254780638

254780638

molecular chaperone protein DnaJ

GeneID in NCBI database:8209639Locus tag:CLIBASIA_02625
Protein GI in NCBI database:254780638Protein Accession:YP_003065051.1
Gene range:-(629789, 630943)Protein Length:384aa
Gene description:molecular chaperone protein DnaJ
COG prediction:[O] DnaJ-class molecular chaperone with C-terminal Zn finger domain
KEGG prediction:dnaJ; molecular chaperone protein DnaJ; K03686 molecular chaperone DnaJ
SEED prediction:Chaperone protein DnaJ
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Protein chaperones;
Heat shock dnaK gene cluster extended
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380----
MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNNPQSTGFFARMKDFFDSLKN
cccccHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccEEEcccHHHHHccccEEEccccccccccccccccccccccccccccccccEEEEEEcccccEEEEccccccccEEEcccccccccccEEEEEEEEEEEcccccccccEEEEccccccccccccccEEEEEEEEEccccEEEccccEEEEEEccHHHHHcccEEEEEcccccEEEEEEccccccccEEEEcccccccccccccccEEEEEEEEccccccHHHHHHHHHHHHHccccccHHHccHHHHHHHHHHHccc
cccccHHHHccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccHHEEcEEcHHHHHccccEEEEcccccccccccccccccccccccccccccccHHHHHHcccEEEEccccccccccEEEcccccccccccEEEEEEEEEEEcccccccccEEEEcccccccccccccccEEEEEEEcccccEEccccccEEEccccHHHHHHcccEEcccccccEEEEEEccccccccEEEEEccccccccccccccEEEEEEEEccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccc
mkkadfyqvlgidrnatDRQLKTAFRSLAMkyhpdqnrndpeaKEKFAQISEAYEVLrdpqkralydqgghealeygaqsqgaggfgagmygnsdfselFEGIFggimgsgrsykrssstgeagaDLRYNLEISLeeafsgktvqirfptavkcstcsgsgakpgtnpmdcnicngsgrvytTAQSFFSIERACStcrgsgqiiphpcskchgqgrvseekllsvnvppgvddgtrirlsgeggagvyggapgDLYIFISVKKhqffkrdgadlyctvPISIVTVAmggtfdvatldathsrvtipegtqtgkqfrlkgkgmpvinsgrkgdLYVQVQVETPQKLNKRQRELLEEFEQissqdnnpqstgFFARMKDFFDSLKN
mkkadfyqvlgidrnatdrqLKTAFRSLAMkyhpdqnrndpeAKEKFAQISEAYEVLRDPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGADLRYNLEISLEEAfsgktvqirfpTAVKCSTCsgsgakpgtnpMDCNICNGSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKllsvnvppgvddgTRIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDAthsrvtipegtqtgkqfrlkgkgmPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFeqissqdnnpqstgFFARMKDFFDSLKN
MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRALYDQGGHEALEygaqsqgaggfgagmygNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSgeggagvyggapgDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNNPQSTGFFARMKDFFDSLKN
*KKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRALYDQGGHEALEYG********FGAGMYGNSDFSELFEGIFG***********************YNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGA**GTNPMDCNICNGSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRL**E******GGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELL*********************MKDFFDSLK*
MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSG***********AGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNNPQSTGFFARMKDFFDSLKN
***ADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSG**PGTNPMDCNICNGSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS************AR**DFF*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNNPQSTGFFARMKDFFDSLKN
MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNNPQSTGFFARMKDFFDSLKN
MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNNPQSTGFFARMKDFFDSLKN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target384 molecular chaperone protein DnaJ [Candidatus Liberibact
254780585191 molecular chaperone DnaJ family protein [Candidatu 5e-05
>gi|254780585|ref|YP_003064998.1| molecular chaperone DnaJ family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 191 Back     alignment
 Score = 40.4 bits (93), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 35/52 (67%)

Query: 7   YQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLR 58
           +++LG+  +++  +++  ++ L  K+HPD N  D  ++E+F  + +AY++L+
Sbjct: 135 FEILGLLSDSSPEEIRGRYKDLVKKHHPDANGGDRGSEERFQAVIQAYKILK 186

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target384 molecular chaperone protein DnaJ [Candidatus Liberibact
315122170384 molecular chaperone protein DnaJ [Candidatus Liberibact 1 0.0
325291563377 DnaJ family molecular chaperone [Agrobacterium sp. H13- 1 1e-145
62899970379 RecName: Full=Chaperone protein dnaJ Length = 379 1 1e-144
86355804375 DnaJ family molecular chaperone [Rhizobium etli CFN 42] 1 1e-144
15887475377 DnaJ family molecular chaperone [Agrobacterium tumefaci 1 1e-143
190889814375 molecular chaperone protein DnaJ [Rhizobium etli CIAT 6 1 1e-143
116249918375 chaperone protein DnaJ [Rhizobium leguminosarum bv. vic 1 1e-142
222084354382 molecular chaperone protein [Agrobacterium radiobacter 1 1e-142
209551666376 chaperone protein DnaJ [Rhizobium leguminosarum bv. tri 1 1e-142
227824010379 chaperone protein DnaJ [Sinorhizobium fredii NGR234] Le 1 1e-142
>gi|315122170|ref|YP_004062659.1| molecular chaperone protein DnaJ [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 384 Back     alignment and organism information
 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/382 (84%), Positives = 358/382 (93%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M K DFYQVLG++RNA D++LK+AFRSLAMKYHPD+N+NDP+AKE+F QISEAYEVLRDP
Sbjct: 1   MTKPDFYQVLGVERNANDKELKSAFRSLAMKYHPDRNQNDPKAKERFGQISEAYEVLRDP 60

