254780633

254780633

creatinine amidohydrolase

GeneID in NCBI database:8209633Locus tag:CLIBASIA_02600
Protein GI in NCBI database:254780633Protein Accession:YP_003065046.1
Gene range:+(637325, 638128)Protein Length:267aa
Gene description:creatinine amidohydrolase
COG prediction:[R] Uncharacterized protein, putative amidase
KEGG prediction:creatinine amidohydrolase; K01470 creatinine amidohydrolase [EC:3.5.2.10]
SEED prediction:Creatinine amidohydrolase (EC 3.5.2.10)
Pathway involved in KEGG:Arginine and proline metabolism [PATH:las00330]
Subsystem involved in SEED:Creatine and Creatinine Degradation
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------
MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFDKDVQK
ccHHHHHHHcccHHHHHcccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHccEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHccccEEEccccccccHHHHHccccccccccccHHHHHHHHHHcHHHHcHHHccccccccHHHHcccccccccccccccccHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcc
ccccccHHHHcHHHHHHHccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHcccHccEEEEcccccccccccccccccEEccHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHccccEEEcccccccccHHccccHHHcccccccHHHHHHHHHHcHHHEcHHHHHHccccccccHccccccccccccccHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcHHHcc
mnpliiftdnslplcadarKDWIvvlplgayeqhgphlpmntDTIIAAGLAERIksilpprlpvtcmpvepigysIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNahggnsplvsIVSTEARMRFSMLVVSTswsrftipqgiisfpeteigihggeiETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRahgshsfgwsmkdlnpkgvvgnamdatVKKGEGLLSYFANCFIQLLndinsfdvsifdkdvqk
MNPLIIFTDNSLPLCADARKDWIVVLPLGAyeqhgphlpMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVIlnahggnsplVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFDKDVQK
MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETeigihggeieTSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFDKDVQK
**PLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSF***********
MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFDKDVQK
*NPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFDKDV**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFDKDVQK
MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFDKDVQK
MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFDKDVQK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target267 creatinine amidohydrolase [Candidatus Liberibacter asia
315121832268 creatinine amidohydrolase [Candidatus Liberibacter sola 1 1e-112
241206367262 creatininase [Rhizobium leguminosarum bv. trifolii WSM1 1 2e-84
222149787273 creatinine amidohydrolase [Agrobacterium vitis S4] Leng 1 2e-83
150397964263 creatininase [Sinorhizobium medicae WSM419] Length = 26 1 2e-82
15966622263 hypothetical protein SMc02977 [Sinorhizobium meliloti 1 1 2e-82
86359214262 creatinine amidohydrolase (creatininase) protein [Rhizo 1 3e-82
222087138263 creatinine amidohydrolase (creatininase) protein [Agrob 1 1e-81
227823444263 creatinine amidohydrolase [Sinorhizobium fredii NGR234] 1 1e-79
116253884262 hypothetical protein RL4147 [Rhizobium leguminosarum bv 1 5e-79
327189537259 putative creatininase protein [Rhizobium etli CNPAF512] 1 2e-78
>gi|315121832|ref|YP_004062321.1| creatinine amidohydrolase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 268 Back     alignment and organism information
 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/264 (74%), Positives = 223/264 (84%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           +NPL+ F DN   L     KDWIVVLPLGAYEQHGPHLPM+TDTIIA GL ER+  ILP 
Sbjct: 2   VNPLVRFADNFPSLDVGDHKDWIVVLPLGAYEQHGPHLPMDTDTIIAKGLVERVIGILPS 61

Query: 61  RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN 120
            LPVT MPVE IGYSIEHMY  GTKTL+YAEAIE WL+II+ I+K+GIRK+VILNAHGGN
Sbjct: 62  TLPVTFMPVESIGYSIEHMYAHGTKTLSYAEAIERWLSIINEIQKLGIRKVVILNAHGGN 121

Query: 121 SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL 180
           SPLVSIVSTEAR+RFS+L VSTSWSRF  P  I+   E  I IHGGEIETSMML LAPHL
Sbjct: 122 SPLVSIVSTEARVRFSVLAVSTSWSRFGFPHDIVLSSERGIDIHGGEIETSMMLVLAPHL 181

Query: 181 VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS 240
           VKMDL++NFSSRQSEFL+NF YLRA+G HSFGW+M+DLNP+GVVGNAM AT +KGE LLS
Sbjct: 182 VKMDLSKNFSSRQSEFLQNFTYLRAYGPHSFGWTMEDLNPEGVVGNAMIATFEKGESLLS 241

