255764494

255764494

molecular chaperone DnaK

GeneID in NCBI database:8209638Locus tag:CLIBASIA_02620
Protein GI in NCBI database:255764494Protein Accession:YP_003065050.2
Gene range:-(631010, 632968)Protein Length:652aa
Gene description:molecular chaperone DnaK
COG prediction:[O] Molecular chaperone
KEGG prediction:dnaK; molecular chaperone DnaK; K04043 molecular chaperone DnaK
SEED prediction:Chaperone protein DnaK
Pathway involved in KEGG:RNA degradation [PATH:las03018]
Subsystem involved in SEED:Protein chaperones;
Heat shock dnaK gene cluster extended
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650--
MSKVIGIDLGTTNSCVAIMDGKNVRVIENAEGTRTTPSMVGFTDEGERLVGQPAKRQAVTNPSNTIFAAKRLIGRRFNDSTVAKDASLVPFKIVEGKGGDAWIEAQGKQYSPSQISAIVLQKMKETAESFLGETVSKAVITVPAYFNDAQRQATKDAGRIAGLDVLRIINEPTAAALAYGLDKKDARTVIVFDFGGGTFDVSLLEMGDGVFEVKATNGDTFLGGEDFDSCLVEHICDTFKKENGIDLKQDTLALQRLKEAAEKAKIELSSTSQTEINLPFISANSAGAQHLNMKLTRAQFERLVNHLIQKTVEPCKKCLQDAGLSPSDIDEVVLVGGMTRMPKIQQSVQDFFNKSPSKGVNPDEVVAMGAAIQAGVLQGDVKDLLLLDVTPLSLGIETLGGVFTSIIDRNSTIPTKKSQVFSTAADNQSAVSIRIGQGERKMFADNKLLGQFDLVGIPPAPKGTPQIEVAFDIDANGIVQVSALDKGTGKAQQISIQASGGLSSEDIEKMVKDAEMNAEMDKKRREAVETKNHAESLIYSTEQSLREHGDKIAEAEQKSIRESIDALRTLLNDADPDESKIKEATQKLMEVSMNLGKAIYEAQAKKDAAADTATADTTAKTDVKDDVVDADYEEIKDDEKDKKKLSIFLSRT
cccEEEEEEccccEEEEEEEcccEEEEEcccccccccEEEEEcccccEEEcHHHHHHHcccccHHHHHHHHHccccccccHHHHHHcccccEEEEccccccEEEccccEEcHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEccHHHHHHHccccccccEEEEEEccccEEEEEEEEEcccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccEEEEEccccccHHHHHHHHHHcccccEEccccHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEEEEEccEEEEEEcccccccccEEEEEEEccccccEEEEEEEcccccccccccEEEEEEEcccccccccccEEEEEEEEcccEEEEEEEEEcccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEcEEEEEcccccccEEEEEEEEcc
ccccEEEEEcccEEEEEEEEccEEEEcccccccccEEccEEEcccccEEEcHHHHccccccHHHEEccHHHccccccccHHHHHHHHHcccEEEEEcccccccccEEEEEcHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEHHHHHHHHcccccccEEEEEEEEEccccEEEEEEEEEccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccEEEEEEcHcccccccccccEccEEHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHccEEEEEcHHHHcHHHHHHHHHccccccEcccccccHHHHHHHHHHHHHcccHHHcccccEccccEEEEEcccEEEEEEccccEccEEEEEEEEEccccccEEEEEEEEccccEHHHcEEEEEEEEEcccccccccccEEEEEEEcccccEEEEEEEcccccEEEEEEcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccHcHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHEEccccHcccEEEEEEccc
mskvigidlgttnscvaimdgknvrvienaegtrttpsmvgftdegerlvgqpakrqavtnpsntIFAAKRLIgrrfndstvakdaslvpfkivegkggdawieaqgkqyspsqISAIVLQKMKETAESFLGETVSKAVITVPAYFNDAQRQATKDAGRIAGLDVLRIINEPTAAALAYgldkkdarTVIVFDFGGGTFDVSLLEMGDGVfevkatngdtflggedfdsCLVEHICDTfkkengidlkQDTLALQRLKEAAEKAKIElsstsqteinlpfisansagaQHLNMKLTRAQFERLVNHLIQKTVEPCKkclqdaglspsdidEVVLVggmtrmpkiQQSVQDFfnkspskgvnpdEVVAMGAAIQAGVLQGDVKDLLLLDVTPLSLGIETLGGVFtsiidrnstiptkksqvfstaadnqsaVSIRigqgerkmfadnkllgqfdlvgippapkgtpqiEVAFdidangivqvsaldkgtgkaQQISIqasgglsseDIEKMVKDAEMNAEMDKKRREAVETKNHAESLIYSTEQSLREHGDKIAEAEQKSIRESIDALRTLlndadpdesKIKEATQKLMEVSMNLGKAIYEAQAKKdaaadtatadttaktdvkddvvdADYEEIKDDEKDKKKLSIFLSRT
mskvigidlgttnscvaimdgknvrvienaegtrttpsmvgftdEGERLVGqpakrqavtnpsnTIFAAKRLIGRRfndstvakdaslvpfKIVEGKGGDAWIEAQGKQYSPSQISAIVLQKMKETAESFLGETVSKAVITVPAYFNDAQRQATKDAGRIAGLDVLRIINEPTAAALAYGLDKKDARTVIVFDFGGGTFDVSLLEMGDGVFEVKATNGDTFLGGEDFDSCLVEHICDTFkkengidlkQDTLALQRLKEAAEKAKielsstsqteinlPFISANSAGAQHLNMKLTRAQFERLVNHLIQKTVEPCKKClqdaglspsdIDEVVLVGGMTRMPKIQQSVQDFFNKSPSKGVNPDEVVAMGAAIQAGVLQGDVKDLLLLDVTPLSLGIETLGGVFTSIIDRnstiptkksqvfstaadnqsaVSIRIGQGERKMFADNKLLGQFDLVGIPPAPKGTPQIEVAFDIDANGIVQVSALDKGTGKAQQIsiqasgglssedIEKMVKDAEMNAEMDKKRREavetknhaesliysteqslrEHGDKIAEAEQKSIRESIDALRTllndadpdesKIKEATQKLMEVSMNLGKAIYEAQAKKDAaadtatadttaktdvkddvvdadyeeikddekdkkklsiflsrt
MSKVIGIDLGTTNSCVAIMDGKNVRVIENAEGTRTTPSMVGFTDEGERLVGQPAKRQAVTNPSNTIFAAKRLIGRRFNDSTVAKDASLVPFKIVEGKGGDAWIEAQGKQYSPSQISAIVLQKMKETAESFLGETVSKAVITVPAYFNDAQRQATKDAGRIAGLDVLRIINEPTAAALAYGLDKKDARTVIVFDFGGGTFDVSLLEMGDGVFEVKATNGDTFLGGEDFDSCLVEHICDTFKKENGIDLKQDTLALQRLKEAAEKAKIELSSTSQTEINLPFISANSAGAQHLNMKLTRAQFERLVNHLIQKTVEPCKKCLQDAGLSPSDIDEVVLVGGMTRMPKIQQSVQDFFNKSPSKGVNPDEVVAMGAAIQAgvlqgdvkdlllldvtplslgIETLGGVFTSIIDRNSTIPTKKSQVFSTAADNQSAVSIRIGQGERKMFADNKLLGQFDLVGIPPAPKGTPQIEVAFDIDANGIVQVSALDKGTGKAQQISIQASGGLSSEDIEKMVKDAEMNAEMDKKRREAVETKNHAESLIYSTEQSLREHGDKIAEAEQKSIRESIDALRTLLNDADPDESKIKEATQKLMEVSMNLGKAIYEAQakkdaaadtatadttaktdvkddvvdadyeeikddekdkkkLSIFLSRT