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           QKRALYDQGGH+ALE+G QS  AGGFG  M+G+S FSE+FE IFGG+MGSGRS+KRS++T
Sbjct: 61  QKRALYDQGGHDALEHGGQSYSAGGFGNNMHGSSVFSEIFEDIFGGMMGSGRSHKRSTAT 120

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
           GEAGADLRYNL+ISLEEAFSGK +QI  PTAVKC++CSGSGAKPGTNP  CNICNGSGRV
Sbjct: 121 GEAGADLRYNLDISLEEAFSGKAIQINIPTAVKCNSCSGSGAKPGTNPKTCNICNGSGRV 180

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
           YTTAQ+FFSIERAC TC+GSG+II +PCSKCHGQGR++EEKLLSVN+PPGVDDGTRIRLS
Sbjct: 181 YTTAQNFFSIERACVTCQGSGKIISNPCSKCHGQGRIAEEKLLSVNIPPGVDDGTRIRLS 240

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           GEG AG++GG PGDLYIFISVKKHQFF+RDGADLYCTVPISIVT A+GGTFDVATLDATH
Sbjct: 241 GEGEAGIHGGPPGDLYIFISVKKHQFFQRDGADLYCTVPISIVTTAIGGTFDVATLDATH 300

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
           SRV IPEGTQTGKQFRLKGKGMPV+NS RKGDLYVQ+QVETPQKLNKRQRELL+EFEQIS
Sbjct: 301 SRVNIPEGTQTGKQFRLKGKGMPVVNSTRKGDLYVQLQVETPQKLNKRQRELLKEFEQIS 360

