254780634

254780634

NOL1/NOP2/SUN family signature protein

GeneID in NCBI database:8209634Locus tag:CLIBASIA_02605
Protein GI in NCBI database:254780634Protein Accession:YP_003065047.1
Gene range:-(635846, 637135)Protein Length:429aa
Gene description:NOL1/NOP2/SUN family signature protein
COG prediction:[J] tRNA and rRNA cytosine-C5-methylases
KEGG prediction:NOL1/NOP2/SUN family signature protein
SEED prediction:Sun protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43
MRLGGQIAAAIEILKDIRTHKKPITNSLKDWGMSHRFAGSSDRASISNIVHDVLRKYLSSAYIMDSDDPESLVYAVIMKDWDIPWEKMLSMLKEDLFSPPLPKESVIKSFHSRQLENAPLHIQGNIPQWLQSSFQSYFKDTWLKEAKSLSMRAPLDLRTNTLKVNRCKLFKNLCHYGVHHSSISRFGLRIPATKGKSRLPNVMNDITFQRGWFEIQDEGSQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKGQIHAWDNNKSRMAPIVARIKRAGIHNVQLHSSWESLRNLQEHFTTVLVDAPCSGTGTWRRRPDIKWRLSQKNLIERTEEQKKILEESAQFVRPEGYLVYITCSILPEENIQQINYFLSKNPHFSIDSIIDDWNQLYDLKNHPSLFIENGCCVLTPFLTNTDGFFFCRLKRHT
cccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHccccccccHHHHHHHHHHccccccccHHHccccHHHHHHHHHHccHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHcccccccccccccEEcccccccccccccccHHHHccEEEEEcHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccEEEEcccccccccccccccEEEEcccccccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHccHHHHHHHHHHccccEEEcccccccccccccccccccccccEEEEcccccccccEEEEEEEEcc
cccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHcHcccccccccccHHHHHHHHHHHccHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHcccccccccccHcEccccccccccccccccHHHHcccEEEEcHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccEEEEEccccccHHHcccccEEEEEccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccHHHHHHHHHHHHHccccEEccccHHHHHHccccHccccccccccEEEcccccccccEEEEEEEEcc
MRLGGQIAAAIEILKDIRthkkpitnslkdwgmshrfagssdrasiSNIVHDVLRKYLSSayimdsddpeSLVYAVIMKDWDIPWEKMLSMLKedlfspplpkesvIKSFHsrqlenaplhiqgniPQWLQSSFQSYFKDTWLKEAkslsmrapldlrtntlkvNRCKLFKnlchygvhhssisrfglripatkgksrlpnvmnditfqrgwfeiqdeGSQIVSNLTAITNSSQIldfcaggggKTLALSMLLNNkgqihawdnnksRMAPIVARIKRAGIHNVQLHSSWESLRNLQEHFTTVlvdapcsgtgtwrrrpdikwRLSQKNLIERTEEQKKILEESaqfvrpegylVYITcsilpeenIQQINYFlsknphfsidSIIDDWNqlydlknhpslfiengccvltpfltntdgfffcrlkrht
MRLGGQIAAAIEILkdirthkkpitnslkdwgmSHRFagssdrasisNIVHDVLRKYLSSAYIMDSDDPESLVYAVIMKDWDIPWEKMLSMLKEDLFSPPLPKESVIKSFHSRQLENAPLHIQGNIPQWLQSSFQSYFKDTWLKEAKslsmrapldlrtntLKVNRCKLFKNLCHYGVhhssisrfglripatkgksrlpnvmNDITFQRGWFEIQDEGSQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKGQIHAWDNNKSRMAPIVARIKRAGIHNVQLHSSWESLRNLQEHFTTVlvdapcsgtgtwrrrpdikwrlSQKNLIERTEEQKKIleesaqfvrpeGYLVYITCSILPEENIQQINYFLSKNPHFSIDSIIDDWNQLYDLKNHPSLFIENGCCVLTPFLTNTDGFFFCRLKRHT
MRLGGQIAAAIEILKDIRTHKKPITNSLKDWGMSHRFAGSSDRASISNIVHDVLRKYLSSAYIMDSDDPESLVYAVIMKDWDIPWEKMLSMLKEDLFSPPLPKESVIKSFHSRQLENAPLHIQGNIPQWLQSSFQSYFKDTWLKEAKSLSMRAPLDLRTNTLKVNRCKLFKNLCHYGVHHSSISRFGLRIPATKGKSRLPNVMNDITFQRGWFEIQDEGSQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKGQIHAWDNNKSRMAPIVARIKRAGIHNVQLHSSWESLRNLQEHFTTVLVDAPCSGTGTWRRRPDIKWRLSQKNLIERTEEQKKILEESAQFVRPEGYLVYITCSILPEENIQQINYFLSKNPHFSIDSIIDDWNQLYDLKNHPSLFIENGCCVLTPFLTNTDGFFFCRLKRHT
*RLGGQIAAAIEILKDIRTHKKPITNSLKDWGMS*****SSDRASISNIVHDVLRKYLSSAYIMDSDDPESLVYAVIMKDWDIPWEKMLSMLKEDLFSPPLP**************NAPLHIQGNIPQWLQSSFQSYFKDTWLKEAKSLSMRAPLDLRTNTLKVNRCKLFKNLCHYGVHHSSISRFGLRIPATKGKSRLPNVMNDITFQRGWFEIQDEGSQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKGQIHAWDNNKSRMAPIVARIKRAGIHNVQLHSSWESLRNLQEHFTTVLVDAPCSGTGTWRRRPDIKWRLSQKNLIERTEEQKKILEESAQFVRPEGYLVYITCSILPEENIQQINYFLSKNPHFSIDSIIDDWNQLYDLKNHPSLFIENGCCVLTPFLTNTDGFFFCRLKRHT
MRLGGQIAAAIEILKDIRTHKKPITNSLKDWGMSHRFAGSSDRASISNIVHDVLRKYLSSAYIMDSDDPESLVYAVIMKDWDIPWEKMLSMLKEDLFSPPLPKESVIKSFHSRQLENAPLHIQGNIPQWLQSSFQSYFKDTWLKEAKSLSMRAPLDLRTNTLKVNRCKLFKNLCHYGVHHSSISRFGLRIPATKGKSRLPNVMNDITFQRGWFEIQDEGSQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKGQIHAWDNNKSRMAPIVARIKRAGIHNVQLHSSWESLRNLQEHFTTVLVDAPCSGTGTWRRRPDIKWRLSQKNLIERTEEQKKILEESAQFVRPEGYLVYITCSILPEENIQQINYFLSKNPHFSIDSIIDDWNQLYDLKNHPSLFIENGCCVLTPFLTNTDGFFFCRLKRHT
*RLGGQIAAAIEILKDIRTHKKPITNSLKDWGMSHRFAGSSDRASISNIVHDVLRKYLSSAYIMDSDDPESLVYAVIMKDWDIPWEKMLSMLKEDLFSPPLPKESVIKSFHSRQLENAPLHIQGNIPQWLQSSFQSYFKDTWLKEAKSLSMRAPLDLRTNTLKVNRCKLFKNLCHYGVHHSSISRFGLRIPATKGKSRLPNVMNDITFQRGWFEIQDEGSQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKGQIHAWDNNKSRMAPIVARIKRAGIHNVQLHSSWESLRNLQEHFTTVLVDAPCSGTGTWRRRPDIKWRLSQKNLIERTEEQKKILEESAQFVRPEGYLVYITCSILPEENIQQINYFLSKNPHFSIDSIIDDWNQLYDLKNHPSLFIENGCCVLTPFLTNTDGFFFCRLKRHT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLGGQIAAAIEILKDIRTHKKPITNSLKDWGMSHRFAGSSDRASISNIVHDVLRKYLSSAYIMDSDDPESLVYAVIMKDWDIPWEKMLSMLKEDLFSPPLPKESVIKSFHSRQLENAPLHIQGNIPQWLQSSFQSYFKDTWLKEAKSLSMRAPLDLRTNTLKVNRCKLFKNLCHYGVHHSSISRFGLRIPATKGKSRLPNVMNDITFQRGWFEIQDEGSQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKGQIHAWDNNKSRMAPIVARIKRAGIHNVQLHSSWESLRNLQEHFTTVLVDAPCSGTGTWRRRPDIKWxxxxxxxxxxxxxxxxxxxxxAQFVRPEGYLVYITCSILPEENIQQINYFLSKNPHFSIDSIIDDWNQLYDLKNHPSLFIENGCCVLTPFLTNTDGFFFCRLKRHT
MRLGGQIAAAIEILKDIRTHKKPITNSLKDWGMSHRFAGSSDRASISNIVHDVLRKYLSSAYIMDSDDPESLVYAVIMKDWDIPWEKMLSMLKEDLFSPPLPKESVIKSFHSRQLENAPLHIQGNIPQWLQSSFQSYFKDTWLKEAKSLSMRAPLDLRTNTLKVNRCKLFKNLCHYGVHHSSISRFGLRIPATKGKSRLPNVMNDITFQRGWFEIQDEGSQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKGQIHAWDNNKSRMAPIVARIKRAGIHNVQLHSSWESLRNLQEHFTTVLVDAPCSGTGTWRRRPDIKWRLSQKNLIERTEEQKKILEESAQFVRPEGYLVYITCSILPEENIQQINYFLSKNPHFSIDSIIDDWNQLYDLKNHPSLFIENGCCVLTPFLTNTDGFFFCRLKRHT
MRLGGQIAAAIEILKDIRTHKKPITNSLKDWGMSHRFAGSSDRASISNIVHDVLRKYLSSAYIMDSDDPESLVYAVIMKDWDIPWEKMLSMLKEDLFSPPLPKESVIKSFHSRQLENAPLHIQGNIPQWLQSSFQSYFKDTWLKEAKSLSMRAPLDLRTNTLKVNRCKLFKNLCHYGVHHSSISRFGLRIPATKGKSRLPNVMNDITFQRGWFEIQDEGSQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKGQIHAWDNNKSRMAPIVARIKRAGIHNVQLHSSWESLRNLQEHFTTVLVDAPCSGTGTWRRRPDIKWRLSQKNLIERTEEQKKILEESAQFVRPEGYLVYITCSILPEENIQQINYFLSKNPHFSIDSIIDDWNQLYDLKNHPSLFIENGCCVLTPFLTNTDGFFFCRLKRHT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target429 NOL1/NOP2/SUN family signature protein [Candidatus Libe
254780666445 Fmu (Sun) domain protein [Candidatus Liberibacter 6e-20
>gi|254780666|ref|YP_003065079.1| Fmu (Sun) domain protein [Candidatus Liberibacter asiaticus str. psy62] Length = 445 Back     alignment
 Score = 90.1 bits (222), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 89/178 (50%), Gaps = 17/178 (9%)

Query: 208 FQRGWFEIQDEGSQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKGQIHAWDNNKS 267
           F  G + +QD  + I   L    N+  +LD CA  GGKT   + L+ +  ++ A D +K 
Sbjct: 218 FAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT---AQLIVSGAKVTALDVSKR 274

Query: 268 RMAPIVARIKRAGIHNVQLHSSWESLRNL-------QEHFTTVLVDAPCSGTGTWRRRPD 320
           R+  +   + R       LH   E +  +       ++ F  VLVDAPCS TGT RR PD
Sbjct: 275 RLEKLRCNLDR-------LHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPD 327

Query: 321 IKWRLSQKNLIERTEEQKKILEESAQFVRPEGYLVYITCSILPEENIQQINYFLSKNP 378
           + W     ++++    Q+K+L +   FV+P G +V+  CS+  +++ + +   L  +P
Sbjct: 328 VLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target429 NOL1/NOP2/SUN family signature protein [Candidatus Libe
315121833429 NOL1/NOP2/SUN family signature protein [Candidatus Libe 1 0.0
15964076429 NOL1/NOP2/SUN family signature protein [Sinorhizobium m 1 1e-141
227824162429 Fmu (Sun) domain protein [Sinorhizobium fredii NGR234] 1 1e-138
222084588429 tRNA and rRNA cytosine-C5-methylase (RNA methyltransfer 1 1e-137
150398714429 Fmu (Sun) domain-containing protein [Sinorhizobium medi 1 1e-137
325291723429 Sun protein [Agrobacterium sp. H13-3] Length = 429 1 1e-136
15887638429 Sun protein [Agrobacterium tumefaciens str. C58] Length 1 1e-136
222147270428 Sun protein [Agrobacterium vitis S4] Length = 428 1 1e-134
327192007429 tRNA and rRNA cytosine-C5-methylase (RNA methyltransfer 1 1e-129
190889972429 tRNA and rRNA cytosine-C5-methylase (RNA methyltransfer 1 1e-128
>gi|315121833|ref|YP_004062322.1| NOL1/NOP2/SUN family signature protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 429 Back     alignment and organism information
 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/428 (82%), Positives = 388/428 (90%)

Query: 1   MRLGGQIAAAIEILKDIRTHKKPITNSLKDWGMSHRFAGSSDRASISNIVHDVLRKYLSS 60
           MRLGGQ+AAAIEILKDI  +KKP TN+LKDWG SHRFAGSSDR SISNIV+DVLRKYLS+
Sbjct: 1   MRLGGQMAAAIEILKDIIFYKKPATNALKDWGASHRFAGSSDRVSISNIVYDVLRKYLSN 60

Query: 61  AYIMDSDDPESLVYAVIMKDWDIPWEKMLSMLKEDLFSPPLPKESVIKSFHSRQLENAPL 120
           AYIMD D+P+ LVYAVI+K+W+I  E + ++L+ED F+P  PKES+IKS HSRQLENAPL
Sbjct: 61  AYIMDDDNPDYLVYAVIIKEWNISLEDISTILREDRFAPLFPKESIIKSLHSRQLENAPL 120

Query: 121 HIQGNIPQWLQSSFQSYFKDTWLKEAKSLSMRAPLDLRTNTLKVNRCKLFKNLCHYGVHH 180
           HIQGNIPQWLQSS QSYFKD WL+E KSLS R PLDLRTNTLKVNR KLFKNL H+GV +
Sbjct: 121 HIQGNIPQWLQSSIQSYFKDNWLEETKSLSTRPPLDLRTNTLKVNRQKLFKNLQHHGVRY 180

Query: 181 SSISRFGLRIPATKGKSRLPNVMNDITFQRGWFEIQDEGSQIVSNLTAITNSSQILDFCA 240
           SSISRFGLRI ATK +SRLPNV N+I+FQRGWFE+QDEGSQIVS+LTA   SSQILDFCA
Sbjct: 181 SSISRFGLRIAATKAQSRLPNVTNEISFQRGWFEVQDEGSQIVSDLTATKQSSQILDFCA 240

Query: 241 GGGGKTLALSMLLNNKGQIHAWDNNKSRMAPIVARIKRAGIHNVQLHSSWESLRNLQEHF 300
           GGGGKTLALSMLLNNKGQIHAWD NKSR+APIVARIKRAGIHNVQLHS+ ESLRNLQEHF
Sbjct: 241 GGGGKTLALSMLLNNKGQIHAWDKNKSRIAPIVARIKRAGIHNVQLHSNLESLRNLQEHF 300

Query: 301 TTVLVDAPCSGTGTWRRRPDIKWRLSQKNLIERTEEQKKILEESAQFVRPEGYLVYITCS 360
           TTVLVDAPCSGTGTWRRRPDIKWRLS KNL+ER EEQKKI++E+A+FVR  GYLVYITCS
Sbjct: 301 TTVLVDAPCSGTGTWRRRPDIKWRLSPKNLMERIEEQKKIMQEAAKFVRLGGYLVYITCS 360

Query: 361 ILPEENIQQINYFLSKNPHFSIDSIIDDWNQLYDLKNHPSLFIENGCCVLTPFLTNTDGF 420
           ILPEENIQQIN FL  +PHF IDSI+D+WN+LYDLKN PSLFIENGCC+LTPFLTNTDGF
Sbjct: 361 ILPEENIQQINNFLDNHPHFRIDSIVDNWNELYDLKNPPSLFIENGCCILTPFLTNTDGF 420

Query: 421 FFCRLKRH 428
           FFCRLKRH
Sbjct: 421 FFCRLKRH 428


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15964076|ref|NP_384429.1| NOL1/NOP2/SUN family signature protein [Sinorhizobium meliloti 1021] Length = 429 Back     alignment and organism information
>gi|227824162|ref|YP_002828135.1| Fmu (Sun) domain protein [Sinorhizobium fredii NGR234] Length = 429 Back     alignment and organism information
>gi|222084588|ref|YP_002543117.1| tRNA and rRNA cytosine-C5-methylase (RNA methyltransferase) protein [Agrobacterium radiobacter K84] Length = 429 Back     alignment and organism information
>gi|150398714|ref|YP_001329181.1| Fmu (Sun) domain-containing protein [Sinorhizobium medicae WSM419] Length = 429 Back     alignment and organism information
>gi|325291723|ref|YP_004277587.1| Sun protein [Agrobacterium sp. H13-3] Length = 429 Back     alignment and organism information
>gi|15887638|ref|NP_353319.1| Sun protein [Agrobacterium tumefaciens str. C58] Length = 429 Back     alignment and organism information
>gi|222147270|ref|YP_002548227.1| Sun protein [Agrobacterium vitis S4] Length = 428 Back     alignment and organism information
>gi|327192007|gb|EGE58988.1| tRNA and rRNA cytosine-C5-methylase (RNA methyltransferase) protein [Rhizobium etli CNPAF512] Length = 429 Back     alignment and organism information
>gi|190889972|ref|YP_001976514.1| tRNA and rRNA cytosine-C5-methylase (RNA methyltransferase) protein [Rhizobium etli CIAT 652] Length = 429 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target429 NOL1/NOP2/SUN family signature protein [Candidatus Libe
PRK14902444 PRK14902, PRK14902, 16S rRNA methyltransferase B; Provi 2e-57
PRK14901434 PRK14901, PRK14901, 16S rRNA methyltransferase B; Provi 2e-42
TIGR00563426 TIGR00563, rsmB, ribosomal RNA small subunit methyltran 4e-39
PRK10901427 PRK10901, PRK10901, 16S rRNA methyltransferase B; Provi 1e-34
COG0144355 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Tra 2e-66
KOG1122460 KOG1122, KOG1122, KOG1122, tRNA and rRNA cytosine-C5-me 3e-38
pfam01189277 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family 9e-36
TIGR00446264 TIGR00446, nop2p, NOL1/NOP2/sun family putative RNA met 5e-30
PRK14904445 PRK14904, PRK14904, 16S rRNA methyltransferase B; Provi 1e-30
PRK14903431 PRK14903, PRK14903, 16S rRNA methyltransferase B; Provi 4e-27
PRK11933 470 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransferase 2e-17
KOG2360413 KOG2360, KOG2360, KOG2360, Proliferation-associated nuc 6e-17
KOG2198375 KOG2198, KOG2198, KOG2198, tRNA cytosine-5-methylases a 4e-15
>gnl|CDD|184895 PRK14902, PRK14902, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|184894 PRK14901, PRK14901, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|161931 TIGR00563, rsmB, ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>gnl|CDD|182822 PRK10901, PRK10901, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|30493 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|36338 KOG1122, KOG1122, KOG1122, tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|144689 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family Back     alignment and domain information
>gnl|CDD|129538 TIGR00446, nop2p, NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>gnl|CDD|184897 PRK14904, PRK14904, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|184896 PRK14903, PRK14903, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|183387 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>gnl|CDD|37571 KOG2360, KOG2360, KOG2360, Proliferation-associated nucleolar protein (NOL1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|37409 KOG2198, KOG2198, KOG2198, tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 429 NOL1/NOP2/SUN family signature protein [Candidatus Libe
PRK10901428 16S rRNA methyltransferase B; Provisional 100.0
TIGR00563487 rsmB ribosomal RNA small subunit methyltransferase B; I 100.0
KOG2360413 consensus 100.0
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translation, 100.0
PRK11933 471 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Revi 100.0
pfam01189277 Nol1_Nop2_Fmu NOL1/NOP2/sun family. 100.0
KOG1122460 consensus 100.0
TIGR00446284 nop2p NOL1/NOP2/sun family putative RNA methylase; Inte 100.0
KOG2198375 consensus 100.0
pfam08003315 Methyltransf_9 Protein of unknown function (DUF1698). T 96.18
pfam05175170 MTS Methyltransferase small domain. This domain is foun 99.35
PRK11873258 arsM arsenite S-adenosylmethyltransferase; Reviewed 99.22
PRK08317241 hypothetical protein; Provisional 99.19
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] 99.17
PRK08287186 cobalt-precorrin-6Y C(15)-methyltransferase; Validated 99.13
PRK07402196 precorrin-6B methylase; Provisional 99.12
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 99.08
pfam08704309 GCD14 tRNA methyltransferase complex GCD14 subunit. GCD 99.07
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 99.06
TIGR02469135 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylat 99.02
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 99.02
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 98.98
pfam01135205 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransf 98.98
COG1092393 Predicted SAM-dependent methyltransferases [General fun 98.97
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.94
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase and rel 98.94
PRK13943317 protein-L-isoaspartate O-methyltransferase; Provisional 98.93
PRK13942214 protein-L-isoaspartate O-methyltransferase; Provisional 98.91
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 98.9
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 98.89
pfam10672286 Methyltrans_SAM S-adenosylmethionine-dependent methyltr 98.87
PTZ00098263 phosphoethanolamine N-methyltransferase; Provisional 98.84
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provisional 98.8
smart00828224 PKS_MT Methyltransferase in polyketide synthase (PKS) e 98.77
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 98.76
COG1041347 Predicted DNA modification methylase [DNA replication, 98.76
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provi 98.73
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.73
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.72
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 98.7
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 98.67
PRK00312213 pcm protein-L-isoaspartate O-methyltransferase; Reviewe 98.67
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransferase [P 98.67
PRK01544503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 98.65
pfam01170171 UPF0020 Putative RNA methylase family UPF0020. This dom 98.65
COG4123248 Predicted O-methyltransferase [General function predict 98.63
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosom 98.61
pfam09445165 Methyltransf_15 RNA cap guanine-N2 methyltransferase. R 98.61
pfam02384312 N6_Mtase N-6 DNA Methylase. Restriction-modification (R 98.52
PRK09329285 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.5
KOG1540296 consensus 98.5
TIGR00479434 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; Inter 98.49
COG2520341 Predicted methyltransferase [General function predictio 98.49
PRK01683252 trans-aconitate 2-methyltransferase; Provisional 98.43
pfam01728176 FtsJ FtsJ-like methyltransferase. This family consists 98.4
PRK00517298 prmA ribosomal protein L11 methyltransferase; Reviewed 98.35
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, ribo 98.32
COG4122219 Predicted O-methyltransferase [General function predict 98.31
TIGR00438192 rrmJ ribosomal RNA large subunit methyltransferase J; I 98.31
pfam01596204 Methyltransf_3 O-methyltransferase. Members of this fam 98.3
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal structu 98.28
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzo 98.26
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.25
pfam06325294 PrmA Ribosomal protein L11 methyltransferase (PrmA). Th 98.23
PRK10909198 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional 98.21
PRK11036256 putative metallothionein SmtA; Provisional 98.2
pfam01269229 Fibrillarin Fibrillarin. 98.17
pfam02353273 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. Thi 98.16
COG2230283 Cfa Cyclopropane fatty acid synthase and related methyl 98.16
KOG2904328 consensus 98.14
pfam0824298 Methyltransf_12 Methyltransferase domain. Members of th 98.09
) (PCMT) (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyzes the transfer of a methyl group from S- adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerization of normal L-aspartyl and L- asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00080">TIGR00080228 pimt protein-L-isoaspartate O-methyltransferase; InterP 98.08
PRK04338 376 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Pro 98.01
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methylt 98.0
TIGR01983275 UbiG ubiquinone biosynthesis O-methyltransferase; Inter 97.99
TIGR01934242 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis meth 97.98
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 97.97
pfam03602181 Cons_hypoth95 Conserved hypothetical protein 95. 97.93
pfam05401201 NodS Nodulation protein S (NodS). This family consists 97.91
COG0742187 N6-adenine-specific methylase [DNA replication, recombi 97.9
PRK04266226 fibrillarin; Provisional 97.89
PRK11783716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 97.89
pfam0824195 Methyltransf_11 Methyltransferase domain. Members of th 97.88
pfam02005 375 TRM N2,N2-dimethylguanosine tRNA methyltransferase. Thi 97.88
PTZ00146296 fibrillarin; Provisional 97.82
PRK00121229 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed 97.75
KOG1270282 consensus 97.68
TIGR00095210 TIGR00095 putative methyltransferase; InterPro: IPR0043 97.63
TIGR02072272 BioC biotin biosynthesis protein BioC; InterPro: IPR011 97.57
pfam02390199 Methyltransf_4 Putative methyltransferase. This is a fa 97.56
KOG1271227 consensus 97.5
KOG2187534 consensus 97.48
COG0220227 Predicted S-adenosylmethionine-dependent methyltransfer 97.46
PRK00107216 gidB glucose-inhibited division protein B; Reviewed 97.41
TIGR02143361 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: 97.41
KOG1099294 consensus 97.38
KOG1253 525 consensus 97.35
TIGR00406330 prmA ribosomal protein L11 methyltransferase; InterPro: 97.33
pfam03291327 Pox_MCEL mRNA capping enzyme. This family of enzymes ar 97.29
KOG1663237 consensus 97.25
COG0286489 HsdM Type I restriction-modification system methyltrans 97.25
TIGR00006323 TIGR00006 S-adenosyl-methyltransferase MraW; InterPro: 97.25
TIGR02021224 BchM-ChlM magnesium protoporphyrin O-methyltransferase; 97.21
COG0275314 Predicted S-adenosylmethionine-dependent methyltransfer 97.1
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Provisio 97.02
COG2521287 Predicted archaeal methyltransferase [General function 97.02
pfam02527184 GidB rRNA small subunit methyltransferase G. This is a 96.95
COG4076252 Predicted RNA methylase [General function prediction on 96.81
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA replic 96.75
PRK09880343 L-idonate 5-dehydrogenase; Provisional 96.55
PRK01544 503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 96.51
KOG2899288 consensus 96.33
PRK04457262 spermidine synthase; Provisional 96.28
KOG1596317 consensus 96.25
TIGR00537183 hemK_rel_arch methylase, putative; InterPro: IPR004557 96.25
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, ribo 96.25
COG4106257 Tam Trans-aconitate methyltransferase [General function 96.24
pfam12147311 Hydrolase_5 Putative lysophospholipase. This domain is 96.19
KOG2671421 consensus 96.08
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 96.03
TIGR00536311 hemK_fam methyltransferase, HemK family; InterPro: IPR0 95.94
PHA02056279 putative methyltransferase 95.93
PRK06922679 hypothetical protein; Provisional 95.92
pfam04989202 CmcI Cephalosporin hydroxylase. Members of this family 95.91
PRK10083339 putative dehydrogenase; Provisional 95.88
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylation) [ 95.72
KOG1661237 consensus 95.64
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 95.63
COG1063350 Tdh Threonine dehydrogenase and related Zn-dependent de 95.62
COG0357215 GidB Predicted S-adenosylmethionine-dependent methyltra 95.57
KOG1541270 consensus 95.44
pfam10294171 Methyltransf_16 Putative methyltransferase. 95.4
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 95.39
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 95.25
TIGR00138197 gidB methyltransferase GidB; InterPro: IPR003682 GidB ( 95.23
KOG4589232 consensus 95.21
TIGR01177358 TIGR01177 conserved hypothetical protein TIGR01177; Int 94.9
TIGR02085386 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase R 94.83
KOG0024354 consensus 94.54
PRK09422338 alcohol dehydrogenase; Provisional 94.11
COG0421282 SpeE Spermidine synthase [Amino acid transport and meta 93.9
pfam00398258 RrnaAD Ribosomal RNA adenine dimethylase. 93.76
TIGR03438301 probable methyltransferase. This model represents a dis 93.69
KOG1975389 consensus 93.36
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh 93.33
KOG2361264 consensus 93.23
PRK00811283 spermidine synthase; Provisional 93.09
pfam04816204 DUF633 Family of unknown function (DUF633). This family 92.91
PRK03612516 spermidine synthase; Provisional 92.85
pfam01564240 Spermine_synth Spermine/spermidine synthase. Spermine a 92.76
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 92.43
KOG4300252 consensus 91.81
KOG3191209 consensus 91.2
COG1352268 CheR Methylase of chemotaxis methyl-accepting proteins 91.13
KOG1709271 consensus 90.99
pfam06080201 DUF938 Protein of unknown function (DUF938). This famil 90.74
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism] 90.19
cd00620126 Methyltransferase_Sun N-terminal RNA binding domain of 99.2
cd00447129 NusB_Sun RNA binding domain of NusB (N protein-Utilizat 98.82
pfam01029126 NusB NusB family. The NusB protein is involved in the r 98.41
PRK00202132 nusB transcription antitermination protein NusB; Review 98.24
cd00619130 Terminator_NusB Transcription termination factor NusB ( 97.65
TIGR01951140 nusB transcription antitermination factor NusB; InterPr 96.71
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 99.03
PRK03522375 rumB 23S rRNA methyluridine methyltransferase; Reviewed 99.02
PRK13168440 rumA 23S rRNA 5-methyluridine methyltransferase; Review 98.8
pfam05958353 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. Thi 98.73
PRK05031363 tRNA (uracil-5-)-methyltransferase; Validated 98.58
PRK11207198 tellurite resistance protein TehB; Provisional 98.68
pfam03848192 TehB Tellurite resistance protein TehB. 98.26
PRK12335289 tellurite resistance protein TehB; Provisional 97.09
TIGR00477239 tehB tellurite resistance protein TehB; InterPro: IPR00 93.81
COG2265432 TrmA SAM-dependent methyltransferases related to tRNA ( 98.64
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.07
KOG2915314 consensus 97.92
PRK00050309 mraW S-adenosyl-methyltransferase MraW; Provisional 97.27
pfam01795310 Methyltransf_5 MraW methylase family. Members of this f 97.18
PRK05785225 hypothetical protein; Provisional 96.95
COG3897218 Predicted methyltransferase [General function predictio 96.74
pfam04445235 DUF548 Protein of unknown function (DUF548). Protein of 96.51
pfam07021193 MetW Methionine biosynthesis protein MetW. This family 96.42
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 96.33
KOG2730263 consensus 96.31
PRK06202233 hypothetical protein; Provisional 96.12
KOG3420185 consensus 95.93
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylase 95.77
pfam00145 319 DNA_methylase C-5 cytosine-specific DNA methylase. 95.69
PRK11760356 putative RNA 2'-O-ribose methyltransferase; Provisional 95.6
PRK10742250 putative methyltransferase; Provisional 95.57
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Tr 95.24
smart00650169 rADc Ribosomal RNA adenine dimethylases. 94.89
PTZ00338296 dimethyladenosine transferase; Provisional 93.84
TIGR02081205 metW methionine biosynthesis protein MetW; InterPro: IP 93.43
TIGR01444142 fkbM_fam methyltransferase, FkbM family; InterPro: IPR0 93.17
TIGR00308 462 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase; In 92.4
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, recom 91.09
KOG2782303 consensus 91.05
pfam05219265 DREV DREV methyltransferase. This family contains DREV 97.15
KOG1098 780 consensus 97.09
pfam10354166 DUF2431 Domain of unknown function (DUF2431). This is t 95.79
pfam01861243 DUF43 Protein of unknown function DUF43. This family in 94.33
pfam00107131 ADH_zinc_N Zinc-binding dehydrogenase. 90.28
PRK11524284 putative methyltransferase; Provisional 93.48
PRK13699227 putative methylase; Provisional 92.2
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase B; InterPro: IPR004573 This family consists of bacterial sequences related to Escherichia coli rsmB, an rRNA SAM-dependent methyltransferase Back     alignment and domain information
>KOG2360 consensus Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>pfam01189 Nol1_Nop2_Fmu NOL1/NOP2/sun family Back     alignment and domain information
>KOG1122 consensus Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase; InterPro: IPR011023 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>KOG2198 consensus Back     alignment and domain information
>pfam08003 Methyltransf_9 Protein of unknown function (DUF1698) Back     alignment and domain information
>pfam05175 MTS Methyltransferase small domain Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>pfam08704 GCD14 tRNA methyltransferase complex GCD14 subunit Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; InterPro: IPR014008 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>pfam02475 Met_10 Met-10+ like-protein Back     alignment and domain information
>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>pfam10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>pfam01170 UPF0020 Putative RNA methylase family UPF0020 Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase Back     alignment and domain information
>pfam02384 N6_Mtase N-6 DNA Methylase Back     alignment and domain information
>PRK09329 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG1540 consensus Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; InterPro: IPR001566 This protein family was first proposed to be RNA methyltransferases by homology to the TrmA family Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>pfam01728 FtsJ FtsJ-like methyltransferase Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00438 rrmJ ribosomal RNA large subunit methyltransferase J; InterPro: IPR004512 The ribosomal RNA large subunit methyltransferase J 2 Back     alignment and domain information
>pfam01596 Methyltransf_3 O-methyltransferase Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK11036 putative metallothionein SmtA; Provisional Back     alignment and domain information
>pfam01269 Fibrillarin Fibrillarin Back     alignment and domain information
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2904 consensus Back     alignment and domain information
>pfam08242 Methyltransf_12 Methyltransferase domain Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate O-methyltransferase; InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase; InterPro: IPR014122 MenG is a generic term for a methyltransferase that catalyses the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase; InterPro: IPR010233 This entry represents an O-methyltransferase, which is believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and mitochondria (COQ3) , Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam03602 Cons_hypoth95 Conserved hypothetical protein 95 Back     alignment and domain information
>pfam05401 NodS Nodulation protein S (NodS) Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>pfam08241 Methyltransf_11 Methyltransferase domain Back     alignment and domain information
>pfam02005 TRM N2,N2-dimethylguanosine tRNA methyltransferase Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>KOG1270 consensus Back     alignment and domain information
>TIGR00095 TIGR00095 putative methyltransferase; InterPro: IPR004398 This is a family of conserved hypothetical proteins, which includes a putative methylase Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC; InterPro: IPR011814 This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulphur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable) Back     alignment and domain information
>pfam02390 Methyltransf_4 Putative methyltransferase Back     alignment and domain information
>KOG1271 consensus Back     alignment and domain information
>KOG2187 consensus Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00107 gidB glucose-inhibited division protein B; Reviewed Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: IPR011869 This family consists exclusively of proteins believed to act as tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>KOG1099 consensus Back     alignment and domain information
>KOG1253 consensus Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase; InterPro: IPR004498 Ribosomal protein L11 methyltransferase (2 Back     alignment and domain information
>pfam03291 Pox_MCEL mRNA capping enzyme Back     alignment and domain information
>KOG1663 consensus Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>TIGR00006 TIGR00006 S-adenosyl-methyltransferase MraW; InterPro: IPR002903 This is a family of methyltransferases Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase; InterPro: IPR010251 Chlorophyll and bacteriochlorophyll are essential photosynthetic pigments involved in oxygenic and non-oxygenic photosythesis respectively Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>pfam02527 GidB rRNA small subunit methyltransferase G Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>KOG2899 consensus Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>KOG1596 consensus Back     alignment and domain information
>TIGR00537 hemK_rel_arch methylase, putative; InterPro: IPR004557 These proteins exhibit homology to the Saccharomyces cerevisiae (yeast) ORF YDR140w (FYV9) Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>pfam12147 Hydrolase_5 Putative lysophospholipase Back     alignment and domain information
>KOG2671 consensus Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>TIGR00536 hemK_fam methyltransferase, HemK family; InterPro: IPR004556 The gene hemK from Escherichia coli was found to contribute to heme biosynthesis and originally suggested to be protoporphyrinogen oxidase Back     alignment and domain information
>PHA02056 putative methyltransferase Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>pfam04989 CmcI Cephalosporin hydroxylase Back     alignment and domain information
>PRK10083 putative dehydrogenase; Provisional Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1661 consensus Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1541 consensus Back     alignment and domain information
>pfam10294 Methyltransf_16 Putative methyltransferase Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00138 gidB methyltransferase GidB; InterPro: IPR003682 GidB (glucose-inhibited division protein B) appears to be present and in a single copy in all complete eubacterial genomes so far Back     alignment and domain information
>KOG4589 consensus Back     alignment and domain information
>TIGR01177 TIGR01177 conserved hypothetical protein TIGR01177; InterPro: IPR005885 This family of largely hypothetical proteins is found exclusively in the Archaea and contain a putative RNA methylase domain Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB; InterPro: IPR011825 This family consists of RNA methyltransferases designated RumB, formerly YbjF Back     alignment and domain information
>KOG0024 consensus Back     alignment and domain information
>PRK09422 alcohol dehydrogenase; Provisional Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam00398 RrnaAD Ribosomal RNA adenine dimethylase Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>KOG1975 consensus Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>KOG2361 consensus Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>pfam04816 DUF633 Family of unknown function (DUF633) Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>pfam01564 Spermine_synth Spermine/spermidine synthase Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>KOG4300 consensus Back     alignment and domain information
>KOG3191 consensus Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>KOG1709 consensus Back     alignment and domain information
>pfam06080 DUF938 Protein of unknown function (DUF938) Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>cd00620 Methyltransferase_Sun N-terminal RNA binding domain of the methyltransferase Sun Back     alignment and domain information
>cd00447 NusB_Sun RNA binding domain of NusB (N protein-Utilization Substance B) and Sun (also known as RrmB or Fmu) proteins Back     alignment and domain information
>pfam01029 NusB NusB family Back     alignment and domain information
>PRK00202 nusB transcription antitermination protein NusB; Reviewed Back     alignment and domain information
>cd00619 Terminator_NusB Transcription termination factor NusB (N protein-Utilization Substance B) Back     alignment and domain information
>TIGR01951 nusB transcription antitermination factor NusB; InterPro: IPR011605 The NusB protein is involved in the regulation of rRNA biosynthesis by transcriptional antitermination Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK13168 rumA 23S rRNA 5-methyluridine methyltransferase; Reviewed Back     alignment and domain information
>pfam05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>pfam03848 TehB Tellurite resistance protein TehB Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB; InterPro: IPR004537 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>KOG2915 consensus Back     alignment and domain information
>PRK00050 mraW S-adenosyl-methyltransferase MraW; Provisional Back     alignment and domain information
>pfam01795 Methyltransf_5 MraW methylase family Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>pfam04445 DUF548 Protein of unknown function (DUF548) Back     alignment and domain information
>pfam07021 MetW Methionine biosynthesis protein MetW Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>KOG2730 consensus Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>KOG3420 consensus Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>pfam00145 DNA_methylase C-5 cytosine-specific DNA methylase Back     alignment and domain information
>PRK11760 putative RNA 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family; InterPro: IPR006342 Members of this group are characterised by two well-conserved short regions separated by a variable region in both sequence and length Back     alignment and domain information
>TIGR00308 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information