*SKVIGIDLGTTNSCVAIMDGKNVRVIENAEGTRTTPSMVGFTDEGERLVGQPAKRQAVTNPSNTIFAAKRLIGRRFNDSTVAKDASLVPFKIVEGKGGDAWIEAQGKQYSPSQISAIVLQKMKETAESFLGETVSKAVITVPAYFNDAQRQATKDAGRIAGLDVLRIINEPTAAALAYGLDKKDARTVIVFDFGGGTFDVSLLEMGDGVFEVKATNGDTFLGGEDFDSCLVEHICDTFKKENGIDLKQDTLALQRLKEAAEKAKIELSSTSQTEINLPFISANSAGAQHLNMKLTRAQFERLVNHLIQKTVEPCKKCLQDAGLSPSDIDEVVLVGGMTRMPKIQQSVQDFFNKSPSKGVNPDEVVAMGAAIQAGVLQGDVKDLLLLDVTPLSLGIETLGGVFTSIIDRNSTIPTKKSQVFSTAADNQSAVSIRIGQGERKMFADNKLLGQFDLVGIPPAPKGTPQIEVAFDIDANGIVQVSALDKG*GK***************DIEKMVKDA************AVETKNHAESLIYSTEQS*************KSIRESIDA****************E*TQKLMEVSM*************************************DYEEI**********SIFLSRT
MSKVIGIDLGTTNSCVAIMDGKNVRVIENAEGTRTTPSMVGFTDEGERLVGQPAKRQAVTNPSNTIFAAKRLIGRRFNDSTVAKDASLVPFKIVEGKGGDAWIEAQGKQYSPSQISAIVLQKMKETAESFLGETVSKAVITVPAYFNDAQRQATKDAGRIAGLDVLRIINEPTAAALAYGLDKKDARTVIVFDFGGGTFDVSLLEMGDGVFEVKATNGDTFLGGEDFDSCLVEHICDTFKKENGIDLKQDTLALQRLKEAAEKAKIELSSTSQTEINLPFISANSAGAQHLNMKLTRAQFERLVNHLIQKTVEPCKKCLQDAGLSPSDIDEVVLVGGMTRMPKIQQSVQDFFNKSPSKGVNPDEVVAMGAAIQAGVLQGDVKDLLLLDVTPLSLGIETLGGVFTSIIDRNSTIPTKKSQVFSTAADNQSAVSIRIGQGERKMFADNKLLGQFDLVGIPPAPKGTPQIEVAFDIDANGIVQVSAL*****************LSSEDIEKMVKDAEMNAEMDKKRREAVETKNHAESLIYSTEQSLREHGDKIAEAEQKSIRESIDALRTLLNDADPDESKIKEATQKLMEVSMNLGKAIYEAQ****************KTDVKDDVVDADYEEIKDDEKDKKKLSIFLSRT
*SKVIGIDLGTTNSCVAIMDGKNVRVIENAEGTRTTPSMVGFTDEGERLVGQPAKRQAVTNPSNTIFAAKRLIGRRFNDSTVAKDASLVPFKIVEGKGGDAWIEAQGKQYSPSQISAIVLQKMKETAESFLGETVSKAVITVPAYFNDAQRQATKDAGRIAGLDVLRIINEPTAAALAYGLDKKDARTVIVFDFGGGTFDVSLLEMGDGVFEVKATNGDTFLGGEDFDSCLVEHICDTFKKENGIDLKQDTLALQRLKEAAEKAKIELSSTSQTEINLPFISANSAGAQHLNMKLTRAQFERLVNHLIQKTVEPCKKCLQDAGLSPSDIDEVVLVGGMTRMPKIQQSVQDFFNKSPSKGVNPDEVVAMGAAIQAGVLQGDVKDLLLLDVTPLSLGIETLGGVFTSIIDRNSTIPTKKSQVFSTAADNQSAVSIRIGQGERKMFADNKLLGQFDLVGIPPAPKGTPQIEVAFDIDANGIVQVSALDKGTGKAQQISIQASGGLSSEDIEKMVKDAEMNAEMDKKRREAVETKNHAESLIYSTEQSLREHGDKIAEAEQKSIRESIDALRTLLNDADPDESKIKEATQKLMEVSMNLGKAIYEAQ***********************VVDADYEEIKDDEKDKKKLSIFLSR*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKVIGIDLGTTNSCVAIMDGKNVRVIENAEGTRTTPSMVGFTDEGERLVGQPAKRQAVTNPSNTIFAAKRLIGRRFNDSTVAKDASLVPFKIVEGKGGDAWIEAQGKQYSPSQISAIVLQKMKETAESFLGETVSKAVITVPAYFNDAQRQATKDAGRIAGLDVLRIINEPTAAALAYGLDKKDARTVIVFDFGGGTFDVSLLEMGDGVFEVKATNGDTFLGGEDFDSCLVEHICDTFKKENGIDxxxxxxxxxxxxxxxxxxxxxxxxxxxxEINLPFISANSAGAQHLNMKLTRAQFERLVNHLIQKTVEPCKKCLQDAGLSPSDIDEVVLVGGMTRMPKIQQSVQDFFNKSPSKGVNPDEVVAMGAAIQAGVLQGDVKDLLLLDVTPLSLGIETLGGVFTSIIDRNSTIPTKKSQVFSTAADNQSAVSIRIGQGERKMFADNKLLGQFDLVGIPPAPKGTPQIEVAFDIDANGIVQVSALDKGTGKAQQISIQASGGLSSEDIEKMVKDAEMNAEMDKKRREAVETKNHAESLIYSTEQSLREHGDKIAEAEQKSIRESIDALRTLLNDADPDESKIKEATQKLMEVSMNLGKAIYEAQAKKDAAADTATADTTAKTDVKDDVVDADYEEIKDDEKDKKKLSIFLSRT
MSKVIGIDLGTTNSCVAIMDGKNVRVIENAEGTRTTPSMVGFTDEGERLVGQPAKRQAVTNPSNTIFAAKRLIGRRFNDSTVAKDASLVPFKIVEGKGGDAWIEAQGKQYSPSQISAIVLQKMKETAESFLGETVSKAVITVPAYFNDAQRQATKDAGRIAGLDVLRIINEPTAAALAYGLDKKDARTVIVFDFGGGTFDVSLLEMGDGVFEVKATNGDTFLGGEDFDSCLVEHICDTFKKENGIDLKQDTLALQRLKEAAEKAKIELSSTSQTEINLPFISANSAGAQHLNMKLTRAQFERLVNHLIQKTVEPCKKCLQDAGLSPSDIDEVVLVGGMTRMPKIQQSVQDFFNKSPSKGVNPDEVVAMGAAIQAGVLQGDVKDLLLLDVTPLSLGIETLGGVFTSIIDRNSTIPTKKSQVFSTAADNQSAVSIRIGQGERKMFADNKLLGQFDLVGIPPAPKGTPQIEVAFDIDANGIVQVSALDKGTGKAQQISIQASGGLSSEDIEKMVKDAEMNAEMDKKRREAVETKNHAESLIYSTEQSLREHGDKIAEAEQKSIRESIDALRTLLNDADPDESKIKEATQKLMEVSMNLGKAIYEAQAKKDAAADTATADTTAKTDVKDDVVDADYEEIKDDEKDKKKLSIFLSRT
MSKVIGIDLGTTNSCVAIMDGKNVRVIENAEGTRTTPSMVGFTDEGERLVGQPAKRQAVTNPSNTIFAAKRLIGRRFNDSTVAKDASLVPFKIVEGKGGDAWIEAQGKQYSPSQISAIVLQKMKETAESFLGETVSKAVITVPAYFNDAQRQATKDAGRIAGLDVLRIINEPTAAALAYGLDKKDARTVIVFDFGGGTFDVSLLEMGDGVFEVKATNGDTFLGGEDFDSCLVEHICDTFKKENGIDLKQDTLALQRLKEAAEKAKIELSSTSQTEINLPFISANSAGAQHLNMKLTRAQFERLVNHLIQKTVEPCKKCLQDAGLSPSDIDEVVLVGGMTRMPKIQQSVQDFFNKSPSKGVNPDEVVAMGAAIQAGVLQGDVKDLLLLDVTPLSLGIETLGGVFTSIIDRNSTIPTKKSQVFSTAADNQSAVSIRIGQGERKMFADNKLLGQFDLVGIPPAPKGTPQIEVAFDIDANGIVQVSALDKGTGKAQQISIQASGGLSSEDIEKMVKDAEMNAEMDKKRREAVETKNHAESLIYSTEQSLREHGDKIAEAEQKSIRESIDALRTLLNDADPDESKIKEATQKLMEVSMNLGKAIYEAQAKKDAAADTATADTTAKTDVKDDVVDADYEEIKDDEKDKKKLSIFLSRT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target652 molecular chaperone DnaK [Candidatus Liberibacter asiat
254781177440 cell division protein [Candidatus Liberibacter asi 9e-05
>gi|254781177|ref|YP_003065590.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] Length = 440 Back     alignment
 Score = 40.4 bits (93), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 89/192 (46%), Gaps = 25/192 (13%)