Query: 361 SQDNNPQSTGFFARMKDFFDSL 382
           S+DNNPQSTGFF RMKDFFDSL
Sbjct: 361 SKDNNPQSTGFFVRMKDFFDSL 382


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325291563|ref|YP_004277427.1| DnaJ family molecular chaperone [Agrobacterium sp. H13-3] Length = 377 Back     alignment and organism information
>gi|62899970|sp|Q6RSN5|DNAJ_AGRTU RecName: Full=Chaperone protein dnaJ Length = 379 Back     alignment and organism information
>gi|86355804|ref|YP_467696.1| DnaJ family molecular chaperone [Rhizobium etli CFN 42] Length = 375 Back     alignment and organism information
>gi|15887475|ref|NP_353156.1| DnaJ family molecular chaperone [Agrobacterium tumefaciens str. C58] Length = 377 Back     alignment and organism information
>gi|190889814|ref|YP_001976356.1| molecular chaperone protein DnaJ [Rhizobium etli CIAT 652] Length = 375 Back     alignment and organism information
>gi|116249918|ref|YP_765756.1| chaperone protein DnaJ [Rhizobium leguminosarum bv. viciae 3841] Length = 375 Back     alignment and organism information
>gi|222084354|ref|YP_002542883.1| molecular chaperone protein [Agrobacterium radiobacter K84] Length = 382 Back     alignment and organism information
>gi|209551666|ref|YP_002283583.1| chaperone protein DnaJ [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 376 Back     alignment and organism information
>gi|227824010|ref|YP_002827983.1| chaperone protein DnaJ [Sinorhizobium fredii NGR234] Length = 379 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target384 molecular chaperone protein DnaJ [Candidatus Liberibact
PRK10767371 PRK10767, PRK10767, chaperone protein DnaJ; Provisional 1e-173
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 1e-131
PRK14277386 PRK14277, PRK14277, chaperone protein DnaJ; Provisional 1e-112
PRK14280376 PRK14280, PRK14280, chaperone protein DnaJ; Provisional 1e-110
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provisional 1e-107
PRK14301373 PRK14301, PRK14301, chaperone protein DnaJ; Provisional 1e-106
PRK14276380 PRK14276, PRK14276, chaperone protein DnaJ; Provisional 2e-98
PRK14283378 PRK14283, PRK14283, chaperone protein DnaJ; Provisional 8e-97
PRK14278378 PRK14278, PRK14278, chaperone protein DnaJ; Provisional 2e-95
PRK14297380 PRK14297, PRK14297, chaperone protein DnaJ; Provisional 4e-95
PRK14300372 PRK14300, PRK14300, chaperone protein DnaJ; Provisional 6e-95
PRK14298377 PRK14298, PRK14298, chaperone protein DnaJ; Provisional 2e-94
PRK14293374 PRK14293, PRK14293, chaperone protein DnaJ; Provisional 2e-91
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provisional 1e-90
PRK14291382 PRK14291, PRK14291, chaperone protein DnaJ; Provisional 5e-90
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provisional 3e-89
PRK14284391 PRK14284, PRK14284, chaperone protein DnaJ; Provisional 1e-88
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provisional 2e-80
PRK14279392 PRK14279, PRK14279, chaperone protein DnaJ; Provisional 2e-79
PRK14281397 PRK14281, PRK14281, chaperone protein DnaJ; Provisional 4e-77
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provisional 6e-76
PRK14289386 PRK14289, PRK14289, chaperone protein DnaJ; Provisional 1e-75
PRK14295389 PRK14295, PRK14295, chaperone protein DnaJ; Provisional 4e-75
PRK14285365 PRK14285, PRK14285, chaperone protein DnaJ; Provisional 7e-75
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provisional 2e-74
PRK14296372 PRK14296, PRK14296, chaperone protein DnaJ; Provisional 1e-62
KOG0712337 KOG0712, KOG0712, KOG0712, Molecular chaperone (DnaJ su 1e-59
PRK14288369 PRK14288, PRK14288, chaperone protein DnaJ; Provisional 7e-55
PTZ00037421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provision 7e-52
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein CbpA; Pr 2e-44
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provisional 8e-36
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with C-te 1e-129
KOG0715288 KOG0715, KOG0715, KOG0715, Molecular chaperone (DnaJ su 8e-48
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Posttran 5e-17
KOG0713336 KOG0713, KOG0713, KOG0713, Molecular chaperone (DnaJ su 6e-43
KOG0714306 KOG0714, KOG0714, KOG0714, Molecular chaperone (DnaJ su 2e-21
pfam01556101 pfam01556, DnaJ_C, DnaJ C terminal region 1e-32
TIGR03835871 TIGR03835, termin_org_DnaJ, terminal organelle assembly 5e-04
pfam0022663 pfam00226, DnaJ, DnaJ domain 7e-26
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homology dom 6e-20
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 2e-19
KOG0716279 KOG0716, KOG0716, KOG0716, Molecular chaperone (DnaJ su 1e-18
KOG0717 508 KOG0717, KOG0717, KOG0717, Molecular chaperone (DnaJ su 5e-16
KOG0718 546 KOG0718, KOG0718, KOG0718, Molecular chaperone (DnaJ su 1e-15
KOG0719264 KOG0719, KOG0719, KOG0719, Molecular chaperone (DnaJ su 2e-14
KOG0722329 KOG0722, KOG0722, KOG0722, Molecular chaperone (DnaJ su 3e-13
KOG0550486 KOG0550, KOG0550, KOG0550, Molecular chaperone (DnaJ su 5e-11
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec63 [I 4e-10
KOG0720490 KOG0720, KOG0720, KOG0720, Molecular chaperone (DnaJ su 8e-10
KOG1789 2235 KOG1789, KOG1789, KOG1789, Endocytosis protein RME-8, c 2e-07
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surface a 4e-07
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Tr 9e-07
PRK00294173 PRK00294, hscB, co-chaperone HscB; Provisional 4e-06
PRK03578176 PRK03578, hscB, co-chaperone HscB; Provisional 1e-05
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone protein; 1e-05
PRK05014171 PRK05014, hscB, co-chaperone HscB; Provisional 2e-05
PRK01356166 PRK01356, hscB, co-chaperone HscB; Provisional 3e-05
KOG1150250 KOG1150, KOG1150, KOG1150, Predicted molecular chaperon 4e-05
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Postt 7e-04
KOG0568342 KOG0568, KOG0568, KOG0568, Molecular chaperone (DnaJ su 9e-04
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Postt 0.001
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle assembly 2e-21
KOG0691296 KOG0691, KOG0691, KOG0691, Molecular chaperone (DnaJ su 6e-20
KOG0624504 KOG0624, KOG0624, KOG0624, dsRNA-activated protein kina 4e-17
KOG0721230 KOG0721, KOG0721, KOG0721, Molecular chaperone (DnaJ su 5e-14
pfam0068479 pfam00684, DnaJ_CXXCXGXG, DnaJ central domain (4 repeat 1e-17
KOG2813406 KOG2813, KOG2813, KOG2813, Predicted molecular chaperon 9e-05
pfam01556101 pfam01556, DnaJ_C, DnaJ C terminal region 0.002
>gnl|CDD|182712 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|162815 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184602 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172782 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172789 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184598 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184600 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184609 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184606 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184607 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184605 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184601 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172769 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184608 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172777 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184610 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172784 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|35931 KOG0712, KOG0712, KOG0712, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|173334 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|184613 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|30832 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35934 KOG0715, KOG0715, KOG0715, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|32396 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35932 KOG0713, KOG0713, KOG0713, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35933 KOG0714, KOG0714, KOG0714, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|144958 pfam01556, DnaJ_C, DnaJ C terminal region Back     alignment and domain information
>gnl|CDD|163547 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|143981 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|128567 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|35935 KOG0716, KOG0716, KOG0716, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35936 KOG0717, KOG0717, KOG0717, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35937 KOG0718, KOG0718, KOG0718, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35938 KOG0719, KOG0719, KOG0719, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35941 KOG0722, KOG0722, KOG0722, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35770 KOG0550, KOG0550, KOG0550, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|34966 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|35939 KOG0720, KOG0720, KOG0720, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|37000 KOG1789, KOG1789, KOG1789, Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport, Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|34866 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|166894 PRK00294, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|179598 PRK03578, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|181850 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|179914 PRK05014, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|167217 PRK01356, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|36365 KOG1150, KOG1150, KOG1150, Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31274 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35788 KOG0568, KOG0568, KOG0568, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31274 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|163547 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|35910 KOG0691, KOG0691, KOG0691, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35843 KOG0624, KOG0624, KOG0624, dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|35940 KOG0721, KOG0721, KOG0721, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|144326 pfam00684, DnaJ_CXXCXGXG, DnaJ central domain (4 repeats) Back     alignment and domain information