Query: 241 YFANCFIQLLNDINSFDVSIFDKD 264
           ++ANCF+QLL DIN FDVS+FDK+
Sbjct: 242 HYANCFVQLLEDINVFDVSLFDKN 265


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241206367|ref|YP_002977463.1| creatininase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 262 Back     alignment and organism information
>gi|222149787|ref|YP_002550744.1| creatinine amidohydrolase [Agrobacterium vitis S4] Length = 273 Back     alignment and organism information
>gi|150397964|ref|YP_001328431.1| creatininase [Sinorhizobium medicae WSM419] Length = 263 Back     alignment and organism information
>gi|15966622|ref|NP_386975.1| hypothetical protein SMc02977 [Sinorhizobium meliloti 1021] Length = 263 Back     alignment and organism information
>gi|86359214|ref|YP_471106.1| creatinine amidohydrolase (creatininase) protein [Rhizobium etli CFN 42] Length = 262 Back     alignment and organism information
>gi|222087138|ref|YP_002545673.1| creatinine amidohydrolase (creatininase) protein [Agrobacterium radiobacter K84] Length = 263 Back     alignment and organism information
>gi|227823444|ref|YP_002827417.1| creatinine amidohydrolase [Sinorhizobium fredii NGR234] Length = 263 Back     alignment and organism information
>gi|116253884|ref|YP_769722.1| hypothetical protein RL4147 [Rhizobium leguminosarum bv. viciae 3841] Length = 262 Back     alignment and organism information
>gi|327189537|gb|EGE56690.1| putative creatininase protein [Rhizobium etli CNPAF512] Length = 259 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target267 creatinine amidohydrolase [Candidatus Liberibacter asia
COG1402250 COG1402, COG1402, Uncharacterized protein, putative ami 4e-48
pfam02633235 pfam02633, Creatininase, Creatinine amidohydrolase 2e-63
>gnl|CDD|31592 COG1402, COG1402, Uncharacterized protein, putative amidase [General function prediction only] Back     alignment and domain information
>gnl|CDD|145669 pfam02633, Creatininase, Creatinine amidohydrolase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 267 creatinine amidohydrolase [Candidatus Liberibacter asia
pfam02633235 Creatininase Creatinine amidohydrolase. Creatinine amid 100.0
COG1402250 Uncharacterized protein, putative amidase [General func 100.0
pfam10673143 DUF2487 Protein of unknown function (DUF2487). This is 95.66
PRK01259309 ribose-phosphate pyrophosphokinase; Provisional 91.85
PRK02039316 consensus 91.74
PRK04923319 ribose-phosphate pyrophosphokinase; Provisional 91.63
PRK04554327 consensus 91.07
PRK00553340 ribose-phosphate pyrophosphokinase; Provisional 90.81
>pfam02633 Creatininase Creatinine amidohydrolase Back     alignment and domain information
>COG1402 Uncharacterized protein, putative amidase [General function prediction only] Back     alignment and domain information
>pfam10673 DUF2487 Protein of unknown function (DUF2487) Back     alignment and domain information
>PRK01259 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK02039 consensus Back     alignment and domain information
>PRK04923 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK04554 consensus Back     alignment and domain information
>PRK00553 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target267 creatinine amidohydrolase [Candidatus Liberibacter asia
3a6j_A260 E122q Mutant Creatininase Complexed With Creatine L 2e-42
1j2t_A260 Creatininase Mn Length = 260 3e-42
3a6e_A260 W174f Mutant Creatininase, Type I Length = 260 3e-42
3a6g_A260 W154f Mutant Creatininase Length = 260 3e-42
3a6h_A260 W154a Mutant Creatininase Length = 260 1e-41
1q3k_A259 Crystal Structure Of Creatinine Amidohydrolase (Cre 6e-41
3no4_A267 Crystal Structure Of A Creatinine Amidohydrolase (N 6e-39
3lub_A254 Crystal Structure Of Putative Creatinine Amidohydro 2e-37
>gi|288562910|pdb|3A6J|A Chain A, E122q Mutant Creatininase Complexed With Creatine Length = 260 Back     alignment and structure
 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 67/270 (24%), Positives = 106/270 (39%), Gaps = 33/270 (12%)