Query: 161 AGLDVLRIINEPTAAALAYGLDKKDARTVIVFDFGGGTFDVSLLEMGDGVF-EVKATNGD 219
           A L V R++  P A+ LA  +D +     +V D GGGT  +++ + G  V+ +V A  G 
Sbjct: 203 AHLSVERMVASPYASGLATLVDDEFELGSVVIDMGGGTTKIAIFDKGKLVYMDVIAIGG- 261

Query: 220 TFLGGEDFDSCLVEHICDTFKKENGIDLKQDTLALQRLKEAAEKAKIELSSTSQTEINLP 279
                         H+ +   +  G+ +  D    +RLK     + I   +     +++P
Sbjct: 262 -------------SHVTNDLAR--GLSISLDN--AERLK-VMHPSIIPSLADEHDILSIP 303

Query: 280 FISANSAGAQHLNM-KLTRAQFERLVNHLIQKTVEPCKKCLQDAGLSPSDIDEVVLVGGM 338
            I      A H ++ +++RA   R++   I++T E   + ++ +G S      +VL GG 
Sbjct: 304 TI----GNADHNDLVQVSRAMISRIIQARIEETFELIGERIKKSGFSSLASKRIVLTGGA 359

Query: 339 TRMPKIQQSVQD 350
           +++  +Q+ +++
Sbjct: 360 SQVIGLQEMLRE 371

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target652 molecular chaperone DnaK [Candidatus Liberibacter asiat
315122171645 molecular chaperone DnaK [Candidatus Liberibacter solan 1 0.0
15887476633 molecular chaperone DnaK [Agrobacterium tumefaciens str 1 0.0
40362977634 DnaK [Agrobacterium tumefaciens] Length = 634 1 0.0
325291564633 molecular chaperone DnaK [Agrobacterium sp. H13-3] Leng 1 0.0
1027504633 DnaK protein [Agrobacterium tumefaciens str. C58] Lengt 1 0.0
623569641 heat shock protein 70 [Sinorhizobium meliloti] Length = 1 0.0
116249919638 molecular chaperone DnaK [Rhizobium leguminosarum bv. v 1 0.0
150398578641 molecular chaperone DnaK [Sinorhizobium medicae WSM419] 1 0.0
58826547638 DnaK [Rhizobium leguminosarum] Length = 638 1 0.0
58826435634 DnaK [Agrobacterium rubi] Length = 634 1 0.0
>gi|315122171|ref|YP_004062660.1| molecular chaperone DnaK [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 645 Back     alignment and organism information
 Score = 1139 bits (2946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/635 (87%), Positives = 597/635 (94%)