>gnl|CDD|38024 KOG2813, KOG2813, KOG2813, Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|144958 pfam01556, DnaJ_C, DnaJ C terminal region Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 384 molecular chaperone protein DnaJ [Candidatus Liberibact
TIGR02349386 DnaJ_bact chaperone protein DnaJ; InterPro: IPR012724 M 100.0
PRK10767376 chaperone protein DnaJ; Provisional 100.0
COG0484371 DnaJ DnaJ-class molecular chaperone with C-terminal Zn 100.0
PTZ00037422 DnaJ_C chaperone protein; Provisional 100.0
PRK10266306 curved DNA-binding protein CbpA; Provisional 100.0
KOG0712337 consensus 100.0
KOG0713336 consensus 100.0
KOG0715288 consensus 100.0
KOG0714306 consensus 99.97
pfam01556101 DnaJ_C DnaJ C terminal region. This family consists of 99.92
KOG0691296 consensus 99.91
KOG0716279 consensus 99.9
KOG0717 508 consensus 99.88
KOG0718 546 consensus 99.87
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslational 99.87
KOG0719264 consensus 99.84
KOG0624504 consensus 99.84
KOG0550486 consensus 99.81
pfam0022663 DnaJ DnaJ domain. DnaJ domains (J-domains) are associat 99.8
KOG0721230 consensus 99.71
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.7
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat shock pr 99.69
KOG0722329 consensus 99.62
KOG0720490 consensus 99.62
PRK09430269 djlA Dna-J like membrane chaperone protein; Provisional 99.59
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intracellul 99.5
PRK01356166 hscB co-chaperone HscB; Provisional 99.02
PRK03578176 hscB co-chaperone HscB; Provisional 98.94
PRK05014171 hscB co-chaperone HscB; Provisional 98.93
PTZ00100114 DnaJ chaperone protein; Provisional 98.89
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Translation, 98.89
KOG1789 2235 consensus 98.86
KOG1150250 consensus 98.83
PRK00294173 hscB co-chaperone HscB; Provisional 98.79
PRK01773173 hscB co-chaperone HscB; Provisional 98.75
KOG0568342 consensus 98.49
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttranslation 97.59
KOG0723112 consensus 97.57
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttranslation 96.4
KOG3192168 consensus 96.1
KOG0724335 consensus 94.4
TIGR00714159 hscB Fe-S protein assembly co-chaperone HscB; InterPro: 94.19
TIGR02642270 phage_xxxx uncharacterized phage protein; InterPro: IPR 93.82
TIGR02349386 DnaJ_bact chaperone protein DnaJ; InterPro: IPR012724 M 99.51
COG0484371 DnaJ DnaJ-class molecular chaperone with C-terminal Zn 99.26
PRK10767376 chaperone protein DnaJ; Provisional 99.08
PTZ00037422 DnaJ_C chaperone protein; Provisional 98.22
pfam0068479 DnaJ_CXXCXGXG DnaJ central domain (4 repeats). The cent 99.07
COG1107 715 Archaea-specific RecJ-like exonuclease, contains DnaJ-t 95.9
KOG2813406 consensus 94.75
pfam0068479 DnaJ_CXXCXGXG DnaJ central domain (4 repeats). The cent 92.91
PRK10266306 curved DNA-binding protein CbpA; Provisional 98.14
COG1107 715 Archaea-specific RecJ-like exonuclease, contains DnaJ-t 97.54
pfam01556101 DnaJ_C DnaJ C terminal region. This family consists of 97.42
KOG0712337 consensus 96.99
TIGR01213450 TIGR01213 conserved hypothetical protein TIGR01213; Int 96.9
KOG2813406 consensus 96.46
KOG0431453 consensus 96.53
TIGR02642270 phage_xxxx uncharacterized phage protein; InterPro: IPR 95.78
PRK00349 944 uvrA excinuclease ABC subunit A; Reviewed 91.05
PRK00635 1809 excinuclease ABC subunit A; Provisional 90.13
>TIGR02349 DnaJ_bact chaperone protein DnaJ; InterPro: IPR012724 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0712 consensus Back     alignment and domain information
>KOG0713 consensus Back     alignment and domain information
>KOG0715 consensus Back     alignment and domain information
>KOG0714 consensus Back     alignment and domain information
>pfam01556 DnaJ_C DnaJ C terminal region Back     alignment and domain information
>KOG0691 consensus Back     alignment and domain information
>KOG0716 consensus Back     alignment and domain information
>KOG0717 consensus Back     alignment and domain information
>KOG0718 consensus Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0719 consensus Back     alignment and domain information
>KOG0624 consensus Back     alignment and domain information
>KOG0550 consensus Back     alignment and domain information
>pfam00226 DnaJ DnaJ domain Back     alignment and domain information
>KOG0721 consensus Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG0722 consensus Back     alignment and domain information
>KOG0720 consensus Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Back     alignment and domain information
>KOG1150 consensus Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0568 consensus Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Back     alignment and domain information
>KOG0724 consensus Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB; InterPro: IPR004640 This family describes the small subunit, Hsc20 (20K heat shock cognate protein) of a pair of proteins Hsc66-Hsc20, related to the DnaK-DnaJ heat shock proteins, which also serve as molecular chaperones Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein; InterPro: IPR013464 This uncharacterised protein is found in prophage regions of Shewanella oneidensis MR-1, Vibrio vulnificus (strain YJ016), Yersinia pseudotuberculosis IP 32953, and Aeromonas hydrophila ATCC7966 Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ; InterPro: IPR012724 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>pfam00684 DnaJ_CXXCXGXG DnaJ central domain (4 repeats) Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2813 consensus Back     alignment and domain information
>pfam00684 DnaJ_CXXCXGXG DnaJ central domain (4 repeats) Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam01556 DnaJ_C DnaJ C terminal region Back     alignment and domain information
>KOG0712 consensus Back     alignment and domain information
>TIGR01213 TIGR01213 conserved hypothetical protein TIGR01213; InterPro: IPR005912 The members of this family of conserved hypothetical proteins show a low level of similarity to several predicted RNA pseudouridine synthases Back     alignment and domain information
>KOG2813 consensus Back     alignment and domain information
>KOG0431 consensus Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein; InterPro: IPR013464 This uncharacterised protein is found in prophage regions of Shewanella oneidensis MR-1, Vibrio vulnificus (strain YJ016), Yersinia pseudotuberculosis IP 32953, and Aeromonas hydrophila ATCC7966 Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target384 molecular chaperone protein DnaJ [Candidatus Liberibact
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 5e-34
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 6e-34
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-33
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 3e-31
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 7e-31
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 3e-30
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 6e-30
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 3e-29
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 4e-29
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 4e-29
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 1e-28
2och_A73 J-Domain Of Dnj-12 From Caenorhabditis Elegans Leng 2e-27
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 3e-26
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 4e-26
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 9e-22
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 5e-18
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 8e-27
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 2e-25
2q2g_A180 Crystal Structure Of Dimerization Domain Of Hsp40 F 7e-21
3agx_A181 Crystal Structure Of Human Hsp40 Hdj1 Peptide-Bindi 1e-17
3agz_A190 Crystal Structure Of Human Hsp40 Hdj1 Peptide-Bindi 1e-17
2qld_A183 Human Hsp40 Hdj1 Length = 183 2e-17
1nlt_A248 The Crystal Structure Of Hsp40 Ydj1 Length = 248 1e-16
>gi|157834231|pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
 Score =  149 bits (377), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 41/75 (54%), Positives = 56/75 (74%)

