC
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCEEEEEEECCC
T ss_conf             98899993987899999997323498798612149887776771068888995999986058875970657999440699


Q ss_pred             CCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEECCCC--CCCEEEEEEEEEEEEEECCCCCCCC
Q ss_conf             45143443045788688899999988777521356777650689986201323--4210456433324998264117885
Q gi|254780629|r   86 PGIHSARWAESNTGERDFDMAMQKIENALRSKFAHDPAFRSAHFISVLSLAWP--DGHVENFSGKVSGIIVWPPRGQLGF  163 (224)
Q Consensus        86 PGvySaR~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~R~A~f~~~~~~~~~--~~~~~~f~G~~~G~I~~~prG~~GF  163 (224)
                      |||||+||++....+.+   .+++++..+..   .+.++|+|+|+|++|+++|  ++.+.+|+|+|+|.|+.+|||++||
T Consensus       103 PGvys~r~~~~~~~~~~---~~~~Ll~~l~~---~~~~~R~A~f~~~i~~~~p~~~~~~~~f~G~~~G~I~~~prG~~gf  176 (221)
T 1k7k_A          103 PGIYSARYSGEDATDQK---NLQKLLETXKD---VPDDQRQARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGF  176 (221)
T ss_dssp             BGGGSTTTTCTTCCHHH---HHHHHHHHTTT---SCGGGCEEEEEEEEEEESSTTCSSCEEEEEEEEEEECSSCCCCSSS
T ss_pred             CCCHHHHHHCCCCCHHH---HHHHHHHHHHC---CCCCCCEEEEEEEEEEECCCCCCCEEEEEEEECCEEEEEECCCCCC
T ss_conf             70142998644686899---99999998647---8823124769999998626789806889988635796401588998


Q ss_pred             CCCEEEEECCCCCCHHHCCHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             7231366569984777689878501212322233233435258999999999999876
Q gi|254780629|r  164 GYDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRI  221 (224)
Q Consensus       164 GyDpIF~p~g~~kT~aEm~~~eKn~~~~~~~~~~~~~~~~iSHR~~Al~kl~~~l~~~  221 (224)
                      ||||||+|+|+++|||||+.+|||+               ||||++|+++|+++|.+.
T Consensus       177 GyD~IFip~g~~kT~AEl~~~eKn~---------------iSHR~~A~~~l~~~L~~~  219 (221)
T 1k7k_A          177 GYDPIFFVPSEGKTAAELTREEKSA---------------ISHRGQALKLLLDALRNG  219 (221)
T ss_dssp             TTGGGEEEGGGTEEGGGSCHHHHHH---------------HSHHHHHHHHHHHHHHCC
T ss_pred             CCCEEEEECCCCCCHHHCCHHHHHH---------------CCHHHHHHHHHHHHHHHC
T ss_conf             8573688799997553299989666---------------298999999999999855



>1vp2_A (A:) Putative xanthosine triphosphate pyrophosphatase/HAM1 protein homolog; TM0159; 1.78A {Thermotoga maritima} Back     alignment and structure
>1v7r_A (A:) Hypothetical protein PH1917; ntpase, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; HET: CIT; 1.40A {Pyrococcus horikoshii OT3} Back     alignment and structure
>2car_A (A:) Inosine triphosphate pyrophosphatase; hydrolase, inosine triphosphate pyrophosphohydrolase, inosine triphosphatase deficiency, ITP, IMP; 1.09A {Homo sapiens} Back     alignment and structure
>1b78_A (A:) Pyrophosphatase; structural genomics, hyperthermal protein; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>2p5x_A (A:) ASMTL, N-acetylserotonin O-methyltransferase-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 2.00A {Homo sapiens} Back     alignment and structure
>1ex2_A (A:) Protein MAF; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: SUC PO4; 1.85A {Bacillus subtilis} Back     alignment and structure
>2amh_A (A:) Septum formation protein MAF homologue, putative; domain alpha-beta motif, structural genomics, PSI, protein structure initiative; 2.00A {Trypanosoma brucei} Back     alignment and structure