Query: 1   MSKVIGIDLGTTNSCVAIMDGKNVRVIENAEGTRTTPSMVGFTDEGERLVGQPAKRQAVT 60
           MSKVIGIDLGTTNSCVAIMDGKNVRVIENAEGTRTTPSMV FTDEGERL+GQPAKRQAVT
Sbjct: 1   MSKVIGIDLGTTNSCVAIMDGKNVRVIENAEGTRTTPSMVAFTDEGERLIGQPAKRQAVT 60

Query: 61  NPSNTIFAAKRLIGRRFNDSTVAKDASLVPFKIVEGKGGDAWIEAQGKQYSPSQISAIVL 120
           NP NTI+A KRLIG+RF DSTV+KDA+L+PFKI+EGK GDAWIEA GKQYSPSQISAI+L
Sbjct: 61  NPCNTIYAVKRLIGQRFADSTVSKDANLIPFKIIEGKNGDAWIEAHGKQYSPSQISAIIL 120

Query: 121 QKMKETAESFLGETVSKAVITVPAYFNDAQRQATKDAGRIAGLDVLRIINEPTAAALAYG 180
           QKMKETAE+FLGE V +AVITVPAYFNDAQRQATKDAGRIAGLDVLRIINEPTAAALAYG
Sbjct: 121 QKMKETAENFLGEKVDQAVITVPAYFNDAQRQATKDAGRIAGLDVLRIINEPTAAALAYG 180

Query: 181 LDKKDARTVIVFDFGGGTFDVSLLEMGDGVFEVKATNGDTFLGGEDFDSCLVEHICDTFK 240
           LDKKD + +IVFDFGGGTFDVSLLEMGDGVFEVKATNGDTFLGGEDFDSCLVEHICD F+
Sbjct: 181 LDKKDGKIIIVFDFGGGTFDVSLLEMGDGVFEVKATNGDTFLGGEDFDSCLVEHICDNFQ 240

Query: 241 KENGIDLKQDTLALQRLKEAAEKAKIELSSTSQTEINLPFISANSAGAQHLNMKLTRAQF 300
           KENGIDL++DTLALQRLKEAAEKAKIELSS  QTEINLPFISANSAGAQHLNMKLTRAQF
Sbjct: 241 KENGIDLRKDTLALQRLKEAAEKAKIELSSAQQTEINLPFISANSAGAQHLNMKLTRAQF 300

Query: 301 ERLVNHLIQKTVEPCKKCLQDAGLSPSDIDEVVLVGGMTRMPKIQQSVQDFFNKSPSKGV 360
           ERLV+HLIQKTVEPCKKCLQDAGLSP+DIDEVVLVGGMTRMPKIQ+SV+DFF+K+PSKGV
Sbjct: 301 ERLVDHLIQKTVEPCKKCLQDAGLSPNDIDEVVLVGGMTRMPKIQKSVEDFFHKTPSKGV 360

Query: 361 NPDEVVAMGAAIQAGVLQGDVKDLLLLDVTPLSLGIETLGGVFTSIIDRNSTIPTKKSQV 420
           NPDEVVAMGAAIQAGVLQGDVKD+LLLDVTPLSLGIETLGGVFT++I+RNSTIPTKKSQV
Sbjct: 361 NPDEVVAMGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTTLIERNSTIPTKKSQV 420

Query: 421 FSTAADNQSAVSIRIGQGERKMFADNKLLGQFDLVGIPPAPKGTPQIEVAFDIDANGIVQ 480
           FSTA DNQSAV+IRIGQGERKMF DNKLLGQFDLVGIPPAP+G PQI V FDIDANGIVQ
Sbjct: 421 FSTATDNQSAVTIRIGQGERKMFTDNKLLGQFDLVGIPPAPRGMPQIAVTFDIDANGIVQ 480

Query: 481 VSALDKGTGKAQQISIQASGGLSSEDIEKMVKDAEMNAEMDKKRREAVETKNHAESLIYS 540
           VSA DKGTGK QQISIQASGGLSSE+IE MVKDAEM+AEMDKKRRE VE+KN AE+LI+S
Sbjct: 481 VSAKDKGTGKEQQISIQASGGLSSEEIENMVKDAEMHAEMDKKRRETVESKNQAENLIHS 540

Query: 541 TEQSLREHGDKIAEAEQKSIRESIDALRTLLNDADPDESKIKEATQKLMEVSMNLGKAIY 600
           TEQSL+EHGDKI+E +QKSIRESIDAL+++L+D D +E KIKEATQKLMEVSMNLGKAIY
Sbjct: 541 TEQSLKEHGDKISEEDQKSIRESIDALQSILDDKDSEEGKIKEATQKLMEVSMNLGKAIY 600

Query: 601 EAQAKKDAAADTATADTTAKTDVKDDVVDADYEEI 635
           EAQAKKDA A      TT +   +DDVVDADYEEI
Sbjct: 601 EAQAKKDATAAEDATTTTTEKKAEDDVVDADYEEI 635