Query: 2  KKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQ 61
           K D+Y++LG+ + A +R+++ A++ LAMKYHPD+N+ D EA+ KF +I EAYEVL D Q
Sbjct: 1  AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQ 60

Query: 62 KRALYDQGGHEALEY 76
          KRA YDQ GH A E 
Sbjct: 61 KRAAYDQYGHAAFEQ 75


>gi|157830433|pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>gi|159162127|pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>gi|157831304|pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>gi|159163949|pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>gi|159164245|pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>gi|159164396|pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>gi|159164236|pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>gi|159163954|pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>gi|159163963|pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>gi|159163951|pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>gi|126031509|pdb|2OCH|A Chain A, J-Domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>gi|122921354|pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>gi|329665912|pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>gi|294979280|pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>gi|159164851|pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>gi|291463722|pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>gi|329665913|pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>gi|149243574|pdb|2Q2G|A Chain A, Crystal Structure Of Dimerization Domain Of Hsp40 From Cryptosporidium Parvum, Cgd2_1800 Length = 180 Back     alignment and structure
>gi|323714381|pdb|3AGX|A Chain A, Crystal Structure Of Human Hsp40 Hdj1 Peptide-Binding Domain Length = 181 Back     alignment and structure
>gi|323714388|pdb|3AGZ|A Chain A, Crystal Structure Of Human Hsp40 Hdj1 Peptide-Binding Domain Complexed With A C-Terminal Peptide Of Hsp70 Length = 190 Back     alignment and structure
>gi|194319948|pdb|2QLD|A Chain A, Human Hsp40 Hdj1 Length = 183 Back     alignment and structure
>gi|42543071|pdb|1NLT|A Chain A, The Crystal Structure Of Hsp40 Ydj1 Length = 248 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target384 molecular chaperone protein DnaJ [Candidatus Liberibact
3lz8_A329 Putative chaperone DNAJ; structure genomics, structural 7e-73
1nlt_A248 Protein YDJ1, mitochondrial protein import protein MAS5 9e-60
3i38_A109 Putative chaperone DNAJ; structural genomics, PSI-2, pr 3e-29
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; beta s 1e-20
3i38_A109 Putative chaperone DNAJ; structural genomics, PSI-2, pr 0.004
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative (fra 7e-28
2qld_A183 DNAJ homolog subfamily B member 1; primarily beta sheet 9e-27
1c3g_A170 Heat shock protein 40; beta sheets, short helices; 2.70 1e-24
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chaperone 1e-23
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapi 6e-22
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structural ge 8e-21
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydr 2e-19
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR {Bos t 6e-19
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, antitum 6e-18
1faf_A79 Large T antigen; J domain, HPD motif, anti-parallel hai 3e-17
2yua_A99 Williams-beuren syndrome chromosome region 18 protein; 4e-17
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone; 1.8 5e-17
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, 1e-16
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein, str 3e-16
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chaperone, 5e-16
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; chaperon 1e-15
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, helix 1e-15
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chaperone 2e-15
3hho_A174 CO-chaperone protein HSCB homolog; structural genomics, 4e-15
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain, AN 7e-15
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precursor; str 1e-14
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national 3e-14
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural genomic 4e-14
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, stru 4e-14
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, struct 6e-14
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chaperone 1e-12
2guz_A71 Mitochondrial import inner membrane translocase subunit 4e-12
2guz_B65 Mitochondrial import inner membrane translocase subunit 6e-05
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-bin 6e-23
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, beta-ha 1e-20
1m1q_A91 Small tetraheme cytochrome C; atomic structure of oxidi 5e-15
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein folding, DN 9e-22
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chaperone, 7e-16
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein structure initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
 Score =  269 bits (689), Expect = 7e-73
 Identities = 100/371 (26%), Positives = 162/371 (43%), Gaps = 68/371 (18%)