Query: 1   MNPLIIFTDNSLPLCAD--ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSIL 58
           M+  +   + +        A  D +++LP+GA EQHG H+ MN D ++   + +R+   +
Sbjct: 1   MSKSVFVGELTWKEYEARVAAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKRVAERI 60

Query: 59  PPRLPVTCMPVEPIGY-----SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVI 113
                   MP    GY     S    +  GT +L  A        II  + + G R++V+
Sbjct: 61  G----ALVMPGLQYGYKSQQKSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVL 116

Query: 114 LNAHGGNSPL----VSIVSTEARMRF--SMLVVSTSWSRFTIPQGIIS--FPETEIGI-- 163
           +N H  NS      + +   E R        VV  S+  F     +I   +PE  +G   
Sbjct: 117 MNGHYQNSMFIVEGIDLALRELRYAGIQDFKVVVLSYWDFVKDPAVIQQLYPEGFLGWDI 176

Query: 164 -HGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKG 222
            HGG  ETS+MLAL P LV +D   +           F    A                G
Sbjct: 177 EHGGVFETSLMLALYPDLVDLDRVVDHPPATFPPYDVFPVDPARTPAP-----------G 225

Query: 223 VVGNAMDATVKKGEGLLSYFANCFIQLLND 252
            + +A  A+ +KGE +L          + +
Sbjct: 226 TLSSAKTASREKGELILEVCVQGIADAIRE 255


gi|42542992|pdb|1J2T|A Chain A, Creatininase Mn Length = 260 Back     alignment and structure
>gi|288562886|pdb|3A6E|A Chain A, W174f Mutant Creatininase, Type I Length = 260 Back     alignment and structure
>gi|288562898|pdb|3A6G|A Chain A, W154f Mutant Creatininase Length = 260 Back     alignment and structure
>gi|288562904|pdb|3A6H|A Chain A, W154a Mutant Creatininase Length = 260 Back     alignment and structure
>gi|34810367|pdb|1Q3K|A Chain A, Crystal Structure Of Creatinine Amidohydrolase (Creatininase) Length = 259 Back     alignment and structure
>gi|304445988|pdb|3NO4|A Chain A, Crystal Structure Of A Creatinine Amidohydrolase (Npun_f1913) From Nostoc Punctiforme Pcc 73102 At 2.00 A Resolution Length = 267 Back     alignment and structure
>gi|290790290|pdb|3LUB|A Chain A, Crystal Structure Of Putative Creatinine Amidohydrolase (Yp_211512.1) From Bacteroides Fragilis Nctc 9343 At 2.11 A Resolution Length = 254 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target267 creatinine amidohydrolase [Candidatus Liberibacter asia
3lub_A254 Putative creatinine amidohydrolase; structural genomics 3e-51
3no4_A267 Creatininase, creatinine amidohydrolase; structural gen 4e-43
1v7z_A260 Creatininase, creatinine amidohydrolase; Mn-activated c 9e-42
>3lub_A Putative creatinine amidohydrolase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Bacteroides fragilis} Length = 254 Back     alignment and structure
 Score =  197 bits (501), Expect = 3e-51
 Identities = 64/262 (24%), Positives = 103/262 (39%), Gaps = 13/262 (4%)

Query: 1   MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP 60
           MN  +  + + L    + + D +++LP GA E H  HLP  TD I+   +A     +   
Sbjct: 2   MNKEVDLSVSCLGKVKELKYD-VIILPWGATEPHNLHLPYLTDCILPHDIAVEAAELALS 60

Query: 61  RLPVTCMPVEPIGY---SIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAH 117
           R  V CM + P+ +   +     +       YA        I+ ++   G RK++IL+ H
Sbjct: 61  RSGVRCMVMPPVPFGAHNPGQRELPFCIHTRYATQQAILEDIVSSLHVQGFRKLLILSGH 120

Query: 118 GGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALA 177
           GGN+    ++   A      L+ + +W     P+G     E EI  H GE ETS+M+   
Sbjct: 121 GGNNFKG-MIRDLAFEYPDFLIAAANWFEVVSPKGYF---EAEIDDHAGESETSVMMHYH 176

Query: 178 PHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEG 237
           P LV +  A +  S+                               VGN   AT +KGE 
Sbjct: 177 PELVNLAEAGDGESKPFAI-----ASLNEKVAWVPRHWDKATVDSGVGNPKKATAEKGER 231