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15887476|ref|NP_353157.1| molecular chaperone DnaK [Agrobacterium tumefaciens str. C58] Length = 633 Back     alignment and organism information
>gi|40362977|gb|AAR84665.1| DnaK [Agrobacterium tumefaciens] Length = 634 Back     alignment and organism information
>gi|325291564|ref|YP_004277428.1| molecular chaperone DnaK [Agrobacterium sp. H13-3] Length = 633 Back     alignment and organism information
>gi|1027504|emb|CAA60592.1| DnaK protein [Agrobacterium tumefaciens str. C58] Length = 633 Back     alignment and organism information
>gi|623569|gb|AAA64925.1| heat shock protein 70 [Sinorhizobium meliloti] Length = 641 Back     alignment and organism information
>gi|116249919|ref|YP_765757.1| molecular chaperone DnaK [Rhizobium leguminosarum bv. viciae 3841] Length = 638 Back     alignment and organism information
>gi|150398578|ref|YP_001329045.1| molecular chaperone DnaK [Sinorhizobium medicae WSM419] Length = 641 Back     alignment and organism information
>gi|58826547|gb|AAW82903.1| DnaK [Rhizobium leguminosarum] Length = 638 Back     alignment and organism information
>gi|58826435|gb|AAW82897.1| DnaK [Agrobacterium rubi] Length = 634 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target652 molecular chaperone DnaK [Candidatus Liberibacter asiat
KOG0102640 KOG0102, KOG0102, KOG0102, Molecular chaperones mortali 0.0
CHL00094621 CHL00094, dnaK, heat shock protein 70 0.0
COG0443579 COG0443, DnaK, Molecular chaperone [Posttranslational m 0.0
KOG0100663 KOG0100, KOG0100, KOG0100, Molecular chaperones GRP78/B 0.0
PRK00290627 PRK00290, dnaK, molecular chaperone DnaK; Provisional 0.0
TIGR02350595 TIGR02350, prok_dnaK, chaperone protein DnaK 0.0
PTZ00400663 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Prov 0.0
PRK13411653 PRK13411, PRK13411, molecular chaperone DnaK; Provision 0.0
PLN03184673 PLN03184, PLN03184, chloroplast Hsp70; Provisional 0.0
PTZ00186657 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein 0.0
PTZ00009653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisio 0.0
TIGR01991599 TIGR01991, HscA, Fe-S protein assembly chaperone HscA 1e-171
PRK05183616 PRK05183, hscA, chaperone protein HscA; Provisional 1e-171
KOG0101620 KOG0101, KOG0101, KOG0101, Molecular chaperones HSP70/H 1e-156
PRK01433595 PRK01433, hscA, chaperone protein HscA; Provisional 1e-104
KOG0103727 KOG0103, KOG0103, KOG0103, Molecular chaperones HSP105/ 2e-74
pfam00012598 pfam00012, HSP70, Hsp70 protein 0.0
PRK13410668 PRK13410, PRK13410, molecular chaperone DnaK; Provision 0.0
KOG0104 902 KOG0104, KOG0104, KOG0104, Molecular chaperones GRP170/ 8e-57
PRK11678450 PRK11678, PRK11678, putative chaperone; Provisional 1e-16
pfam06723327 pfam06723, MreB_Mbl, MreB/Mbl protein 3e-10
TIGR00904333 TIGR00904, mreB, cell shape determining protein, MreB/M 4e-10
COG1077342 COG1077, MreB, Actin-like ATPase involved in cell morph 2e-09
PRK13930335 PRK13930, PRK13930, rod shape-determining protein MreB; 2e-09
PRK13927334 PRK13927, PRK13927, rod shape-determining protein MreB; 7e-07
PRK13928336 PRK13928, PRK13928, rod shape-determining protein Mbl; 7e-09
PRK13929335 PRK13929, PRK13929, rod-share determining protein MreBH 1e-06
TIGR02529239 TIGR02529, EutJ, ethanolamine utilization protein EutJ 7e-08
COG4820277 COG4820, EutJ, Ethanolamine utilization protein, possib 2e-07
PRK15080267 PRK15080, PRK15080, ethanolamine utilization protein Eu 1e-06
TIGR01312481 TIGR01312, XylB, D-xylulose kinase 0.002
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
>gnl|CDD|35325 KOG0102, KOG0102, KOG0102, Molecular chaperones mortalin/PBP74/GRP75, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|177026 CHL00094, dnaK, heat shock protein 70 Back     alignment and domain information
>gnl|CDD|30792 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35323 KOG0100, KOG0100, KOG0100, Molecular chaperones GRP78/BiP/KAR2, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|178963 PRK00290, dnaK, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|162816 TIGR02350, prok_dnaK, chaperone protein DnaK Back     alignment and domain information
>gnl|CDD|185598 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|178726 PLN03184, PLN03184, chloroplast Hsp70; Provisional Back     alignment and domain information
>gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>gnl|CDD|185395 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information
>gnl|CDD|162645 TIGR01991, HscA, Fe-S protein assembly chaperone HscA Back     alignment and domain information
>gnl|CDD|179957 PRK05183, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|35324 KOG0101, KOG0101, KOG0101, Molecular chaperones HSP70/HSC70, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|167230 PRK01433, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|35326 KOG0103, KOG0103, KOG0103, Molecular chaperones HSP105/HSP110/SSE1, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|143803 pfam00012, HSP70, Hsp70 protein Back     alignment and domain information
>gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|35327 KOG0104, KOG0104, KOG0104, Molecular chaperones GRP170/SIL1, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183274 PRK11678, PRK11678, putative chaperone; Provisional Back     alignment and domain information
>gnl|CDD|115385 pfam06723, MreB_Mbl, MreB/Mbl protein Back     alignment and domain information
>gnl|CDD|129982 TIGR00904, mreB, cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>gnl|CDD|31275 COG1077, MreB, Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|184404 PRK13930, PRK13930, rod shape-determining protein MreB; Provisional Back     alignment and domain information
>gnl|CDD|184401 PRK13927, PRK13927, rod shape-determining protein MreB; Provisional Back     alignment and domain information
>gnl|CDD|184402 PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>gnl|CDD|184403 PRK13929, PRK13929, rod-share determining protein MreBH; Provisional Back     alignment and domain information
>gnl|CDD|131581 TIGR02529, EutJ, ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>gnl|CDD|34429 COG4820, EutJ, Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|185038 PRK15080, PRK15080, ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>gnl|CDD|162297 TIGR01312, XylB, D-xylulose kinase Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 652 molecular chaperone DnaK [Candidatus Liberibacter asiat
TIGR02350598 prok_dnaK chaperone protein DnaK; InterPro: IPR012725 M 100.0
PRK13411655 molecular chaperone DnaK; Provisional 100.0
PTZ00186657 heat shock 70 kDa precursor protein; Provisional 100.0
PRK13410719 molecular chaperone DnaK; Provisional 100.0
PTZ00009657 heat shock 70 kDa protein; Provisional 100.0
PRK05183621 hscA chaperone protein HscA; Provisional 100.0
KOG0100663 consensus 100.0
pfam00012598 HSP70 Hsp70 protein. Hsp70 chaperones help to fold many 100.0
PRK01433595 hscA chaperone protein HscA; Provisional 100.0
TIGR01991628 HscA Fe-S protein assembly chaperone HscA; InterPro: IP 100.0
KOG0102640 consensus 100.0
KOG0101620 consensus 100.0
COG0443579 DnaK Molecular chaperone [Posttranslational modificatio 100.0
KOG0103727 consensus 100.0
KOG0104 902 consensus 100.0
PRK00290631 dnaK molecular chaperone DnaK; Provisional 100.0
CHL00094622 dnaK heat shock protein 70 100.0
PRK11678450 putative chaperone; Provisional 100.0
pfam06723327 MreB_Mbl MreB/Mbl protein. This family consists of bact 100.0