Query: 1   MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDP 60
           M+  D+Y +LG+      + +KTA+R LA KYHPD +  + +A+ KF  ++EA+EVL+D 
Sbjct: 25  MELKDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVS-KENDAEAKFKDLAEAWEVLKDE 83

Query: 61  QKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSST 120
           Q+RA YDQ      + G   Q         Y   DF ++F  +FG      ++++R    
Sbjct: 84  QRRAEYDQLWQHRNDPGFGRQRQTHE--QSYSQQDFDDIFSSMFG-----QQAHQRRRQH 136

Query: 121 GEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAKPGTNPMDCNICNGSGRV 180
              G DL   + + LEE  +                      +  T   +  + N     
Sbjct: 137 AARGHDLEIEVAVFLEETLAE---------------------QTRTISYNLPVYNV---- 171

Query: 181 YTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS 240
                                           G       K L+V +P GV DG RIRL 
Sbjct: 172 -------------------------------FGMIESETPKTLNVKIPAGVVDGQRIRLK 200

Query: 241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATH 300
           G+G  G  GG  GDL++ I +  H  F   G +L   +P++    A+G    V TL  + 
Sbjct: 201 GQGTPGENGGPNGDLWLVIHIAPHPLFDIVGHNLEIVLPLAPWEAALGAKVTVPTLKESI 260

Query: 301 SRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQIS 360
             +T+P G+Q G++ R+KGKG+   +    GDL+  +++  P K +++ REL ++     
Sbjct: 261 -LLTVPPGSQAGQRLRIKGKGLV--SKTHTGDLFAVIKIVMPTKPDEKARELWQQLAAAE 317

Query: 361 SQDNNPQSTGF 371
           +   +P+ T  
Sbjct: 318 A-SFDPRKTWG 327


>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248 Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Length = 109 Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Length = 121 Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Length = 109 Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Length = 180 Back     alignment and structure
>2qld_A DNAJ homolog subfamily B member 1; primarily beta sheets, chaperone; 2.70A {Homo sapiens} Length = 183 Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Length = 170 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, PSI-2, protein structure initiative; 1.86A {Caenorhabditis elegans} Length = 73 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulator/viral protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphorylation; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>3hho_A CO-chaperone protein HSCB homolog; structural genomics, IDP01304, center for structural genomics of infectious diseases, CSGI; 2.15A {Vibrio cholerae} Length = 174 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precursor; structural genomics medical relevance, protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, protein structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 65 Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Length = 79 Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1m1q_A Small tetraheme cytochrome C; atomic structure of oxidized tetraheme cytochrome C, electron transport; HET: HEM; 0.97A {Shewanella oneidensis mr-1} SCOP: a.138.1.3 PDB: 1m1p_A* 1m1r_A* Length = 91 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target384 molecular chaperone protein DnaJ [Candidatus Liberibact
3lz8_A329 Putative chaperone DNAJ; structure genomics, structural 100.0
1nlt_A248 Protein YDJ1, mitochondrial protein import protein MAS5 100.0
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative (fra 100.0
2qld_A183 DNAJ homolog subfamily B member 1; primarily beta sheet 100.0
1c3g_A170 Heat shock protein 40; beta sheets, short helices, chap 100.0
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein folding, DN 99.95
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, 99.89
3i38_A109 Putative chaperone DNAJ; structural genomics, PSI-2, pr 99.9
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; beta s 99.84
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chaperone 99.89
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chaperone, 99.89
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chaperone, 99.88
2yua_A99 Williams-beuren syndrome chromosome region 18 protein; 99.88
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapi 99.87
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, stru 99.86
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, struct 99.86
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, helix 99.85
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone; 1.8 99.84
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural genomic 99.84
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chaperone 99.83
3hho_A174 CO-chaperone protein HSCB homolog; structural genomics, 99.83
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chaperone 99.83
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, antitum 99.83
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national 99.82
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precursor; str 99.82
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein, str 99.81
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structural ge 99.71
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydr 99.7
1faf_A79 Large T antigen; J domain, HPD motif, anti-parallel hai 99.65
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR {Bos t 99.51
2guz_A71 Mitochondrial import inner membrane translocase subunit 99.49
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; chaperon 99.44
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain, AN 99.44
2guz_B65 Mitochondrial import inner membrane translocase subunit 99.15
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, RAS- 98.23
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, beta-ha 99.71
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-bin 99.24
1nlt_A248 Protein YDJ1, mitochondrial protein import protein MAS5 98.16
2qld_A183 DNAJ homolog subfamily B member 1; primarily beta sheet 98.08
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative (fra 97.95
1c3g_A170 Heat shock protein 40; beta sheets, short helices, chap 97.91
3lz8_A329 Putative chaperone DNAJ; structure genomics, structural 97.52
2k3v_A86 Tetraheme cytochrome C-type; multihaem cytochromes, red 98.08
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, beta-ha 95.27
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-bin 93.22
3i38_A109 Putative chaperone DNAJ; structural genomics, PSI-2, pr 97.75
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; beta s 97.48
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator protei 90.21
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) seque 90.05
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein structure initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
Probab=100.00  E-value=0  Score=547.38  Aligned_cols=303  Identities=33%  Similarity=0.596  Sum_probs=246.1

