254780635

254780635

hypothetical protein CLIBASIA_02610

GeneID in NCBI database:8209635Locus tag:CLIBASIA_02610
Protein GI in NCBI database:254780635Protein Accession:YP_003065048.1
Gene range:-(634351, 635589)Protein Length:412aa
Gene description:hypothetical protein
COG prediction:[P] Uncharacterized iron-regulated protein
KEGG prediction:hypothetical protein; K07231 putative iron-regulated protein
SEED prediction:Iron-regulated protein A precursor
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410--
MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP
ccHHHHHHHHHHccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHcEEEEcccccccccccccccccccHHHHHcccccccccccccccccccccccccEEcccccccHHHccHHHHHHHHcccccccHHccccHHHHHHHccccccccccccccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHcccccccccHHHHHHHHcHHHHHHHHHHHHHHHHHcccEEEcccccEEccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHcccc
ccccccccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccEEEccccccccccccccccccccccHHHcccccccccccccccEEEEEEcccEEEcccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccccccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccHHHHHHHHHHccccccHHHHHHHHcEEEEcccccHHHcccccccccccHHHcccccEEEEcccEEEccccEcccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEcccc
MYFITIISIVFtlpshalsivpnvslEKVLQNYATIAHAKYEDALMCARTLDSAIETlvttpnkknlENARLQWIRARipyqqsevyrfGNKIVDTWDkkvnawpldegfidyvdssygkeneennlytanIIANSKIIVnekeidlsiispDLLRKLHRAngidtnittGYHVIEFLLWGqdlktnvrepgnrpytdfdignctgghcrrRVEYLKVVSKILVSDLEEMMKawgpdgqaTKDLMKDINAGLNSIITGMTSLSYNELAGERMnlglilhdpeqeidcfsdntyasYLNDVIGIISSYTGEYIrmngekihgaSIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALdliepnrvignvp
MYFITIISIvftlpshaLSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETlvttpnkknlenARLQWIRaripyqqsevyrFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPgnrpytdfdignctgghcrrrveYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRialdliepnrvignvp
MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP
*YFITIISIVFTLPSHALS*VPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGN**
MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP
**FITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP
MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP
MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPNRVIGNVP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target412 hypothetical protein CLIBASIA_02610 [Candidatus Liberib
315122173433 hypothetical protein CKC_02115 [Candidatus Liberibacter 1 1e-180
159184243425 hypothetical protein Atu0288 [Agrobacterium tumefaciens 1 1e-131
222147269425 hypothetical protein Avi_0335 [Agrobacterium vitis S4] 1 1e-129
325291722425 iron-regulated protein [Agrobacterium sp. H13-3] Length 1 1e-129
209551882424 hypothetical protein Rleg2_4315 [Rhizobium leguminosaru 1 1e-124
86355961424 hypothetical protein RHE_CH00304 [Rhizobium etli CFN 42 1 1e-124
116250090424 iron-regulated protein [Rhizobium leguminosarum bv. vic 1 1e-124
241207259424 hypothetical protein Rleg_4578 [Rhizobium leguminosarum 1 1e-124
190889971424 hypothetical protein RHECIAT_CH0000341 [Rhizobium etli 1 1e-124
222084586425 hypothetical protein Arad_0521 [Agrobacterium radiobact 1 1e-124
>gi|315122173|ref|YP_004062662.1| hypothetical protein CKC_02115 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 433 Back     alignment and organism information
 Score =  635 bits (1639), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 302/405 (74%), Positives = 354/405 (87%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           M+F TII+ + T PS+ LS+V +V    VL+NYATIAHAKYEDA++ ARTL+ AIETLV+
Sbjct: 27  MHFFTIITFILTFPSNVLSVVIDVDPIDVLRNYATIAHAKYEDAVISARTLNRAIETLVS 86

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
           +P++KNL+NARLQWI+ARIPYQQSE+YRFG+ IV+ WDKK+NAWP+DEG IDYVD SYGK
Sbjct: 87  SPSQKNLDNARLQWIKARIPYQQSEIYRFGSTIVNAWDKKINAWPIDEGVIDYVDISYGK 146

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
            N+EN LY ANIIAN+KI  + KEID SIISP LLRKLH  NGIDTNITTGYHVIEFLLW
Sbjct: 147 HNDENELYAANIIANTKISFDGKEIDTSIISPKLLRKLHFINGIDTNITTGYHVIEFLLW 206