Query: 238 LLSYFANCFIQLLNDINSFDVS 259
            +         L  ++   D+ 
Sbjct: 232 YVKPIVEKLAGLFEEMAQHDLY 253


>3no4_A Creatininase, creatinine amidohydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.00A {Nostoc punctiforme pcc 73102} Length = 267 Back     alignment and structure
>1v7z_A Creatininase, creatinine amidohydrolase; Mn-activated creatininase, substrate complex; 1.60A {Pseudomonas SP} SCOP: c.125.1.1 PDB: 1j2u_A 1j2t_A 1q3k_A Length = 260 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target267 creatinine amidohydrolase [Candidatus Liberibacter asia
1v7z_A260 Creatininase, creatinine amidohydrolase; Mn-activated c 100.0
3no4_A267 Creatininase, creatinine amidohydrolase; structural gen 100.0
3lub_A254 Putative creatinine amidohydrolase; structural genomics 100.0
>1v7z_A Creatininase, creatinine amidohydrolase; Mn-activated creatininase, substrate complex; 1.60A {Pseudomonas SP} SCOP: c.125.1.1 PDB: 1j2u_A 1j2t_A 3a6d_A 3a6j_A 3a6k_A 3a6l_A 3a6g_A 3a6f_A 3a6e_A 3a6h_A 1q3k_A Back     alignment and structure
Probab=100.00  E-value=0  Score=458.87  Aligned_cols=241  Identities=25%  Similarity=0.330  Sum_probs=201.8

Q ss_pred             CCCCCCHHHCCHHHHHH-CC-CCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHH
Q ss_conf             98664046669798973-10-49889993200124797465226789999999999983566773999140232678011
Q gi|254780633|r    1 MNPLIIFTDNSLPLCAD-AR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH   78 (267)
Q Consensus         1 m~~~~~~~~lT~~e~~~-~~-~~~vvilPvGs~EqHGpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h   78 (267)
                      |..+++|++|||+|+++ ++ +++++|||+||+||||||||+|||+++++++|+++|+++    +++|+|++|||+|++|
T Consensus         1 m~~~~~l~~lTw~E~~~~l~~~~~v~ilPvGs~EqHGpHLPlgtD~~ia~~ia~~~a~~~----~~~v~P~i~~G~s~~h   76 (260)
T 1v7z_A            1 MSKSVFVGELTWKEYEARVAAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKRVAERI----GALVMPGLQYGYKSQQ   76 (260)
T ss_dssp             --CCCBGGGSCHHHHHHHHHTSCCCEEEEECCBCCCCSSBCTTHHHHHHHHHHHHHHHHH----TCEECCCBCCCBCCCH
T ss_pred             CCCCEEHHHCCHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHC----CCCCCCCCCCCCCCCC
T ss_conf             985576785798999999827997899825566056886414689999999999999876----9947787665776333


Q ss_pred             CC-----CCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHH----HHHHHHHHHHH--CCEEEEEECCCCC
Q ss_conf             36-----8873330999999999999999997499889997398786789----99999998635--5839998247654
Q gi|254780633|r   79 MY-----VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL----VSIVSTEARMR--FSMLVVSTSWSRF  147 (267)
Q Consensus        79 ~~-----fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~----l~~a~~~l~~~--~~~~~~~~~~~~~  147 (267)
                      +.     ||||||++++||.++|.||++||++|||||||||||||||..+    ++.++++++.+  .+..++..+||.+
T Consensus        77 ~~~~~~~fPGTisl~~~t~~~~l~di~~sl~~~Gfr~ivivNgHgGN~~~~~~a~~~~~~el~~~~~~~~~~~~~~~~~~  156 (260)
T 1v7z_A           77 KSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVLMNGHYENSMFIVEGIDLALRELRYAGIQDFKVVVLSYWDF  156 (260)
T ss_dssp             HHHSCTTSSSCBCBCHHHHHHHHHHHHHHHHHHTCCEEEEEECSGGGHHHHHHHHHHHHHHHHHTTCCCCEEEEEEGGGG
T ss_pred             CCCCCCCCCCEEEECHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCC
T ss_conf             57766777725997878899999999999998089659997168764078999999999998753377616999972011


Q ss_pred             CCHHHH----CC-CCCCCCCCCCCHHHHHHHHHHCCCCCCHHHCCCCCCCCCCHHCCCCCCCCCCCCCCCCCHHHCCCCC
Q ss_conf             565641----36-6556678868779999999978132683324667644320001340001377633202288809881
Q gi|254780633|r  148 TIPQGI----IS-FPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKG  222 (267)
Q Consensus       148 ~~~~~~----~~-~~~~~~g~HAge~ETS~~lal~PelV~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~G  222 (267)
                      ......    .. ......++|||+.|||+|||++||+||+|++.+..+.....           .....|...+++++|
T Consensus       157 ~~~~~~~~~~~~~~~~~~~~~HAg~~ETS~~l~l~PelV~~~~~~~~~~~~~~~-----------~~~~~~~~~~~~~~G  225 (260)
T 1v7z_A          157 VKDPAVIQQLYPEGFLGWDIEHGGVFETSLMLALYPDLVDLDRVVDHPPATFPP-----------YDVFPVDPARTPAPG  225 (260)
T ss_dssp             CCCHHHHHHHCTTCCCCSTTCSSSHHHHHHHHHHCGGGBCGGGCCCCCCCCCCS-----------SEEESCCGGGSCTTS
T ss_pred             CCCHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCHHHCCHHHHCCCCCCCCCC-----------CCCCCCCHHHCCCCC
T ss_conf             456066666432333567887777899999999694421876612047767884-----------334357774439998


Q ss_pred             CEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             041443079999999999999999999999995853
Q gi|254780633|r  223 VVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDV  258 (267)
Q Consensus       223 v~GdP~~At~E~G~~~~~~~v~~l~~~i~e~~~~~~  258 (267)
                      ++|||+.||+|+|+++++.++++++++|++  +||-
T Consensus       226 v~Gdp~~As~E~G~~~~~~~v~~l~~~i~e--~~pp  259 (260)
T 1v7z_A          226 TLSSAKTASREKGELILEVCVQGIADAIRE--EFPP  259 (260)
T ss_dssp             CSSCCTTCCHHHHHHHHHHHHHHHHHHHHH--HSCC
T ss_pred             EECCCCHHHHHHHHHHHHHHHHHHHHHHHH--HCCC
T ss_conf             332825314999999999999999999980--5779



>3no4_A Creatininase, creatinine amidohydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.00A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>3lub_A Putative creatinine amidohydrolase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Bacteroides fragilis} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 267 creatinine amidohydrolase [Candidatus Liberibacter asia
d1v7za_257 c.125.1.1 (A:) Creatininase {Pseudomonas putida [TaxId: 4e-42
>d1v7za_ c.125.1.1 (A:) Creatininase {Pseudomonas putida [TaxId: 303]} Length = 257 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Creatininase
superfamily: Creatininase
family: Creatininase
domain: Creatininase
species: Pseudomonas putida [TaxId: 303]
 Score =  165 bits (418), Expect = 4e-42
 Identities = 61/251 (24%), Positives = 94/251 (37%), Gaps = 31/251 (12%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A  D +++LP+GA EQHG H+ MN D ++   + +R    +  R+    MP    GY  +
Sbjct: 18  AAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKR----VAERIGALVMPGLQYGYKSQ 73

Query: 78  HM-----YVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
                  +  GT +L  A        II  + + G R++V++N H  NS  +      A 
Sbjct: 74  QKSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVLMNGHYENSMFIVEGIDLAL 133

Query: 133 MRFS-------MLVVSTSWSRFTIPQGIISFPETEI----GIHGGEIETSMMLALAPHLV 181
                       +VV + W     P  I              HGG  ETS+MLAL P LV
Sbjct: 134 RELRYAGIQDFKVVVLSYWDFVKDPAVIQQLYPEGFLGWDIEHGGVFETSLMLALYPDLV 193

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
            +D   +                      F          G + +A  A+ +KGE +L  
Sbjct: 194 DLDRVVDHPPA-----------TFPPYDVFPVDPARTPAPGTLSSAKTASREKGELILEV 242

Query: 242 FANCFIQLLND 252
                   + +
Sbjct: 243 CVQGIADAIRE 253


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target267 creatinine amidohydrolase [Candidatus Liberibacter asia
d1v7za_257 Creatininase {Pseudomonas putida [TaxId: 303]} 100.0
>d1v7za_ c.125.1.1 (A:) Creatininase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Creatininase
superfamily: Creatininase
family: Creatininase
domain: Creatininase
species: Pseudomonas putida [TaxId: 303]
Probab=100.00  E-value=0  Score=449.79  Aligned_cols=238  Identities=25%  Similarity=0.328  Sum_probs=197.7

Q ss_pred             CCCCHHHCCHHHHHH-CC-CCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCC
Q ss_conf             664046669798973-10-4988999320012479746522678999999999998356677399914023267801136
Q gi|254780633|r    3 PLIIFTDNSLPLCAD-AR-KDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMY   80 (267)
Q Consensus         3 ~~~~~~~lT~~e~~~-~~-~~~vvilPvGs~EqHGpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h~~   80 (267)
                      .+++|++|||+|+++ ++ +++|+|||+||+||||||||+|||+++++++|+++|+++    +++|+|++|||+|++|+.
T Consensus         1 ~~~~l~~lT~~Ev~~~l~~~~~v~ilPvGs~EqHGpHLPlgtD~~ia~~ia~~~a~~~----~~~v~P~i~~G~s~~h~~   76 (257)
T d1v7za_           1 KSVFVGELTWKEYEARVAAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKRVAERI----GALVMPGLQYGYKSQQKS   76 (257)
T ss_dssp             CCCBGGGSCHHHHHHHHHTSCCCEEEEECCBCCCCSSBCTTHHHHHHHHHHHHHHHHH----TCEECCCBCCCBCCCHHH
T ss_pred             CCEEHHHCCHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHC----CCEECCCCCCCCCCCCCC
T ss_conf             9573774798999999836997899956563046987522589999999999999877----992836515576633457


Q ss_pred             -----CCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHH----HHHHHHHHHHHC--CEEEEEECCCCCCC
Q ss_conf             -----8873330999999999999999997499889997398786789----999999986355--83999824765456
Q gi|254780633|r   81 -----VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPL----VSIVSTEARMRF--SMLVVSTSWSRFTI  149 (267)
Q Consensus        81 -----fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~----l~~a~~~l~~~~--~~~~~~~~~~~~~~  149 (267)
                           ||||||++++||.++|+||++||++|||||||||||||||..+    ++.++++++.+.  +..+...+||....
T Consensus        77 ~~~~~fPGTisl~~~t~~~~l~di~~sl~~~Gfr~ivivNgHgGN~~~~~~~~~~~~~el~~~~~~~~~~~~~~~~~~~~  156 (257)
T d1v7za_          77 GGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVLMNGHYENSMFIVEGIDLALRELRYAGIQDFKVVVLSYWDFVK  156 (257)
T ss_dssp             HSCTTSSSCBCBCHHHHHHHHHHHHHHHHHHTCCEEEEEECSGGGHHHHHHHHHHHHHHHHHTTCCCCEEEEEEGGGGCC
T ss_pred             CCCCCCCCEEEECHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCC
T ss_conf             65567785476077889999999999999708856999940677737899999999999765237740799997022245


Q ss_pred             HHHH----C-CCCCCCCCCCCCHHHHHHHHHHCCCCCCHHHCCCCCCCCCCHHCCCCCCCCCCCCCCCCCHHHCCCCCCE
Q ss_conf             5641----3-6655667886877999999997813268332466764432000134000137763320228880988104
Q gi|254780633|r  150 PQGI----I-SFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVV  224 (267)
Q Consensus       150 ~~~~----~-~~~~~~~g~HAge~ETS~~lal~PelV~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~Gv~  224 (267)
                      ....    . .......++|||+.|||+|||++||+|+++++.+..+......           ..+.|...+.+++|++
T Consensus       157 ~~~~~~~~~~~~~~~~~~~HAge~ETS~~l~l~PelV~~~~~~~~~~~~~~~~-----------~~~~~~~~~~~~~G~~  225 (257)
T d1v7za_         157 DPAVIQQLYPEGFLGWDIEHGGVFETSLMLALYPDLVDLDRVVDHPPATFPPY-----------DVFPVDPARTPAPGTL  225 (257)
T ss_dssp             CHHHHHHHCTTCCCCSTTCSSSHHHHHHHHHHCGGGBCGGGCCCCCCCCCCSS-----------EEESCCGGGSCTTSCS
T ss_pred             CHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCHHHCCHHHHCCCCCCCCCCC-----------CCCCCCHHHCCCCCEE
T ss_conf             61666664124545667877668899999986966447133100377777722-----------2335657442989757


Q ss_pred             ECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             144307999999999999999999999999585
Q gi|254780633|r  225 GNAMDATVKKGEGLLSYFANCFIQLLNDINSFD  257 (267)
Q Consensus       225 GdP~~At~E~G~~~~~~~v~~l~~~i~e~~~~~  257 (267)
                      |||+.||+|+|+++++.+++.++++|+|  +|+
T Consensus       226 Gdp~~At~E~G~~lle~~~~~l~~~i~e--~~p  256 (257)
T d1v7za_         226 SSAKTASREKGELILEVCVQGIADAIRE--EFP  256 (257)
T ss_dssp             SCCTTCCHHHHHHHHHHHHHHHHHHHHH--HSC
T ss_pred             ECCCCCCHHHHHHHHHHHHHHHHHHHHH--HCC
T ss_conf             1734027999999999999999999974--578



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 267 creatinine amidohydrolase [Candidatus Liberibacter
1v7z_A_260 (A:) Creatininase, creatinine amidohydrolase; Mn-a 2e-53
>1v7z_A (A:) Creatininase, creatinine amidohydrolase; Mn-activated creatininase, substrate complex; 1.60A {Pseudomonas SP}Length = 260 Back     alignment and structure
 Score =  203 bits (517), Expect = 2e-53
 Identities = 61/251 (24%), Positives = 93/251 (37%), Gaps = 31/251 (12%)

Query: 18  ARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIE 77
           A  D +++LP+GA EQHG H+ MN D ++   + +R+      R+    MP    GY  +
Sbjct: 20  AAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKRV----AERIGALVMPGLQYGYKSQ 75

Query: 78  HMYV-----DGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEAR 132
                     GT +L  A        II  + + G R++V++N H  NS  +      A 
Sbjct: 76  QKSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVLMNGHYENSMFIVEGIDLAL 135

Query: 133 MRFS-------MLVVSTSWSRFTIPQGIISFPETEI----GIHGGEIETSMMLALAPHLV 181
                       +VV + W     P  I              HGG  ETS+MLAL P LV
Sbjct: 136 RELRYAGIQDFKVVVLSYWDFVKDPAVIQQLYPEGFLGWDIEHGGVFETSLMLALYPDLV 195

Query: 182 KMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLSY 241
            +D   +                      F          G + +A  A+ +KGE +L  
Sbjct: 196 DLDRVVDHPPATFPP-----------YDVFPVDPARTPAPGTLSSAKTASREKGELILEV 244

Query: 242 FANCFIQLLND 252
                   + +
Sbjct: 245 CVQGIADAIRE 255


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target267 creatinine amidohydrolase [Candidatus Liberibacter asia
1v7z_A_260 Creatininase, creatinine amidohydrolase; Mn-activa 100.0
3dah_A_1-152_296-319176 Ribose-phosphate pyrophosphokinase; seattle struct 90.19
>1v7z_A (A:) Creatininase, creatinine amidohydrolase; Mn-activated creatininase, substrate complex; 1.60A {Pseudomonas SP} Back     alignment and structure
Probab=100.00  E-value=0  Score=459.02  Aligned_cols=237  Identities=25%  Similarity=0.305  Sum_probs=204.4

Q ss_pred             CCCCCCHHHCCHHHHHH-CCC-CCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHH
Q ss_conf             98664046669798973-104-9889993200124797465226789999999999983566773999140232678011
Q gi|254780633|r    1 MNPLIIFTDNSLPLCAD-ARK-DWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPPRLPVTCMPVEPIGYSIEH   78 (267)
Q Consensus         1 m~~~~~~~~lT~~e~~~-~~~-~~vvilPvGs~EqHGpHlPlgtD~~~a~~ia~~~a~~~~~~~~~~v~P~i~yG~s~~h   78 (267)
                      |+.+++|++|||+|+++ .++ ++++|||+|||||||||||+|||+++++++|+++|+++    +++|+|++|||+|++|
T Consensus         1 M~~~~~l~~lt~~E~~~~l~~~~~v~ilPvGs~EqHGpHLPlgtD~~~a~~ia~~ia~~~----~~lv~P~i~yG~s~~h   76 (260)
T 1v7z_A            1 MSKSVFVGELTWKEYEARVAAGDCVLMLPVGALEQHGHHMCMNVDVLLPTAVCKRVAERI----GALVMPGLQYGYKSQQ   76 (260)
T ss_dssp             --CCCBGGGSCHHHHHHHHHTSCCCEEEEECCBCCCCSSBCTTHHHHHHHHHHHHHHHHH----TCEECCCBCCCBCCCH
T ss_pred             CCCCEEHHHCCHHHHHHHHHCCCCEEEEEEECEECCCCCCCHHHHHHHHHHHHHHHHHHC----CCCCCCCCCCCCCCCC
T ss_conf             985566785798999999827997899825574046887514589999999999999877----9917465255767434


Q ss_pred             CC-----CCCCEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHH------CCEEEEEECCCCC
Q ss_conf             36-----887333099999999999999999749988999739878678999999998635------5839998247654
Q gi|254780633|r   79 MY-----VDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGNSPLVSIVSTEARMR------FSMLVVSTSWSRF  147 (267)
Q Consensus        79 ~~-----fpGTisl~~~t~~~~l~di~~sl~~~Gf~~iviiNgHgGN~~~l~~a~~~l~~~------~~~~~~~~~~~~~  147 (267)
                      +.     |||||+++++||.++|.||++||+++||||||||||||||.+++..+++++.++      .+..++..+||..
T Consensus        77 ~~~~~~~fPGTisl~~~t~~~~l~di~~sl~~~Gf~~ivivNgHgGN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  156 (260)
T 1v7z_A           77 KSGGGNHFPGTTSLDGATLTGTVQDIIRELARHGARRLVLMNGHYENSMFIVEGIDLALRELRYAGIQDFKVVVLSYWDF  156 (260)
T ss_dssp             HHHSCTTSSSCBCBCHHHHHHHHHHHHHHHHHHTCCEEEEEECSGGGHHHHHHHHHHHHHHHHHTTCCCCEEEEEEGGGG
T ss_pred             CCCCCCCCCCEEECCHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCC
T ss_conf             57655677864760738899999999999998088659998227776378999999999998653377516999861112


Q ss_pred             CCHHH-H---C-CCCCCCCCCCCCHHHHHHHHHHCCCCCCHHHCCCCCCCCCCHHCCCCCCCCCCCCCCCCCHHHCCCCC
Q ss_conf             56564-1---3-66556678868779999999978132683324667644320001340001377633202288809881
Q gi|254780633|r  148 TIPQG-I---I-SFPETEIGIHGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKG  222 (267)
Q Consensus       148 ~~~~~-~---~-~~~~~~~g~HAge~ETS~~lal~PelV~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~G  222 (267)
                      ..... .   . .......++|||+.|||+|||++|++|+++++.+..+......           ...+|..++++++|
T Consensus       157 ~~~~~~~~~~~~~~~~~~~~~HAg~~ETS~~l~l~PelV~~~~~~~~~~~~~~~~-----------~~~~~~~~~~~~~G  225 (260)
T 1v7z_A          157 VKDPAVIQQLYPEGFLGWDIEHGGVFETSLMLALYPDLVDLDRVVDHPPATFPPY-----------DVFPVDPARTPAPG  225 (260)
T ss_dssp             CCCHHHHHHHCTTCCCCSTTCSSSHHHHHHHHHHCGGGBCGGGCCCCCCCCCCSS-----------EEESCCGGGSCTTS
T ss_pred             CCCHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCHHHCCHHHHCCCCCCCCCCC-----------CCCCCCHHHCCCCC
T ss_conf             3561667664224545668877778999999986967427233111587668832-----------23346675419998


Q ss_pred             CEECCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             041443079999999999999999999999
Q gi|254780633|r  223 VVGNAMDATVKKGEGLLSYFANCFIQLLND  252 (267)
Q Consensus       223 v~GdP~~At~E~G~~~~~~~v~~l~~~i~e  252 (267)
                      ++|||+.||+|+|+++++.++++++++|++
T Consensus       226 v~Gdp~~As~e~G~~~~~~~~~~l~~~i~~  255 (260)
T 1v7z_A          226 TLSSAKTASREKGELILEVCVQGIADAIRE  255 (260)
T ss_dssp             CSSCCTTCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEECCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             671715323999999999999999999983



>3dah_A (A:1-152,A:296-319) Ribose-phosphate pyrophosphokinase; seattle structural genomics center for infectious disease, ssgcid, cytoplasm, magnesium; HET: AMP; 2.30A {Burkholderia pseudomallei 1710B} Back     alignment and structure