Q ss_pred             CCCCCCHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             98745248718799889999999999999997569988798799999999999876099899999877248765314555
Q gi|254780638|r    1 MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKEKFAQISEAYEVLRDPQKRALYDQGGHEALEYGAQS   80 (384)
Q Consensus         1 ~~~~DyY~iLGV~~~As~~eIKkAYrklA~k~HPDkn~~d~~A~ekFkeI~eAYevLsD~~kR~~YD~~G~~~~~~~~~~   80 (384)
                      |+.+|||+||||+++||++||||||||||+|||||||+ +++|++|||+|+|||||||||+||++||++|..+...+...
T Consensus        25 m~~kDyY~iLGV~~~AS~~EIKkAYRkLA~k~HPDkn~-~~~AeekFkeI~eAYevLsD~~kR~~YD~~g~~~~~~~~~~  103 (329)
T 3lz8_A           25 MELKDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSK-ENDAEAKFKDLAEAWEVLKDEQRRAEYDQLWQHRNDPGFGR  103 (329)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CCCCCCHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCC-CCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCC
T ss_conf             66477789809999979999999999999986889897-94699999999999972103445555666653035877675


Q ss_pred             CCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCCCCCCCCCCCCEECCCCCC
Q ss_conf             66521001443222222334443561013760344422221222221123222100000135544455443100023432
Q gi|254780638|r   81 QGAGGFGAGMYGNSDFSELFEGIFGGIMGSGRSYKRSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGS  160 (384)
Q Consensus        81 ~~~~~~~~~~~~~~~~~d~f~~~f~~~~~~~~~~~~~~~~~~~~~d~~~~~~islee~~~G~~~~i~~~~~~~C~~C~G~  160 (384)
                      ..  .+..+.....++.++|..+|+.....     .......++.++...+.+++++.+.|....+.+..          
T Consensus       104 ~~--~~~~~~~~~~~~~d~~~~~~~~~~~~-----~~~~~~~~g~~~~~~~~~~~~~~~~g~~~~~~~~~----------  166 (329)
T 3lz8_A          104 QR--QTHEQSYSQQDFDDIFSSMFGQQAHQ-----RRRQHAARGHDLEIEVAVFLEETLAEQTRTISYNL----------  166 (329)
T ss_dssp             ----------------------------------------CCCCCCEEEEECCCTTGGGSCEEEEEEEEE----------
T ss_pred             CC--CCCCCCCCCCCCCCCCCCCCCCCCCC-----CCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCC----------
T ss_conf             45--65677667888544330304676555-----55566667887033112221101245532222124----------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCEEEECCCCCCCCCCEECCCCCCCHHHHHCCCCCCCEEEC
Q ss_conf             25788542103553101121001100124686166656554698354120011210001110000011001148501203
Q gi|254780638|r  161 GAKPGTNPMDCNICNGSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKLLSVNVPPGVDDGTRIRLS  240 (384)
Q Consensus       161 g~~~~~~~~~C~~C~G~G~~~~~~~~~~~~~~~C~~C~G~g~i~~~~c~~C~G~g~~~~~~~~~I~Ip~G~~~G~~i~~~  240 (384)
                                                                    .|..|.+.+...+.++++|.||||+.+|++|+++
T Consensus       167 ----------------------------------------------~~~~~~~~~~~~~~~~~~v~ip~G~~~G~~i~~~  200 (329)
T 3lz8_A          167 ----------------------------------------------PVYNVFGMIESETPKTLNVKIPAGVVDGQRIRLK  200 (329)
T ss_dssp             ----------------------------------------------EECCSCC-CCEEEEEEEEEEECTTCCTTCEEEES
T ss_pred             ----------------------------------------------CCCCCCCCEEECCCCEECCCCCCCCCCCEEEEEC
T ss_conf             ----------------------------------------------6534467312026743788679898598289989