PRK13930336 rod shape-determining protein MreB; Provisional 100.0
PRK13929335 rod-share determining protein MreBH; Provisional 100.0
PRK13928325 rod shape-determining protein Mbl; Provisional 100.0
PRK13927338 rod shape-determining protein MreB; Provisional 100.0
TIGR00904337 mreB cell shape determining protein, MreB/Mrl family; I 99.98
COG1077342 MreB Actin-like ATPase involved in cell morphogenesis [ 99.96
PRK09472420 ftsA cell division protein FtsA; Reviewed 99.76
COG0849418 ftsA Cell division ATPase FtsA [Cell division and chrom 99.72
cd00012371 ACTIN Actin; An ubiquitous protein involved in the form 99.31
smart00268373 ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarkinase/ 99.28
PTZ00004375 actin; Provisional 99.24
pfam00022369 Actin Actin. 99.22
PTZ00280416 actin; Provisional 99.01
PTZ00281376 actin; Provisional 98.93
KOG0676372 consensus 98.02
TIGR02529240 EutJ ethanolamine utilization protein EutJ family prote 99.64
pfam06406318 StbA StbA protein. This family consists of several bact 99.24
COG4820277 EutJ Ethanolamine utilization protein, possible chapero 99.17
COG4972354 PilM Tfp pilus assembly protein, ATPase PilM [Cell moti 98.24
KOG0680400 consensus 94.47
PRK13917346 plasmid segregation protein ParM; Provisional 99.05
TIGR01174393 ftsA cell division protein FtsA; InterPro: IPR003494 Ft 98.58
pfam02491163 FtsA Cell division protein FtsA. FtsA is essential for 98.29
COG1924396 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-c 98.2
TIGR03192293 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subuni 97.61
pfam08841332 DDR Diol dehydratase reactivase ATPase-like domain. Dio 97.15
PRK00292315 glk glucokinase; Provisional 95.81
pfam02685316 Glucokinase Glucokinase. This is a family of glucokinas 91.63
KOG0679426 consensus 98.82
COG5277444 Actin and related proteins [Cytoskeleton] 98.42
PRK10331470 L-fuculokinase; Provisional 98.47
PRK10939521 autoinducer-2 (AI-2) kinase; Provisional 98.46
PTZ00294510 glycerol kinase; Provisional 98.44
PRK04123542 ribulokinase; Provisional 98.34
COG1070502 XylB Sugar (pentulose and hexulose) kinases [Carbohydra 98.01
PRK13317273 pantothenate kinase; Provisional 97.7
pfam02782193 FGGY_C FGGY family of carbohydrate kinases, C-terminal 97.12
pfam01968285 Hydantoinase_A Hydantoinase/oxoprolinase. This family i 97.08
TIGR03286404 methan_mark_15 putative methanogenesis marker protein 1 96.66
KOG2517516 consensus 96.62
PRK00047498 glpK glycerol kinase; Provisional 96.18
PRK10640471 rhaB rhamnulokinase; Provisional 94.95
KOG2531545 consensus 94.95
COG44571014 SrfB Uncharacterized protein conserved in bacteria, put 94.82
TIGR01315574 5C_CHO_kinase FGGY-family pentulose kinase; InterPro: I 92.58
pfam03702363 UPF0075 Uncharacterized protein family (UPF0075). The p 92.09
PRK09585366 anmK anhydro-N-acetylmuramic acid kinase; Reviewed 91.97
pfam07520999 SrfB Virulence factor SrfB. This family includes homolo 98.03
TIGR01312494 XylB xylulokinase; InterPro: IPR006000 The ability to m 97.79
COG1069544 AraB Ribulose kinase [Energy production and conversion] 97.51
KOG0797618 consensus 97.46
pfam06277473 EutA Ethanolamine utilisation protein EutA. This family 97.43
PRK10719471 eutA reactivating factor for ethanolamine ammonia lyase 97.39
COG4819473 EutA Ethanolamine utilization protein, possible chapero 96.31
COG5026466 Hexokinase [Carbohydrate transport and metabolism] 93.82
KOG0681645 consensus 93.38
COG0145674 HyuA N-methylhydantoinase A/acetone carboxylase, beta s 92.96
pfam01869288 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family. This fam 97.04
smart00842187 FtsA Cell division protein FtsA. FtsA is essential for 96.17
PRK10854513 exopolyphosphatase; Provisional 95.18
PRK11031494 guanosine pentaphosphate phosphohydrolase; Provisional 94.93
COG0248492 GppA Exopolyphosphatase [Nucleotide transport and metab 94.35
pfam02541285 Ppx-GppA Ppx/GppA phosphatase family. This family consi 94.31
TIGR00395 1109 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 T 92.25
>TIGR02350 prok_dnaK chaperone protein DnaK; InterPro: IPR012725 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>PRK13411 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PTZ00186 heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>PRK05183 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>KOG0100 consensus Back     alignment and domain information
>pfam00012 HSP70 Hsp70 protein Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>TIGR01991 HscA Fe-S protein assembly chaperone HscA; InterPro: IPR010236 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>KOG0102 consensus Back     alignment and domain information
>KOG0101 consensus Back     alignment and domain information
>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0103 consensus Back     alignment and domain information
>KOG0104 consensus Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>PRK11678 putative chaperone; Provisional Back     alignment and domain information
>pfam06723 MreB_Mbl MreB/Mbl protein Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes Back     alignment and domain information
>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK09472 ftsA cell division protein FtsA; Reviewed Back     alignment and domain information
>COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] Back     alignment and domain information
>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton Back     alignment and domain information
>smart00268 ACTIN Actin Back     alignment and domain information
>PTZ00004 actin; Provisional Back     alignment and domain information
>pfam00022 Actin Actin Back     alignment and domain information
>PTZ00280 actin; Provisional Back     alignment and domain information
>PTZ00281 actin; Provisional Back     alignment and domain information
>KOG0676 consensus Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein; InterPro: IPR013366 Salmonella typhimurium is capable of growth on ethanolamine as a sole source of carbon nitrogen and energy Back     alignment and domain information
>pfam06406 StbA StbA protein Back     alignment and domain information
>COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>COG4972 PilM Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0680 consensus Back     alignment and domain information
>PRK13917 plasmid segregation protein ParM; Provisional Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA; InterPro: IPR003494 FtsA is essential for bacterial cell division, and co-localizes to the septal ring with FtsZ Back     alignment and domain information
>pfam02491 FtsA Cell division protein FtsA Back     alignment and domain information
>COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] Back     alignment and domain information
>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit Back     alignment and domain information
>pfam08841 DDR Diol dehydratase reactivase ATPase-like domain Back     alignment and domain information
>PRK00292 glk glucokinase; Provisional Back     alignment and domain information
>pfam02685 Glucokinase Glucokinase Back     alignment and domain information
>KOG0679 consensus Back     alignment and domain information
>COG5277 Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>PRK10331 L-fuculokinase; Provisional Back     alignment and domain information
>PRK10939 autoinducer-2 (AI-2) kinase; Provisional Back     alignment and domain information
>PTZ00294 glycerol kinase; Provisional Back     alignment and domain information
>PRK04123 ribulokinase; Provisional Back     alignment and domain information
>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13317 pantothenate kinase; Provisional Back     alignment and domain information
>pfam02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain Back     alignment and domain information
>pfam01968 Hydantoinase_A Hydantoinase/oxoprolinase Back     alignment and domain information
>TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 Back     alignment and domain information
>KOG2517 consensus Back     alignment and domain information
>PRK00047 glpK glycerol kinase; Provisional Back     alignment and domain information
>PRK10640 rhaB rhamnulokinase; Provisional Back     alignment and domain information
>KOG2531 consensus Back     alignment and domain information
>COG4457 SrfB Uncharacterized protein conserved in bacteria, putative virulence factor [Function unknown] Back     alignment and domain information
>TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase; InterPro: IPR006003 The enzymes for catabolism of the pentitols D-arabinitol and ribitol include NAD-dependent pentose dehydrogenase (dalD and rbtD), ATP-dependent pentulose kinases (dalK and rbtK) and a pentose-specific ion symporter (dalT and rbtT) Back     alignment and domain information
>pfam03702 UPF0075 Uncharacterized protein family (UPF0075) Back     alignment and domain information
>PRK09585 anmK anhydro-N-acetylmuramic acid kinase; Reviewed Back     alignment and domain information
>pfam07520 SrfB Virulence factor SrfB Back     alignment and domain information
>TIGR01312 XylB xylulokinase; InterPro: IPR006000 The ability to metabolise xylose, one of the most abundant sugars in nature, is dependent on its conversion to xylulose-5-phosphate, which then enters the non-oxidative pentose phosphate pathway Back     alignment and domain information
>COG1069 AraB Ribulose kinase [Energy production and conversion] Back     alignment and domain information
>KOG0797 consensus Back     alignment and domain information
>pfam06277 EutA Ethanolamine utilisation protein EutA Back     alignment and domain information
>PRK10719 eutA reactivating factor for ethanolamine ammonia lyase; Provisional Back     alignment and domain information
>COG4819 EutA Ethanolamine utilization protein, possible chaperonin protecting lyase from inhibition [Amino acid transport and metabolism] Back     alignment and domain information
>COG5026 Hexokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0681 consensus Back     alignment and domain information
>COG0145 HyuA N-methylhydantoinase A/acetone carboxylase, beta subunit [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>pfam01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family Back     alignment and domain information
>smart00842 FtsA Cell division protein FtsA Back     alignment and domain information
>PRK10854 exopolyphosphatase; Provisional Back     alignment and domain information
>PRK11031 guanosine pentaphosphate phosphohydrolase; Provisional Back     alignment and domain information
>COG0248 GppA Exopolyphosphatase [Nucleotide transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam02541 Ppx-GppA Ppx/GppA phosphatase family Back     alignment and domain information
>TIGR00395 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target652 molecular chaperone DnaK [Candidatus Liberibacter asiat
2kho_A605 Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP 1e-137
3d2f_A675 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 2e-67
3c7n_A668 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 1e-65
3d2e_A675 Crystal Structure Of A Complex Of Sse1p And Hsp70, 1e-64
2qxl_A658 Crystal Structure Analysis Of Sse1, A Yeast Hsp110 4e-64
1yuw_A554 Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 1e-114
3c7n_B554 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 1e-114
2v7z_A543 Crystal Structure Of The 70-Kda Heat Shock Cognate 1e-110
2v7y_A509 Crystal Structure Of The Molecular Chaperone Dnak F 1e-110
1dkg_D383 Crystal Structure Of The Nucleotide Exchange Factor 7e-95
3ldl_A384 Crystal Structure Of Human Grp78 (70kda Heat Shock 1e-91
3iuc_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 3e-91
2qw9_B394 Crystal Structure Of Bovine Hsc70 (1-394aa)in The A 1e-90
1ngc_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 2e-90
1ngd_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 2e-90
1ngf_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 2e-90
1nge_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 2e-90
1hpm_A386 How Potassium Affects The Activity Of The Molecular 3e-90
1ba0_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 3e-90
1atr_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 4e-90
2qwn_A394 Crystal Structure Of Disulfide-Bond-Crosslinked Com 4e-90
1ats_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 5e-90
3cqx_A386 Chaperone Complex Length = 386 5e-90
3gdq_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 6e-90
1nga_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 7e-90
1ngb_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 9e-90
3a8y_A392 Crystal Structure Of The Complex Between The Bag5 B 2e-89
3jxu_A409 Crystal Structure Of The Human 70kda Heat Shock Pro 2e-89
2e8a_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 2e-89
2e88_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 2e-89
3d2f_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 2e-89
3fzf_A381 Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP 2e-89
1hx1_A400 Crystal Structure Of A Bag Domain In Complex With T 2e-89
1ba1_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 3e-89
1bup_A386 T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot 4e-89
1s3x_A382 The Crystal Structure Of The Human Hsp70 Atpase Dom 4e-89
3fe1_A403 Crystal Structure Of The Human 70kda Heat Shock Pro 5e-89
1hjo_A380 Heat-Shock 70kd Protein 42kd Atpase N-Terminal Doma 5e-89
1qqm_A378 D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 8e-89
1ngg_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-88
1ngh_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-88
3i33_A404 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-88
1kay_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71a 1e-88
1kax_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71m 2e-88
1qqo_A378 E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 2e-88
1kaz_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71e 2e-88
2bup_A381 T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 5e-88
1qqn_A378 D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 6e-88
3d2e_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70, 3e-86
3kvg_A400 Crystal Structure Of The N-Terminal Domain Of Hsp70 3e-86
3gl1_A387 Crystal Structure Of Atpase Domain Of Ssb1 Chaperon 1e-80
1dky_A219 The Substrate Binding Domain Of Dnak In Complex Wit 2e-33
3dpo_A219 Crystal Structure Of The Substrate Binding Domain O 2e-33
1dkx_A219 The Substrate Binding Domain Of Dnak In Complex Wit 6e-33
1bpr_A191 Nmr Structure Of The Substrate Binding Domain Of Dn 1e-21
3n8e_A182 Substrate Binding Domain Of The Human Heat Shock 70 9e-17
>gi|237640373|pdb|2KHO|A Chain A, Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAPERONE (1-605) Complexed With Adp And Substrate Length = 605 Back     alignment and structure
 Score =  495 bits (1273), Expect = e-137,   Method: Composition-based stats.
 Identities = 378/607 (62%), Positives = 478/607 (78%), Gaps = 7/607 (1%)

Query: 1   MSKVIGIDLGTTNSCVAIMDGKNVRVIENAEGTRTTPSMVGFTDEGERLVGQPAKRQAVT 60
           M K+IGIDLGTTNSCVAIMDG   RV+ENAEG RTTPS++ +T +GE LVGQPAKRQAVT
Sbjct: 1   MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVT 60

Query: 61  NPSNTIFAAKRLIGRRFNDSTVAKDASLVPFKIVEGKGGDAWIEAQGKQYSPSQISAIVL 120
           NP NT+FA KRLIGRRF D  V +D S++PFKI+    GDAW+E +G++ +P QISA VL
Sbjct: 61  NPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVL 120

Query: 121 QKMKETAESFLGETVSKAVITVPAYFNDAQRQATKDAGRIAGLDVLRIINEPTAAALAYG 180
           +KMK+TAE +LGE V++AVITVPAYFNDAQRQATKDAGRIAGL+V RIINEPTAAALAYG
Sbjct: 121 KKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYG 180

Query: 181 LDK-KDARTVIVFDFGGGTFDVSLLEMG----DGVFEVKATNGDTFLGGEDFDSCLVEHI 235
           LDK    RT+ V+D GGGTFD+S++E+     +  FEV ATNGDT LGGEDFDS L+ ++
Sbjct: 181 LDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYL 240

Query: 236 CDTFKKENGIDLKQDTLALQRLKEAAEKAKIELSSTSQTEINLPFISANSAGAQHLNMKL 295
            + FKK+ GIDL+ D LA+QRLKEAAEKAKIELSS  QT++NLP+I+A++ G +H+N+K+
Sbjct: 241 VEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKV 300

Query: 296 TRAQFERLVNHLIQKTVEPCKKCLQDAGLSPSDIDEVVLVGGMTRMPKIQQSVQDFFNKS 355
           TRA+ E LV  L+ +++EP K  LQDAGLS SDID+V+LVGG TRMP +Q+ V +FF K 
Sbjct: 301 TRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKE 360

Query: 356 PSKGVNPDEVVAMGAAIQAGVLQGDVKDLLLLDVTPLSLGIETLGGVFTSIIDRNSTIPT 415
           P K VNPDE VA+GAA+Q GVL GDVKD+LLLDVTPLSLGIET+GGV T++I +N+TIPT
Sbjct: 361 PRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPT 420

Query: 416 KKSQVFSTAADNQSAVSIRIGQGERKMFADNKLLGQFDLVGIPPAPKGTPQIEVAFDIDA 475
           K SQVFSTA DNQSAV+I + QGERK  ADNK LGQF+L GI PAP+G PQIEV FDIDA
Sbjct: 421 KHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDA 480

Query: 476 NGIVQVSALDKGTGKAQQISIQASGGLSSEDIEKMVKDAEMNAEMDKKRREAVETKNHAE 535
           +GI+ VSA DK +GK Q+I+I+AS GL+ ++I+KMV+DAE NAE D+K  E V+T+N  +
Sbjct: 481 DGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFDELVQTRNQGD 540

Query: 536 SLIYSTEQSLREHGDKIAEAEQKSIRESIDALRTLLNDADPDESKIKEATQKLMEVSMNL 595
            L++ST + + E GDK+   ++ +I  ++ AL T L     D++ I+   Q+L +VS  L
Sbjct: 541 HLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGE--DKAAIEAKMQELAQVSQKL 598

Query: 596 GKAIYEA 602
            +   + 
Sbjct: 599 MEIAQQQ 605


>gi|190613722|pdb|3D2F|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 675 Back     alignment and structure
>gi|189096176|pdb|3C7N|A Chain A, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 668 Back     alignment and structure
>gi|190613718|pdb|3D2E|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine-Labeled Crystals Length = 675 Back     alignment and structure
>gi|159795398|pdb|2QXL|A Chain A, Crystal Structure Analysis Of Sse1, A Yeast Hsp110 Length = 658 Back     alignment and structure
>gi|78101017|pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 Back     alignment and structure
>gi|189096177|pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 Back     alignment and structure
>gi|178847300|pdb|2V7Z|A Chain A, Crystal Structure Of The 70-Kda Heat Shock Cognate Protein From Rattus Norvegicus In Post-Atp Hydrolysis State Length = 543 Back     alignment and structure
>gi|178847298|pdb|2V7Y|A Chain A, Crystal Structure Of The Molecular Chaperone Dnak From Geobacillus Kaustophilus Hta426 In Post-Atp Hydrolysis State Length = 509 Back     alignment and structure
>gi|2392283|pdb|1DKG|D Chain D, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 383 Back     alignment and structure
>gi|320089786|pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 Back     alignment and structure
>gi|259090349|pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 Back     alignment and structure
>gi|157832111|pdb|1NGC|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>gi|157832112|pdb|1NGD|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>gi|157832114|pdb|1NGF|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>gi|157832113|pdb|1NGE|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>gi|157831370|pdb|1HPM|A Chain A, How Potassium Affects The Activity Of The Molecular Chaperone Hsc70. Ii. Potassium Binds Specifically In The Atpase Active Site Length = 386 Back     alignment and structure
>gi|157830186|pdb|1BA0|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal 1nge 3 Length = 386 Back     alignment and structure
>gi|157830078|pdb|1ATR|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>gi|163310915|pdb|2QWN|A Chain A, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa) D876c In The AdpPi State Length = 394 Back     alignment and structure
>gi|157830079|pdb|1ATS|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>gi|215261181|pdb|3CQX|A Chain A, Chaperone Complex Length = 386 Back     alignment and structure
>gi|226887861|pdb|3GDQ|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1- Like Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 408 Back     alignment and structure
>gi|157832109|pdb|1NGA|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>gi|157832110|pdb|1NGB|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>gi|292659561|pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392 Back     alignment and structure