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
           GQDLKTNV   G RPYTDFDI  CTGG+C+RR+EYLKVVSKILVSDLEE+MK W PDG+ 
Sbjct: 207 GQDLKTNVHGSGERPYTDFDIKKCTGGNCQRRIEYLKVVSKILVSDLEELMKVWKPDGEE 266

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
           T ++MKD N GL++IITGMTSLSYNELAGERMNLGLILHDP+QE+DCFSDNTYASYLN+V
Sbjct: 267 TLNIMKDTNLGLDTIITGMTSLSYNELAGERMNLGLILHDPKQELDCFSDNTYASYLNNV 326

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
           IGI+SSYTGEY R+NGE+IHG SIHDLI + N+NL+ EI +KF++TMKDF+ L +RAE+I
Sbjct: 327 IGILSSYTGEYTRINGEEIHGPSIHDLIKNKNKNLSAEIKNKFAHTMKDFYALAERAEHI 386

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIEPN 405
           ES+DQMIS NNPEGNKIV NLI+DLITQT SL+K+RIALDL E N
Sbjct: 387 ESYDQMISANNPEGNKIVLNLIDDLITQTNSLKKLRIALDLKEIN 431


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159184243|ref|NP_353318.2| hypothetical protein Atu0288 [Agrobacterium tumefaciens str. C58] Length = 425 Back     alignment and organism information
>gi|222147269|ref|YP_002548226.1| hypothetical protein Avi_0335 [Agrobacterium vitis S4] Length = 425 Back     alignment and organism information
>gi|325291722|ref|YP_004277586.1| iron-regulated protein [Agrobacterium sp. H13-3] Length = 425 Back     alignment and organism information
>gi|209551882|ref|YP_002283799.1| hypothetical protein Rleg2_4315 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 424 Back     alignment and organism information
>gi|86355961|ref|YP_467853.1| hypothetical protein RHE_CH00304 [Rhizobium etli CFN 42] Length = 424 Back     alignment and organism information
>gi|116250090|ref|YP_765928.1| iron-regulated protein [Rhizobium leguminosarum bv. viciae 3841] Length = 424 Back     alignment and organism information
>gi|241207259|ref|YP_002978355.1| hypothetical protein Rleg_4578 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 424 Back     alignment and organism information
>gi|190889971|ref|YP_001976513.1| hypothetical protein RHECIAT_CH0000341 [Rhizobium etli CIAT 652] Length = 424 Back     alignment and organism information
>gi|222084586|ref|YP_002543115.1| hypothetical protein Arad_0521 [Agrobacterium radiobacter K84] Length = 425 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target412 hypothetical protein CLIBASIA_02610 [Candidatus Liberib
pfam09375285 pfam09375, Peptidase_M75, Imelysin 1e-59
COG3487446 COG3487, IrpA, Uncharacterized iron-regulated protein [ 1e-133
>gnl|CDD|150145 pfam09375, Peptidase_M75, Imelysin Back     alignment and domain information
>gnl|CDD|33290 COG3487, IrpA, Uncharacterized iron-regulated protein [Inorganic ion transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 412 hypothetical protein CLIBASIA_02610 [Candidatus Liberib
COG3487446 IrpA Uncharacterized iron-regulated protein [Inorganic 100.0
pfam09375285 Peptidase_M75 Imelysin. The imelysin peptidase was firs 100.0
COG3489359 Predicted periplasmic lipoprotein [General function pre 100.0
PRK10378374 hypothetical protein; Provisional 100.0
COG2822376 Predicted periplasmic lipoprotein involved in iron tran 99.97
>COG3487 IrpA Uncharacterized iron-regulated protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam09375 Peptidase_M75 Imelysin Back     alignment and domain information
>COG3489 Predicted periplasmic lipoprotein [General function prediction only] Back     alignment and domain information
>PRK10378 hypothetical protein; Provisional Back     alignment and domain information
>COG2822 Predicted periplasmic lipoprotein involved in iron transport [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target412 hypothetical protein CLIBASIA_02610 [Candidatus Liberib
3at7_A283 Crystal Structure Of Bacterial Cell-Surface Alginat 5e-18
3pf0_A364 Crystal Structure Of An Imelysin-Like Protein (Psyc 1e-12
3n8u_A361 Crystal Structure Of An Imelysin Peptidase (Bacova_ 1e-15
3n8u_A 361 Crystal Structure Of An Imelysin Peptidase (Bacova_ 2e-13
>gi|323714411|pdb|3AT7|A Chain A, Crystal Structure Of Bacterial Cell-Surface Alginate-Binding Protein Algp7 Length = 283 Back     alignment and structure
 Score = 96.9 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 51/403 (12%), Positives = 107/403 (26%), Gaps = 132/403 (32%)

Query: 1   MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVT 60
           +  +  +++     S A + V  + L + + +Y               +TL         
Sbjct: 6   LSRLASLTLFVGFMSAAQAAVAPLDLVQPISDYKIYV-------SENLQTLVRDTREFTN 58

Query: 61  TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGK 120
                ++  A+  +   R+ Y++ E                   P+ E F D   S   +
Sbjct: 59  AVKAGDVAKAKKLFASTRMSYERIE-------------------PIAELFSDLDASIDSR 99

Query: 121 ENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLW 180
            ++                                               G+H IE+ L+
Sbjct: 100 ADDHEK------------------------------------AEKDPAFFGFHRIEYGLF 123

Query: 181 GQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQA 240
            Q+                                L  V+  L++D+ E+ K        
Sbjct: 124 AQNSAKG----------------------------LAPVADKLMADVLELQKRIRGLTFP 155

Query: 241 TKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDV 300
            + +             G  ++   E+A  +++          E D +S      +  + 
Sbjct: 156 PEKV------------VGGAAVLMEEVAATKISG---------EEDRYSHTDLWDFQANF 194

Query: 301 IGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENI 360
            G                        L+  +NR  A +++  F    K     +      
Sbjct: 195 EGAKKIVDL--------------FRPLVVKDNRAFADKVDANFDTVFKTLAKYRTADGGF 240

Query: 361 ESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIALDLIE 403
           E + ++    +    K++   +N L    E L K+R  L L  
Sbjct: 241 ELYGKL----SERDRKVLAGRVNTL---AEDLSKMRGLLGLDL 276


>gi|311772305|pdb|3PF0|A Chain A, Crystal Structure Of An Imelysin-Like Protein (Psyc_1802) From Psychrobacter Arcticum 273-4 At 2.15 A Resolution Length = 364 Back     alignment and structure
>gi|301598665|pdb|3N8U|A Chain A, Crystal Structure Of An Imelysin Peptidase (Bacova_03801) From Bacteroides Ovatus At 1.44 A Resolution Length = 361 Back     alignment and structure
>gi|301598665|pdb|3N8U|A Chain A, Crystal Structure Of An Imelysin Peptidase (Bacova_03801) From Bacteroides Ovatus At 1.44 A Resolution Length = 361 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target412 hypothetical protein CLIBASIA_02610 [Candidatus Liberib
3pf0_A364 Imelysin-like protein; putative metalloendopeptidase, s 1e-26
3oyv_A361 Imelysin; outer membrane protein, extracellular active 4e-24
3oyv_A 361 Imelysin; outer membrane protein, extracellular active 5e-24
>3pf0_A Imelysin-like protein; putative metalloendopeptidase, structural genomics, joint CE structural genomics, JCSG; 2.15A {Psychrobacter arcticus} Length = 364 Back     alignment and structure
 Score =  115 bits (289), Expect = 1e-26
 Identities = 49/372 (13%), Positives = 105/372 (28%), Gaps = 84/372 (22%)

Query: 27  EKVLQNYA-TIAHAKYEDALMCARTLDSAIETLV--TTPNKKNLENARLQWIRARIPYQQ 83
           +  L + A  +    Y DA   +  L    +        +   L+  R QW+     +  
Sbjct: 52  KTYLTHVANDMVIPAYADAAKQSDLLHDLAQKHCQKAPVSGDELQALRDQWLVLAQAWAS 111

Query: 84  SEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEK 143
           +E+  FG       +  +N +P + G +    +     N      TA  +AN   +V   
Sbjct: 112 AEMVNFGPATASMSNLYINYYPDERGLVHGGVADLITANPA---LTAEQLANESAVV--- 165

Query: 144 EIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGN 203
                                      G   +E  L+  D                    
Sbjct: 166 --------------------------QGIPGLEEALYANDSLDA---------------- 183

Query: 204 CTGGHCRRRVEYLKVVSKILVSDLEEMMKAW--GPDGQATKDLMKDINAGLNSIITGMTS 261
                   +  Y+   S  L + L+++ K W          D   + + GLN     + S
Sbjct: 184 -------GQCAYVMSASSALGTRLKDIEKNWQQNAIKLLAIDKTAESDQGLNQWFNSLLS 236

Query: 262 LSYNELAGERMN--LGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKI 319
           L    +    +   LGL            +  + A     +  +  + T   +       
Sbjct: 237 L-VETMKSNAIEQPLGLSGKAKGHLPAATAGQSRAIINAKLATLNKAMTDPVLT------ 289

Query: 320 HGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVR 379
                  L S+N   +A  ++   ++T             +    + ++  +    + + 
Sbjct: 290 -----AILGSNNENTVADTLSTALADTTA----------LLAQMPEDLATADKATQQELY 334

Query: 380 NLINDLITQTES 391
           + + ++    +S
Sbjct: 335 DHLTNITRLIKS 346


>3oyv_A Imelysin; outer membrane protein, extracellular active site, metal BIN protein, structural genomics; HET: MSE; 1.25A {Bacteroides ovatus atcc 8483} PDB: 3n8u_A* Length = 361 Back     alignment and structure
>3oyv_A Imelysin; outer membrane protein, extracellular active site, metal BIN protein, structural genomics; HET: MSE; 1.25A {Bacteroides ovatus atcc 8483} PDB: 3n8u_A* Length = 361 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target412 hypothetical protein CLIBASIA_02610 [Candidatus Liberib
3pf0_A364 Imelysin-like protein; putative metalloendopeptidase, s 100.0
3oyv_A 361 Imelysin; outer membrane protein, extracellular active 100.0
3oyv_A361 Imelysin; outer membrane protein, extracellular active 100.0
>3pf0_A Imelysin-like protein; putative metalloendopeptidase, structural genomics, joint CE structural genomics, JCSG; 2.15A {Psychrobacter arcticus} Back     alignment and structure
Probab=100.00  E-value=0  Score=382.28  Aligned_cols=301  Identities=14%  Similarity=0.218  Sum_probs=246.4

Q ss_pred             CCCHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHH--CCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             6788999988788-6798899999999999999999994--999889999999999999977765654015402210001
Q gi|254780635|r   23 NVSLEKVLQNYAT-IAHAKYEDALMCARTLDSAIETLVT--TPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDK   99 (412)
Q Consensus        23 ~~~~~~vl~~yad-iv~~~Y~d~~~~a~~L~~ai~af~a--~Pt~~~L~aak~aw~~Ar~~we~~E~f~fGpa~~~~~~~   99 (412)
                      ..+.+.+|+||+| ||+|+|.++..++.+|+.++++||.  .|++++|+++|.+|+.+|.+||++|+|+|||+...++.+
T Consensus        48 ~~~~~~~L~~~ad~vIiP~y~~l~~~a~~L~~a~~a~c~~~~p~~~~L~aar~aw~~a~~~Wq~~e~~~fGPa~~~~~~~  127 (364)
T 3pf0_A           48 AETEKTYLTHVANDMVIPAYADAAKQSDLLHDLAQKHCQKAPVSGDELQALRDQWLVLAQAWASAEMVNFGPATASMSNL  127 (364)
T ss_dssp             HHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHGGGCSBCHHHHHHHHHHHHHHHHHHHHHTTCCSGGGGGGGHHH
T ss_pred             HHHHHHHHHHHHCCEEHHCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHH
T ss_conf             22289999997137530369999999999999999985057998899999999999999999998716078566512555


Q ss_pred             HHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCHHHHHHHHHCCCCCCHHHCCHHHHHHHH
Q ss_conf             10016576210001123334443333322233336433435522222320397888766641666510211278999986
Q gi|254780635|r  100 KVNAWPLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLL  179 (412)
Q Consensus       100 ~in~WPl~~~~iD~v~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~d~~~it~~~l~~~~e~~~~~~~~~~GfhAiEyLL  179 (412)
                      +|++||++++.|+..........                         ..++++.+       ...+++.||||||||||
T Consensus       128 ~i~~wP~~~~~i~~~i~~~~~~~-------------------------~~~~~~~~-------~~~s~~~qGf~ALEyLL  175 (364)
T 3pf0_A          128 YINYYPDERGLVHGGVADLITAN-------------------------PALTAEQL-------ANESAVVQGIPGLEEAL  175 (364)
T ss_dssp             HHCCCCCTTCHHHHHHHHHHHHC-------------------------TTCCTGGG-------GGSCGGGSHHHHHHHHH
T ss_pred             HCCCCCCCHHHHHHHHHHHHHCC-------------------------CCCCHHHH-------CCCCHHHCCHHHHHHHH
T ss_conf             31247774037888999887426-------------------------75685664-------33345741859999997


Q ss_pred             CCCCCCCCCCCCCCCCHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC--CHHHHHHCCHHHHHHHHHH
Q ss_conf             27787776555555303432011334540456799999999999999999995203554--1057762153445999999
Q gi|254780635|r  180 WGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDG--QATKDLMKDINAGLNSIIT  257 (412)
Q Consensus       180 fg~~~~~~~~~~~~r~~~d~~~~~~t~~~~~rr~~YL~ava~~l~~~~~~l~~~W~~~~--~~~~~~~~~~~~~~~~i~~  257 (412)
                      |+++..                       ..+||.||++++.+|+.++.+|...|+++.  .+....+.+..+++..+++
T Consensus       176 f~~~~~-----------------------~~~rc~Yl~ava~~l~~~a~~l~~~W~~~~~~~~~~~~~~~~~~al~~l~~  232 (364)
T 3pf0_A          176 YANDSL-----------------------DAGQCAYVMSASSALGTRLKDIEKNWQQNAIKLLAIDKTAESDQGLNQWFN  232 (364)
T ss_dssp             HSSSSB-----------------------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTGGGTTTCCHHHHHHHH
T ss_pred             CCCCCC-----------------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHCCCCCCCCCHHHHHHHHH
T ss_conf             688755-----------------------067889999999999999999999886274754002444460589999999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCC--CHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHH-HCHH
Q ss_conf             9999989876430022423578--843446663527289999999999999503335666543356468999975-1887
Q gi|254780635|r  258 GMTSLSYNELAGERMNLGLILH--DPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISH-NNRN  334 (412)
Q Consensus       258 g~~~~~~~Ev~~~Ki~~pl~~~--~pe~~Es~~S~~S~~d~~~Ni~gi~n~y~G~~~~~~g~~~~g~sl~d~l~~-~~~~  334 (412)
                      +|..+. +++++.|||.|++..  .+...++|||++|+.++.+|+.|++++|.|.            ++..++.. .+++
T Consensus       233 ~~i~~~-e~l~~~Klg~Plg~~~~~~~~~~~~~S~~S~~~i~anl~sl~~~y~g~------------~~~~~l~~~~~~~  299 (364)
T 3pf0_A          233 SLLSLV-ETMKSNAIEQPLGLSGKAKGHLPAATAGQSRAIINAKLATLNKAMTDP------------VLTAILGSNNENT  299 (364)
T ss_dssp             HHHHHH-HHHHHHTTHHHHTSSSSCCSCCTTTTTTCHHHHHHHHHHHHHHHHSCH------------HHHHHHTTSSTHH
T ss_pred             HHHHHH-HHHHHHHHCCCCCCCCCCCCCCHHHHHCCCHHHHHHHHHHHHHHHCCC------------HHHHHHHCCCCHH
T ss_conf             999999-999985642455677789876446671375999999999999997350------------0777752056588


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHH-HHHHHCCCCCC
Q ss_conf             89999999999999998311113114534575404998999999999999999999999-99875287663
Q gi|254780635|r  335 LAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLR-KIRIALDLIEP  404 (412)
Q Consensus       335 La~~i~~~f~~a~~~l~ai~~~~~~~~~~D~~i~~~~~~~~~~v~~ai~aL~~~~~~i~-~~~~~Lgl~~~  404 (412)
                      |+++|..+|+.+..+++.|+.++.          ..+..++..+..++..|   ...++ +++..|||+..
T Consensus       300 La~~I~~q~~~a~~~i~~l~~~~~----------~~d~~~~~~l~~~l~~L---~~~lk~d~~~~Lgi~~g  357 (364)
T 3pf0_A          300 VADTLSTALADTTALLAQMPEDLA----------TADKATQQELYDHLTNI---TRLIKSQLIPTLGIRVG  357 (364)
T ss_dssp             HHHHHHHHHHHHHHHHHTSCSSGG----------GSCHHHHHHHHHHHHHH---HHHHHHTHHHHTTCCSC
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCHH----------CCCHHHHHHHHHHHHHH---HHHHHHHHHHHHCCCCC
T ss_conf             999999999999999983860221----------03758999999999999---99999988997194648



>3oyv_A Imelysin; outer membrane protein, extracellular active site, metal BIN protein, structural genomics; HET: MSE; 1.25A {Bacteroides ovatus atcc 8483} PDB: 3n8u_A* Back     alignment and structure
>3oyv_A Imelysin; outer membrane protein, extracellular active site, metal BIN protein, structural genomics; HET: MSE; 1.25A {Bacteroides ovatus atcc 8483} PDB: 3n8u_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00