Q ss_pred             CCCCCCCCCCCCCCEEEEEECCCCCCEEEECCCCEEEEEECHHHHCCCCEEEEECCCCCCCCEEECCCCCCCCEEEECCE
Q ss_conf             67765678841664157531034684286414846999846665135424885167888231011685177887898881
Q gi|254780638|r  241 GEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTIPEGTQTGKQFRLKGK  320 (384)
Q Consensus       241 g~G~~~~~~~~~GDl~i~i~~~~h~~f~r~g~dL~~~~~I~l~eal~G~~~~i~tldG~~i~i~i~~~~~~~~~~~i~g~  320 (384)
                      |+|++.+.+..+|||+|+|.+++|+.|+|+|+||+++++|++++||+|+++.|+||+|. +.|+||++++||++++|+|+
T Consensus       201 g~G~~~~~~~~~GDl~i~i~~~~~~~f~R~g~dL~~~~~I~l~eAl~G~~~~i~tldg~-~~v~ip~g~~~G~~~ri~Gk  279 (329)
T 3lz8_A          201 GQGTPGENGGPNGDLWLVIHIAPHPLFDIVGHNLEIVLPLAPWEAALGAKVTVPTLKES-ILLTVPPGSQAGQRLRIKGK  279 (329)
T ss_dssp             SCSCCC---CCCCCEEEEECCCCCSSCEEETTEEEEEEEECHHHHHHCEEEEECCSSSC-EEEEECTTCCTTCEEEETTC
T ss_pred             CEECCCCCCCCCCCEEEEEEEECCCCCEECCCCEEEEEEECCHHHCCCCCEEEECCCCC-EEEEECCCCCCCCEEEECCC
T ss_conf             70335878887875799999824775232277337888866322036993176678987-89987989899968998898


Q ss_pred             ECCCCCCCCCCCEEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHH
Q ss_conf             0200689886527999999929899999999999999872888881005889
Q gi|254780638|r  321 GMPVINSGRKGDLYVQVQVETPQKLNKRQRELLEEFEQISSQDNNPQSTGFF  372 (384)
Q Consensus       321 G~p~~~~~~rGdl~i~~~v~~P~~Ls~~qk~ll~~l~~~~~~~~~~~~~~~~  372 (384)
                      |||.  .+.||||||+|+|+||++||++||+||++|+++.. ..+|++ +||
T Consensus       280 G~p~--~~~rGDL~V~~~V~~P~~ls~~qkell~~l~~~~~-~~~p~~-~~~  327 (329)
T 3lz8_A          280 GLVS--KTHTGDLFAVIKIVMPTKPDEKARELWQQLAAAEA-SFDPRK-TWG  327 (329)
T ss_dssp             SCBC--SSCBCCEEEEEEECCCSSCCHHHHHHHHHHHHHTT-TCCTTT-TC-
T ss_pred             CCCC--CCCCCCEEEEEEEECCCCCCHHHHHHHHHHHHCCC-CCCCHH-HHC
T ss_conf             9899--99988989999998699999999999999985136-899414-321



>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2qld_A DNAJ homolog subfamily B member 1; primarily beta sheets, chaperone; 2.70A {Homo sapiens} Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, protein structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hho_A CO-chaperone protein HSCB homolog; structural genomics, IDP01304, center for structural genomics of infectious diseases, CSGI; 2.15A {Vibrio cholerae} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, PSI-2, protein structure initiative; 1.86A {Caenorhabditis elegans} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precursor; structural genomics medical relevance, protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulator/viral protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphorylation; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>2qld_A DNAJ homolog subfamily B member 1; primarily beta sheets, chaperone; 2.70A {Homo sapiens} Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein structure initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>2k3v_A Tetraheme cytochrome C-type; multihaem cytochromes, redox proteins, electron transport, iron, metal-binding, periplasm, transport; HET: HEM; NMR {Shewanella frigidimarina} Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibitory protein; transcription regulation, Trp RNA-binding attenuation protein; 2.8A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) sequence RTPA; anti-trap, tryptophan RNA-binding attenuation protein; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 384 molecular chaperone protein DnaJ [Candidatus Liberibact
d1c3ga290 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's 1e-22
d1nlta280 b.4.1.1 (A:258-337) Mitochondrial protein import protei 3e-19
d1nlta174 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein imp 2e-08
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Esc 9e-21
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 5e-17
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} 9e-17
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 9e-17
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {E 2e-15
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo 1e-14
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J domain { 1e-14
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J domain { 2e-13
d1exka_79 g.54.1.1 (A:) Cysteine-rich domain of the chaperone pro 3e-17
d1m1qa_90 a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate 1e-14
d1nlta374 g.54.1.1 (A:139-212) Mitochondrial protein import prote 6e-14
d1qo8a1101 a.138.1.3 (A:2-102) Flavocytochrome c3 (respiratory fum 0.002
d1c3ga180 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's 1e-14
d1nlta174 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein imp 4e-07
d1c3ga180 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's 1e-05
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 90 Back     information, alignment and structure

class: All beta proteins
fold: HSP40/DnaJ peptide-binding domain
superfamily: HSP40/DnaJ peptide-binding domain
family: HSP40/DnaJ peptide-binding domain
domain: Heat shock protein 40 Sis1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  101 bits (252), Expect = 1e-22
 Identities = 27/89 (30%), Positives = 47/89 (52%), Gaps = 1/89 (1%)

Query: 267 FKRDGADLYCTVPISIVTVAMGGTFDVATLDATHSRVTIPEGTQTGKQFRLKGKGMPVI- 325
           FKRDG DL  T+P+S     +G +  + T+D     ++  +  Q  +     G+GMP   
Sbjct: 2   FKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPK 61

Query: 326 NSGRKGDLYVQVQVETPQKLNKRQRELLE 354
           N  ++G+L V+ +V+ P  LN  Q+  ++
Sbjct: 62  NPSQRGNLIVKYKVDYPISLNDAQKRAID 90


>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 Back     information, alignment and structure
>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure