254780640

254780640

hypothetical protein CLIBASIA_02635

GeneID in NCBI database:8209641Locus tag:CLIBASIA_02635
Protein GI in NCBI database:254780640Protein Accession:YP_003065053.1
Gene range:-(628237, 628569)Protein Length:110aa
Gene description:hypothetical protein
COG prediction:[D] Chromosome segregation ATPases
KEGG prediction:hypothetical protein
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MTRLRKKNTCACLSKSLTSYYARKLIFKLLDIEISHFRGFTEIQKIEFADHLTIVNGQNGYGKSSLSEAIEWLFYGYTQRRKHGDSIKKRSIKTPMPMCMAVPRCKYQLK
cccccccccccccccccccccccEEEEEEEEEEEcccccccccEEEEccccEEEEEEcccccHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccEEEccccEEEcc
cccccccccHHHHcHHHHHHHHHHHHHHHHHEEEHccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHccccHHHHcccccccccccccccccEccc
mtrlrkkntcaclSKSLTSYYARKLIFKLLDIEishfrgfteiqkiefadhltivngqngygkssLSEAIEWLFYGYTqrrkhgdsikkrsiktpmpmcmavprckyqlk
mtrlrkkntcaclskslTSYYARKLIFKLLDIEISHFRGFTEIQKIEFADHLTIVNGQNGYGKSSLSEAIEWLFYGYtqrrkhgdsikkrsiktpmpmcmavprckyqlk
MTRLRKKNTCACLSKSLTSYYARKLIFKLLDIEISHFRGFTEIQKIEFADHLTIVNGQNGYGKSSLSEAIEWLFYGYTQRRKHGDSIKKRSIKTPMPMCMAVPRCKYQLK
***********CLSKSLTSYYARKLIFKLLDIEISHFRGFTEIQKIEFADHLTIVNGQNGYGKSSLSEAIEWLFY*********************PMCMAVPRCKYQ**
********TCACLSKSLTSYYARKLIFKLLDIEISHFRGFTEIQKIEFADHLTIVNGQNGYGKSSLSEAIEWLFYGYTQRRKHGDSIKKRSIKTPMPMCMAVPRCKYQLK
*****KKNTCACLSKSLTSYYARKLIFKLLDIEISHFRGFTEIQKIEFADHLTIVNGQNGYGKSSLSEAIEWLFYGYTQRRKHGD*IKKRSIKTPMPMCMAVPRCKYQL*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTRLRKKNTCACLSKSLTSYYARKLIFKLLDIEISHFRGFTEIQKIEFADHLTIVNGQNGYGKSSLSEAIEWLFYGYTQRRKHGDSIKKRSIKTPMPMCMAVPRCKYQLK
MTRLRKKNTCACLSKSLTSYYARKLIFKLLDIEISHFRGFTEIQKIEFADHLTIVNGQNGYGKSSLSEAIEWLFYGYTQRRKHGDSIKKRSIKTPMPMCMAVPRCKYQLK
MTRLRKKNTCACLSKSLTSYYARKLIFKLLDIEISHFRGFTEIQKIEFADHLTIVNGQNGYGKSSLSEAIEWLFYGYTQRRKHGDSIKKRSIKTPMPMCMAVPRCKYQLK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target110 hypothetical protein CLIBASIA_02635 [Candidatus Liberib
254780766 375 recombination protein F [Candidatus Liberibacter a 5e-04
>gi|254780766|ref|YP_003065179.1| recombination protein F [Candidatus Liberibacter asiaticus str. psy62] Length = 375 Back     alignment
 Score = 34.3 bits (77), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 28 KLLDIEISHFRGFTEIQKIEFADHLTIVNGQNGYGKSSLSEAIEWLFYGYTQRR 81
          K+  + IS FR +  ++ +  A H TI  G NG GK+++ EAI +L  G   RR
Sbjct: 6  KIKFLNISEFRNYASLRLVFDAQH-TIFVGDNGVGKTNILEAISFLSPGRGFRR 58

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target110 hypothetical protein CLIBASIA_02635 [Candidatus Liberib
255595159 344 conserved hypothetical protein [Ricinus communis] Lengt 1 1e-05
330970648 882 SMC-like protein [Pseudomonas syringae pv. aceris str. 1 2e-05
257793002 514 SMC domain protein [Alicyclobacillus acidocaldarius sub 1 3e-04
116492610 1176 condensin subunit Smc [Pediococcus pentosaceus ATCC 257 1 3e-04
218289469 514 SMC domain protein [Alicyclobacillus acidocaldarius LAA 1 3e-04
167647762 682 SMC domain-containing protein [Caulobacter sp. K31] Len 1 5e-04
226226181 800 exonuclease [Gemmatimonas aurantiaca T-27] Length = 800 1 6e-04
329575675 287 RecF/RecN/SMC protein [Enterococcus faecalis TX1467] Le 1 7e-04
323479028 308 chromosome partition protein SMC [Enterococcus faecalis 1 7e-04
332638234 1185 Barmotin [Weissella cibaria KACC 11862] Length = 1185 1 7e-04
>gi|255595159|ref|XP_002536238.1| conserved hypothetical protein [Ricinus communis] Length = 344 Back     alignment and organism information
 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (65%)

Query: 26  IFKLLDIEISHFRGFTEIQKIEFADHLTIVNGQNGYGKSSLSEAIEW 72
           I +L  +E+ HFRGF+E    EF +  T V G NG GKSSL EA+E+
Sbjct: 80  IVRLTKLEVEHFRGFSEKHTFEFKNPYTFVYGPNGTGKSSLCEALEY 126


Species: Ricinus communis
Genus: Ricinus
Family: Euphorbiaceae
Order: Malpighiales
Class: 
Phylum: Streptophyta
Superkingdom: Eukaryota
>gi|330970648|gb|EGH70714.1| SMC-like protein [Pseudomonas syringae pv. aceris str. M302273PT] Length = 882 Back     alignment and organism information
>gi|257793002|ref|YP_003186401.1| SMC domain protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] Length = 514 Back     alignment and organism information
>gi|116492610|ref|YP_804345.1| condensin subunit Smc [Pediococcus pentosaceus ATCC 25745] Length = 1176 Back     alignment and organism information
>gi|218289469|ref|ZP_03493697.1| SMC domain protein [Alicyclobacillus acidocaldarius LAA1] Length = 514 Back     alignment and organism information
>gi|167647762|ref|YP_001685425.1| SMC domain-containing protein [Caulobacter sp. K31] Length = 682 Back     alignment and organism information
>gi|226226181|ref|YP_002760287.1| exonuclease [Gemmatimonas aurantiaca T-27] Length = 800 Back     alignment and organism information
>gi|329575675|gb|EGG57202.1| RecF/RecN/SMC protein [Enterococcus faecalis TX1467] Length = 287 Back     alignment and organism information
>gi|323479028|gb|ADX78467.1| chromosome partition protein SMC [Enterococcus faecalis 62] Length = 308 Back     alignment and organism information
>gi|332638234|ref|ZP_08417097.1| Barmotin [Weissella cibaria KACC 11862] Length = 1185 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target110 hypothetical protein CLIBASIA_02635 [Candidatus Liberib
cd03242 270 cd03242, ABC_RecF, RecF is a recombinational DNA repair 1e-06
cd03278 197 cd03278, ABC_SMC_barmotin, Barmotin is a tight junction 3e-06
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA repli 6e-06
cd03279 213 cd03279, ABC_sbcCD, SbcCD and other Mre11/Rad50 (MR) co 8e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell divi 2e-05
COG1195 363 COG1195, RecF, Recombinational DNA repair ATPase (RecF 2e-05
PRK00064 361 PRK00064, recF, recombination protein F; Reviewed 7e-05
PRK01156 895 PRK01156, PRK01156, chromosome segregation protein; Pro 1e-04
cd03239178 cd03239, ABC_SMC_head, The structural maintenance of ch 2e-04
cd03227162 cd03227, ABC_Class2, ABC-type Class 2 contains systems 2e-04
TIGR00611 365 TIGR00611, recf, recF protein 3e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation protein S 3e-04
TIGR00618 1042 TIGR00618, sbcc, exonuclease SbcC 3e-04
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 5e-04
KOG0018 1141 KOG0018, KOG0018, KOG0018, Structural maintenance of ch 6e-04
COG3593 581 COG3593, COG3593, Predicted ATP-dependent endonuclease 0.001
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein; Pro 0.001
PRK02224 880 PRK02224, PRK02224, chromosome segregation protein; Pro 0.002
cd03241 276 cd03241, ABC_RecN, RecN ATPase involved in DNA repair; 0.003
COG1106 371 COG1106, COG1106, Predicted ATPases [General function p 0.003
cd03240 204 cd03240, ABC_Rad50, The catalytic domains of Rad50 are 9e-08
>gnl|CDD|73001 cd03242, ABC_RecF, RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>gnl|CDD|73037 cd03278, ABC_SMC_barmotin, Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>gnl|CDD|30768 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|73038 cd03279, ABC_sbcCD, SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>gnl|CDD|31389 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|31388 COG1195, RecF, Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|178835 PRK00064, recF, recombination protein F; Reviewed Back     alignment and domain information
>gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|72998 cd03239, ABC_SMC_head, The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>gnl|CDD|72986 cd03227, ABC_Class2, ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>gnl|CDD|161957 TIGR00611, recf, recF protein Back     alignment and domain information
>gnl|CDD|162739 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC Back     alignment and domain information
>gnl|CDD|145545 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|35241 KOG0018, KOG0018, KOG0018, Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|33393 COG3593, COG3593, Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|179675 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|73000 cd03241, ABC_RecN, RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>gnl|CDD|31303 COG1106, COG1106, Predicted ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|72999 cd03240, ABC_Rad50, The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 110 hypothetical protein CLIBASIA_02635 [Candidatus Liberib
PRK01156 895 chromosome segregation protein; Provisional 99.92
PRK02224 880 chromosome segregation protein; Provisional 99.91
PRK03918 882 chromosome segregation protein; Provisional 99.9
COG0419 908 SbcC ATPase involved in DNA repair [DNA replication, re 99.87
cd03279 213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes ar 99.86
PRK10246 1047 exonuclease subunit SbcC; Provisional 99.86
TIGR02168 1191 SMC_prok_B chromosome segregation protein SMC; InterPro 99.86
TIGR02169 1202 SMC_prok_A chromosome segregation protein SMC; InterPro 99.81
pfam02463 1162 SMC_N RecF/RecN/SMC N terminal domain. This domain is f 99.8
COG1196 1163 Smc Chromosome segregation ATPases [Cell division and c 99.78
PRK00064 355 recF recombination protein F; Reviewed 99.74
cd03242 270 ABC_RecF RecF is a recombinational DNA repair ATPase th 99.7
TIGR00618 1063 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins 99.67
cd03274 212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are 99.67
cd03275 247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are 99.65
COG1195 363 RecF Recombinational DNA repair ATPase (RecF pathway) [ 99.64
KOG0018 1141 consensus 99.64
cd03239178 ABC_SMC_head The structural maintenance of chromosomes 99.64
cd03276 198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are 99.58
TIGR00611 399 recf DNA replication and repair protein RecF; InterPro: 99.52
cd03277 213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are 99.52
KOG0996 1293 consensus 99.46
cd03240 204 ABC_Rad50 The catalytic domains of Rad50 are similar to 99.38
KOG0979 1072 consensus 99.36
KOG0250 1074 consensus 99.35
TIGR00606 1328 rad50 rad50; InterPro: IPR004584 Rad50 is involved in r 99.34
PRK10869 553 recombination and repair protein; Provisional 99.34
KOG0964 1200 consensus 99.32
cd03241 276 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-b 99.28
COG0497 557 RecN ATPase involved in DNA repair [DNA replication, re 99.19
KOG0933 1174 consensus 99.17
KOG0962 1294 consensus 99.13
TIGR00634 605 recN DNA repair protein RecN; InterPro: IPR004604 DNA r 99.09
PRK13641 286 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.73
PRK13643 288 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.7
PRK13640 283 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.69
PRK13644 274 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.67
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.67
PRK13650 276 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.66
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.63
TIGR01166 190 cbiO cobalt ABC transporter, ATP-binding protein; Inter 97.59
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.54
COG1122 235 CbiO ABC-type cobalt transport system, ATPase component 97.53
PRK13635 279 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.51
PRK13632 273 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.47
PRK13642 277 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.45
PRK13633 281 cobalt transporter ATP-binding subunit; Provisional 97.44
TIGR00958 770 3a01208 antigen peptide transporter 2; InterPro: IPR005 97.43
KOG0057 591 consensus 97.17
TIGR01420 350 pilT_fam twitching motility protein; InterPro: IPR00632 96.76
TIGR00455 187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 96.03
COG1124 252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 95.69
pfam06414 191 Zeta_toxin Zeta toxin. This family consists of several 95.45
COG4185 187 Uncharacterized protein conserved in bacteria [Function 95.44
KOG0059 885 consensus 95.29
TIGR01192 592 chvA glucan exporter ATP-binding protein; InterPro: IPR 94.91
TIGR01184 230 ntrCD nitrate ABC transporter, ATP-binding proteins C a 93.01
COG1419 407 FlhF Flagellar GTP-binding protein [Cell motility and s 93.0
KOG0743 457 consensus 92.54
cd03115 173 SRP The signal recognition particle (SRP) mediates the 92.45
COG4172 534 ABC-type uncharacterized transport system, duplicated A 91.83
PRK05541 176 adenylylsulfate kinase; Provisional 91.77
COG0529 197 CysC Adenylylsulfate kinase and related kinases [Inorga 91.77
PRK03846 198 adenylylsulfate kinase; Provisional 90.81
cd03273 251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are 99.75
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. This m 99.71
cd03272 243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are 99.66
COG3593 581 Predicted ATP-dependent endonuclease of the OLD family 99.3
cd03278 197 ABC_SMC_barmotin Barmotin is a tight junction-associate 99.28
COG3950 440 Predicted ATP-binding protein involved in virulence [Ge 99.24
COG1106 371 Predicted ATPases [General function prediction only] 99.19
COG4717 984 Uncharacterized conserved protein [Function unknown] 99.18
COG4637 373 Predicted ATPase [General function prediction only] 98.94
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 98.6
COG3910 233 Predicted ATPase [General function prediction only] 98.48
COG4938 374 Uncharacterized conserved protein [Function unknown] 98.3
PRK04863 1486 mukB cell division protein MukB; Provisional 98.15
PRK09984 262 phosphonate/organophosphate ester transporter subunit; 98.1
pfam04310 227 MukB MukB N-terminal. This family represents the N-term 98.08
CHL00131 252 ycf16 sulfate ABC transporter protein; Validated 98.06
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 98.06
COG4674 249 Uncharacterized ABC-type transport system, ATPase compo 98.04
cd03234 226 ABCG_White The White subfamily represents ABC transport 98.04
PRK11300 255 livG leucine/isoleucine/valine transporter ATP-binding 98.02
PRK13638 271 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.02
TIGR00972 248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 98.02
PRK13543 214 cytochrome c biogenesis protein CcmA; Provisional 98.02
cd03264 211 ABC_drug_resistance_like ABC-type multidrug transport s 98.02
PRK11614 237 livF leucine/isoleucine/valine transporter ATP-binding 97.98
PRK13542 224 consensus 97.98
PRK10253 265 iron-enterobactin transporter ATP-binding protein; Prov 97.97
PRK13539 206 cytochrome c biogenesis protein CcmA; Provisional 97.96
PRK13544 208 consensus 97.95
PRK10744 257 phosphate transporter subunit; Provisional 97.94
PRK13548 257 hmuV hemin importer ATP-binding subunit; Provisional 97.94
PRK13547 273 hmuV hemin importer ATP-binding subunit; Provisional 97.94
PRK11231 255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 97.91
PRK13541 195 cytochrome c biogenesis protein CcmA; Provisional 97.9
PRK11831 269 putative ABC transporter ATP-binding protein YrbF; Prov 97.9
PRK10247 225 putative ABC transporter ATP-binding protein YbbL; Prov 97.89
PRK13538 204 cytochrome c biogenesis protein CcmA; Provisional 97.88
TIGR03411 242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 97.88
PRK10908 222 cell division protein FtsE; Provisional 97.88
PRK11701 258 phnK phosphonates transport ATP-binding protein; Provis 97.88
PRK03695 245 vitamin B12-transporter ATPase; Provisional 97.88
cd03298 211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 97.87
PRK10575 265 iron-hydroxamate transporter ATP-binding subunit; Provi 97.86
PRK09580 248 sufC cysteine desulfurase ATPase component; Reviewed 97.85
PRK09536 409 btuD corrinoid ABC transporter ATPase; Reviewed 97.85
cd03269 210 ABC_putative_ATPase This subfamily is involved in drug 97.84
cd03231 201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 97.83
COG4559 259 ABC-type hemin transport system, ATPase component [Inor 97.83
PRK13636 285 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.82
COG4604 252 CeuD ABC-type enterochelin transport system, ATPase com 97.82
PRK09544 251 znuC high-affinity zinc transporter ATPase; Reviewed 97.81
TIGR01978 248 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron 97.79
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 97.77
PRK13651 304 cobalt transporter ATP-binding subunit; Provisional 97.77
cd03235 213 ABC_Metallic_Cations ABC component of the metal-type tr 97.77
PRK10771 233 thiQ thiamine transporter ATP-binding subunit; Provisio 97.76
TIGR03410 230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 97.76
cd03217 200 ABC_FeS_Assembly ABC-type transport system involved in 97.76
PRK10895 241 putative ABC transporter ATP-binding protein YhbG; Prov 97.76
COG3839 338 MalK ABC-type sugar transport systems, ATPase component 97.76
COG1121 254 ZnuC ABC-type Mn/Zn transport systems, ATPase component 97.75
PRK11247 257 ssuB aliphatic sulfonates transport ATP-binding subunit 97.75
PRK13652 277 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.74
PRK13647 273 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.74
COG1131 293 CcmA ABC-type multidrug transport system, ATPase compon 97.74
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.73
cd03259 213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 97.73
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 97.72
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 97.72
COG4913 1104 Uncharacterized protein conserved in bacteria [Function 97.71
cd03226 205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 97.71
cd03260 227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 97.7
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 97.7
TIGR01189 204 ccmA heme ABC exporter, ATP-binding protein CcmA; Inter 97.7
cd03218 232 ABC_YhbG The ABC transporters belonging to the YhbG fam 97.7
PRK10619 257 histidine/lysine/arginine/ornithine transporter subunit 97.7
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 97.7
cd03224 222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 97.69
cd03220 224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 97.69
PRK13540 200 cytochrome c biogenesis protein CcmA; Provisional 97.69
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 97.68
PRK11144 352 modC molybdate transporter ATP-binding protein; Provisi 97.68
PRK11248 255 tauB taurine transporter ATP-binding subunit; Provision 97.67
TIGR03522 301 GldA_ABC_ATP gliding motility-associated ABC transporte 97.67
cd03268 208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 97.67
cd03267 236 ABC_NatA_like Similar in sequence to NatA, this is the 97.67
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.67
TIGR01188 343 drrA daunorubicin resistance ABC transporter, ATP-bindi 97.66
PRK09493 240 glnQ glutamine ABC transporter ATP-binding protein; Rev 97.66
cd03263 220 ABC_subfamily_A The ABCA subfamily mediates the transpo 97.65
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.64
PRK09700 510 D-allose transporter ATP-binding protein; Provisional 97.64
PRK13546 264 teichoic acids export protein ATP-binding subunit; Prov 97.64
cd03237 246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 97.63
TIGR02680 1416 TIGR02680 conserved hypothetical protein TIGR02680; Int 97.63
PRK13549 513 xylose transporter ATP-binding subunit; Provisional 97.62
cd03299 235 ABC_ModC_like Archeal protein closely related to ModC. 97.62
cd03266 218 ABC_NatA_sodium_exporter NatA is the ATPase component o 97.61
cd03265 220 ABC_DrrA DrrA is the ATP-binding protein component of a 97.61
cd03296 239 ABC_CysA_sulfate_importer Part of the ABC transporter c 97.61
cd03297 214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 97.61
cd03271 261 ABC_UvrA_II The excision repair protein UvrA domain II; 97.61
PRK11264 248 putative amino-acid ABC transporter ATP-binding protein 97.6
cd03225 211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 97.59
cd03257 228 ABC_NikE_OppD_transporters The ABC transporter subfamil 97.59
PRK13536 306 nodulation factor exporter subunit NodI; Provisional 97.59
PRK13639 275 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.58
PRK11629 233 lolD lipoprotein transporter ATP-binding subunit; Provi 97.58
PRK10762 501 D-ribose transporter ATP binding protein; Provisional 97.58
cd03256 241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 97.58
cd03233 202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 97.58
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 97.57
PRK13537 304 lipooligosaccharide transporter ATP-binding subunit; Pr 97.57
PRK10851 352 sulfate/thiosulfate transporter subunit; Provisional 97.56
PRK11288 501 araG L-arabinose transporter ATP-binding protein; Provi 97.56
COG0411 250 LivG ABC-type branched-chain amino acid transport syste 97.53
cd03219 236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 97.53
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 97.52
COG4133 209 CcmA ABC-type transport system involved in cytochrome c 97.51
PRK10938 490 putative molybdenum transport ATP-binding protein ModF; 97.5
COG0410 237 LivF ABC-type branched-chain amino acid transport syste 97.5
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 97.5
PRK13634 276 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.5
pfam12128 1192 DUF3584 Protein of unknown function (DUF3584). This pro 97.49
cd03255 218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 97.48
PRK09473 330 oppD oligopeptide transporter ATP-binding component; Pr 97.47
cd03290 218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 97.47
PRK10584 228 putative ABC transporter ATP-binding protein YbbA; Prov 97.46
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 97.45
cd03293 220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 97.45
TIGR00954 788 3a01203 Peroxysomal long chain fatty acyl transporter; 97.45
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 97.45
PRK10418 254 nikD nickel transporter ATP-binding protein; Provisiona 97.43
PRK09452 378 potA putrescine/spermidine ABC transporter ATPase prote 97.43
PRK11000 369 maltose/maltodextrin transporter ATP-binding protein; P 97.43
COG0396 251 sufC Cysteine desulfurase activator ATPase [Posttransla 97.43
PRK09700 510 D-allose transporter ATP-binding protein; Provisional 97.42
cd03300 232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 97.42
PRK11124 242 artP arginine transporter ATP-binding subunit; Provisio 97.41
cd03236 255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 97.41
cd03289 275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 97.4
cd03244 221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 97.39
cd03261 235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 97.38
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 97.37
cd03250 204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 97.36
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 97.35
PRK10982 491 galactose/methyl galaxtoside transporter ATP-binding pr 97.35
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 97.32
PRK11607 377 potG putrescine transporter ATP-binding subunit; Provis 97.31
PRK11147 632 ABC transporter ATPase component; Reviewed 97.31
PRK11147 632 ABC transporter ATPase component; Reviewed 97.3
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 97.3
cd03292 214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 97.27
PRK11153 343 metN DL-methionine transporter ATP-binding subunit; Pro 97.27
cd03254 229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 97.26
PRK11650 358 ugpC glycerol-3-phosphate transporter ATP-binding subun 97.26
TIGR03608 206 L_ocin_972_ABC putative bacteriocin export ABC transpor 97.26
cd03246173 ABCC_Protease_Secretion This family represents the ABC 97.26
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 97.26
cd03301 213 ABC_MalK_N The N-terminal ATPase domain of the maltose 97.24
cd03369 207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 97.23
TIGR02315 253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 97.23
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, ATPa 97.22
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 97.22
cd03295 242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 97.21
PRK11288 501 araG L-arabinose transporter ATP-binding protein; Provi 97.21
cd03245 220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 97.19
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 97.19
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 97.18
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 97.17
cd03248 226 ABCC_TAP TAP, the Transporter Associated with Antigen P 97.14
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 97.13
COG0488 530 Uup ATPase components of ABC transporters with duplicat 97.12
cd03288 257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 97.11
cd03253 236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 97.11
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 97.08
cd03251 234 ABCC_MsbA MsbA is an essential ABC transporter, closely 97.07
cd03249 238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 97.06
COG1129 500 MglA ABC-type sugar transport system, ATPase component 97.05
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 97.03
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provisiona 97.03
cd03270 226 ABC_UvrA_I The excision repair protein UvrA domain I; N 97.02
PRK10789 569 putative multidrug transporter membrane\ATP-binding com 96.99
cd03291 282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 96.99
COG1126 240 GlnQ ABC-type polar amino acid transport system, ATPase 96.98
COG4555 245 NatA ABC-type Na+ transport system, ATPase component [E 96.97
PRK10938 490 putative molybdenum transport ATP-binding protein ModF; 96.97
PRK13409 590 putative ATPase RIL; Provisional 96.95
PRK11022 327 dppD dipeptide transporter ATP-binding subunit; Provisi 96.95
COG5293 591 Predicted ATPase [General function prediction only] 96.94
cd03262 213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 96.93
cd03252 237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 96.92
TIGR02673 215 FtsE cell division ATP-binding protein FtsE; InterPro: 96.91
COG3842 352 PotA ABC-type spermidine/putrescine transport systems, 96.91
PRK11174 588 cysteine/glutathione ABC transporter membrane/ATP-bindi 96.91
pfam09818 447 ABC_ATPase Predicted ATPase of the ABC class. Members o 96.91
TIGR00929 931 VirB4_CagE type IV secretion/conjugal transfer ATPase, 96.9
COG1119 257 ModF ABC-type molybdenum transport system, ATPase compo 96.88
PRK13409 590 putative ATPase RIL; Provisional 96.88
TIGR00968 241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 96.88
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 96.88
cd03294 269 ABC_Pro_Gly_Bertaine This family comprises the glycine 96.88
TIGR02324 224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 96.88
PRK10982 491 galactose/methyl galaxtoside transporter ATP-binding pr 96.85
cd03243 202 ABC_MutS_homologs The MutS protein initiates DNA mismat 96.8
PRK10762 501 D-ribose transporter ATP binding protein; Provisional 96.79
PRK13549 513 xylose transporter ATP-binding subunit; Provisional 96.78
COG3845 501 ABC-type uncharacterized transport systems, ATPase comp 96.77
KOG0064 728 consensus 96.77
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 96.77
PRK13657 585 cyclic beta-1,2-glucan ABC transporter; Provisional 96.76
TIGR00630 956 uvra excinuclease ABC, A subunit; InterPro: IPR004602 A 96.73
COG1117 253 PstB ABC-type phosphate transport system, ATPase compon 96.72
KOG0927 614 consensus 96.72
PRK10522 547 multidrug transporter membrane component/ATP-binding co 96.71
TIGR02525 374 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IP 96.7
COG1136 226 SalX ABC-type antimicrobial peptide transport system, A 96.7
cd03283 199 ABC_MutS-like MutS-like homolog in eukaryotes. The MutS 96.69
PRK10070 400 glycine betaine transporter ATP-binding subunit; Provis 96.69
COG0488 530 Uup ATPase components of ABC transporters with duplicat 96.69
COG4138 248 BtuD ABC-type cobalamin transport system, ATPase compon 96.66
COG3638 258 ABC-type phosphate/phosphonate transport system, ATPase 96.64
COG4988 559 CydD ABC-type transport system involved in cytochrome b 96.62
cd03280 200 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes. Th 96.62
COG3096 1480 MukB Uncharacterized protein involved in chromosome par 96.6
PRK11308 327 dppF dipeptide transporter ATP-binding subunit; Provisi 96.56
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 96.56
TIGR01277 213 thiQ thiamine ABC transporter, ATP-binding protein; Int 96.55
cd03258 233 ABC_MetN_methionine_transporter MetN (also known as Yus 96.52
PRK10419 266 nikE nickel transporter ATP-binding protein; Provisiona 96.52
PTZ00243 1560 ABC transporter; Provisional 96.5
cd03285 222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS prot 96.48
COG4586 325 ABC-type uncharacterized transport system, ATPase compo 96.47
TIGR02857 570 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) 96.46
PRK11160 575 cysteine/glutathione ABC transporter membrane/ATP-bindi 96.45
cd03281 213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS prot 96.43
KOG0062 582 consensus 96.43
PRK11176 581 lipid transporter ATP-binding/permease protein; Provisi 96.43
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 96.42
COG1101 263 PhnK ABC-type uncharacterized transport system, ATPase 96.42
COG1134 249 TagH ABC-type polysaccharide/polyol phosphate transport 96.41
PRK10790 593 putative multidrug transporter membrane\ATP-binding com 96.4
TIGR02142 361 modC_ABC molybdate ABC transporter, ATP-binding protein 96.39
TIGR02633 501 xylG D-xylose ABC transporter, ATP-binding protein; Int 96.33
cd03284 216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS protein 96.27
TIGR02533 495 type_II_gspE general secretory pathway protein E; Inter 96.24
cd03287 222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS prot 96.21
cd03286 218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS prot 96.18
pfam00488 234 MutS_V MutS domain V. This domain is found in proteins 96.17
COG4152 300 ABC-type uncharacterized transport system, ATPase compo 96.16
COG4178 604 ABC-type uncharacterized transport system, permease and 96.12
smart00534 185 MUTSac ATPase domain of DNA mismatch repair MUTS family 96.1
TIGR02982 220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 96.07
pfam03193161 DUF258 Protein of unknown function, DUF258. 96.07
COG4615 546 PvdE ABC-type siderophore export system, fused ATPase a 96.02
PRK12289 351 ribosome-associated GTPase; Reviewed 96.0
COG1132 567 MdlB ABC-type multidrug transport system, ATPase and pe 95.95
TIGR00960 216 3a0501s02 Type II (General) Secretory Pathway (IISP) Fa 95.91
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 95.9
COG3044 554 Predicted ATPase of the ABC class [General function pre 95.89
smart00382148 AAA ATPases associated with a variety of cellular activ 95.88
COG3840 231 ThiQ ABC-type thiamine transport system, ATPase compone 95.87
COG2274 709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 95.87
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 95.81
KOG0065 1391 consensus 95.8
PRK10078 184 ribose 1,5-bisphosphokinase; Provisional 95.8
TIGR01194 555 cyc_pep_trnsptr cyclic peptide transporter; InterPro: I 95.8
PRK13853 789 type IV secretion system protein VirB4; Provisional 95.78
PRK12288344 ribosome-associated GTPase; Reviewed 95.77
COG4161 242 ArtP ABC-type arginine transport system, ATPase compone 95.75
cd03282 204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS prot 95.72
COG1162301 Predicted GTPases [General function prediction only] 95.68
PRK00098298 ribosome-associated GTPase; Reviewed 95.66
PRK13830 818 conjugal transfer protein TrbE; Provisional 95.66
KOG0058 716 consensus 95.65
TIGR03375 694 type_I_sec_LssB type I secretion system ATPase, LssB fa 95.64
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) r 95.61
KOG0061 613 consensus 95.59
TIGR02204 576 MsbA_rel ABC transporter, permease/ATP-binding protein; 95.58
TIGR02211 221 LolD_lipo_ex lipoprotein releasing system, ATP-binding 95.48
cd01131 198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 95.44
PRK00349 944 uvrA excinuclease ABC subunit A; Reviewed 95.43
PRK13898 800 type IV secretion system ATPase VirB4; Provisional 95.43
PRK00349 944 uvrA excinuclease ABC subunit A; Reviewed 95.42
COG1125 309 OpuBA ABC-type proline/glycine betaine transport system 95.41
KOG0927 614 consensus 95.36
COG1135 339 AbcC ABC-type metal ion transport system, ATPase compon 95.3
PRK13873 815 conjugal transfer ATPase TrbE; Provisional 95.29
KOG0060 659 consensus 95.28
COG1137 243 YhbG ABC-type (unclassified) transport system, ATPase c 95.22
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog [Gene 95.17
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 95.1
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 95.05
KOG0989 346 consensus 95.02
PRK00635 1809 excinuclease ABC subunit A; Provisional 95.01
KOG0054 1381 consensus 95.0
PRK00635 1809 excinuclease ABC subunit A; Provisional 94.99
PRK13891 852 conjugal transfer protein TrbE; Provisional 94.96
TIGR00630 956 uvra excinuclease ABC, A subunit; InterPro: IPR004602 A 94.95
KOG2355 291 consensus 94.94
TIGR02868 566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 94.93
COG2805 353 PilT Tfp pilus assembly protein, pilus retraction ATPas 94.85
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog [Gene 94.84
COG3596 296 Predicted GTPase [General function prediction only] 94.84
pfam08298 358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 94.73
KOG0055 1228 consensus 94.7
COG2804 500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 94.66
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 94.64
PRK10436 461 hypothetical protein; Provisional 94.6
cd01129 264 PulE-GspE PulE/GspE The type II secretory pathway is th 94.59
COG4148 352 ModC ABC-type molybdate transport system, ATPase compon 94.57
COG4694 758 Uncharacterized protein conserved in bacteria [Function 94.55
COG0194 191 Gmk Guanylate kinase [Nucleotide transport and metaboli 94.54
TIGR00956 1466 3a01205 Pleiotropic Drug Resistance (PDR) Family protei 94.49
PRK12726 407 flagellar biosynthesis regulator FlhF; Provisional 94.48
COG1127 263 Ttg2A ABC-type transport system involved in resistance 94.41
pfam00625 182 Guanylate_kin Guanylate kinase. 94.4
COG0444 316 DppD ABC-type dipeptide/oligopeptide/nickel transport s 94.33
TIGR03263 180 guanyl_kin guanylate kinase. Members of this family are 94.28
PTZ00265 1467 multidrug resistance protein (mdr1); Provisional 94.25
TIGR02782 315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 94.23
TIGR02788 328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 94.12
cd01130 186 VirB11-like_ATPase Type IV secretory pathway component 94.11
TIGR00955 671 3a01204 Pigment precourser permease; InterPro: IPR00528 94.08
PRK06731 270 flhF flagellar biosynthesis regulator FlhF; Validated 94.06
COG2884 223 FtsE Predicted ATPase involved in cell division [Cell d 93.99
KOG0066 807 consensus 93.98
PTZ00243 1560 ABC transporter; Provisional 93.96
TIGR01186 372 proV glycine betaine/L-proline transport ATP binding su 93.9
PRK00300 208 gmk guanylate kinase; Provisional 93.86
COG1123 539 ATPase components of various ABC-type transport systems 93.76
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 93.76
COG1123 539 ATPase components of various ABC-type transport systems 93.66
PTZ00265 1467 multidrug resistance protein (mdr1); Provisional 93.6
PRK05399 848 DNA mismatch repair protein; Provisional 93.59
PRK13900 332 type IV secretion system ATPase VirB11; Provisional 93.55
TIGR02538 577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 93.52
COG3451 796 VirB4 Type IV secretory pathway, VirB4 components [Intr 93.42
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 93.36
PRK13851 343 type IV secretion system protein VirB11; Provisional 93.3
COG4525 259 TauB ABC-type taurine transport system, ATPase componen 93.26
PRK13833 323 conjugal transfer protein TrbB; Provisional 93.23
COG4167 267 SapF ABC-type antimicrobial peptide transport system, A 93.23
pfam00448 196 SRP54 SRP54-type protein, GTPase domain. This family in 93.17
COG4107 258 PhnK ABC-type phosphonate transport system, ATPase comp 93.12
COG4619 223 ABC-type uncharacterized transport system, ATPase compo 93.01
pfam00308 219 Bac_DnaA Bacterial dnaA protein. 92.96
PRK01889353 ribosome-associated GTPase; Reviewed 92.94
pfam00485 196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 92.93
PRK11784 333 tRNA 2-selenouridine synthase; Provisional 92.83
COG4608 268 AppF ABC-type oligopeptide transport system, ATPase com 92.68
cd02028 179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 92.66
pfam09439 181 SRPRB Signal recognition particle receptor beta subunit 92.63
PRK05480 209 uridine kinase; Provisional 92.62
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00176">TIGR00176 165 mobB molybdopterin-guanine dinucleotide biosynthesis pr 92.6
TIGR00064 284 ftsY signal recognition particle-docking protein FtsY; 92.56
cd02023 198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 92.55
TIGR02203 603 MsbA_lipidA lipid A export permease/ATP-binding protein 92.5
TIGR02237 223 recomb_radB DNA repair and recombination protein RadB; 92.41
PRK13768 253 GTPase; Provisional 92.24
KOG0066 807 consensus 92.2
COG0249 843 MutS Mismatch repair ATPase (MutS family) [DNA replicat 92.16
PRK13894 320 conjugal transfer ATPase TrbB; Provisional 92.14
KOG0054 1381 consensus 92.12
PRK09270 230 frcK putative fructose transport system kinase; Reviewe 92.08
PRK04195 403 replication factor C large subunit; Provisional 92.05
smart00072 184 GuKc Guanylate kinase homologues. Active enzymes cataly 92.04
cd04105 203 SR_beta Signal recognition particle receptor, beta subu 92.03
PRK00091 304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 91.89
TIGR00382 452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 91.89
TIGR02322 183 phosphon_PhnN phosphonate metabolism protein/1,5-bispho 91.84
COG0178 935 UvrA Excinuclease ATPase subunit [DNA replication, reco 91.82
cd02026 273 PRK Phosphoribulokinase (PRK) is an enzyme involved in 91.66
COG4598 256 HisP ABC-type histidine transport system, ATPase compon 91.66
pfam02456 370 Adeno_IVa2 Adenovirus IVa2 protein. IVa2 protein can in 91.59
COG0552 340 FtsY Signal recognition particle GTPase [Intracellular 91.48
TIGR01846 703 type_I_sec_HlyB type I secretion system ATPase; InterPr 91.45
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 91.44
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 91.41
TIGR03005 256 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, AT 91.39
TIGR01842 556 type_I_sec_PrtD type I secretion system ATPase; InterPr 91.32
cd04163 168 Era Era subfamily. Era (E. coli Ras-like protein) is a 91.32
COG0572 218 Udk Uridine kinase [Nucleotide transport and metabolism 91.31
PRK07429 331 phosphoribulokinase; Provisional 91.26
PRK09435 325 arginine/ornithine transport system ATPase; Provisional 91.22
TIGR00150147 TIGR00150 conserved hypothetical protein TIGR00150; Int 91.2
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 91.14
COG4778 235 PhnL ABC-type phosphonate transport system, ATPase comp 91.13
PRK08356 195 hypothetical protein; Provisional 91.11
TIGR00041 211 DTMP_kinase thymidylate kinase; InterPro: IPR000062 Thy 91.07
PRK08233 182 hypothetical protein; Provisional 91.03
COG0630 312 VirB11 Type IV secretory pathway, VirB11 components, an 90.98
TIGR00750 333 lao LAO/AO transport system ATPase; InterPro: IPR005129 90.97
COG5008 375 PilU Tfp pilus assembly protein, ATPase PilU [Cell moti 90.92
cd02025 220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 90.8
PRK00089 296 era GTP-binding protein Era; Reviewed 90.78
COG3709 192 Uncharacterized component of phosphonate metabolism [In 90.77
cd01673 193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phos 90.67
TIGR01070 863 mutS1 DNA mismatch repair protein MutS; InterPro: IPR00 90.6
PRK11545 177 gntK gluconate kinase 1; Provisional 90.59
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 90.58
pfam00009 185 GTP_EFTU Elongation factor Tu GTP binding domain. This 90.4
cd00879 190 Sar1 Sar1 subfamily. Sar1 is an essential component of 90.39
KOG0073 185 consensus 90.37
cd01886 270 EF-G Elongation factor G (EF-G) subfamily. Translocatio 95.64
PRK00440 318 rfc replication factor C small subunit; Reviewed 95.07
cd04170 268 EF-G_bact Elongation factor G (EF-G) subfamily. Translo 94.52
cd04169 267 RF3 RF3 subfamily. Peptide chain release factor 3 (RF3) 94.45
cd04168 237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), Tet(W) 94.43
PRK08118 167 topology modulation protein; Reviewed 93.27
cd04104 197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase famil 93.1
PRK12402 337 replication factor C small subunit 2; Reviewed 93.09
cd03114148 ArgK-like The function of this protein family is unkown 93.03
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 93.01
pfam00004131 AAA ATPase family associated with various cellular acti 92.71
pfam00350 168 Dynamin_N Dynamin family. 92.49
cd01890 179 LepA LepA subfamily. LepA belongs to the GTPase family 92.25
cd04162 164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 (Arf- 92.09
PRK07261 171 topology modulation protein; Provisional 91.99
COG0563 178 Adk Adenylate kinase and related kinases [Nucleotide tr 91.74
TIGR01187 331 potA polyamine ABC transporter, ATP-binding protein; In 91.69
cd00881 189 GTP_translation_factor GTP translation factor family. T 91.68
pfam10662143 PduV-EutP Ethanolamine utilisation - propanediol utilis 91.58
cd01891 194 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA 91.5
cd01883 219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha su 91.48
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 91.39
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 91.08
TIGR01313 175 therm_gnt_kin carbohydrate kinase, thermoresistant gluc 91.02
cd04160 167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 90.97
PRK06217 185 hypothetical protein; Validated 90.9
pfam07726131 AAA_3 ATPase family associated with various cellular ac 90.85
cd04157 162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 90.84
pfam00735 280 Septin Septin. Members of this family include CDC3, CDC 90.73
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes to the 90.6
cd04177 168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the Rap s 90.43
cd01896 233 DRG The developmentally regulated GTP-binding protein ( 91.66
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC; InterPro: IPR011890 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC; InterPro: IPR011891 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea Back     alignment and domain information
>pfam02463 SMC_N RecF/RecN/SMC N terminal domain Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0018 consensus Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR00611 recf DNA replication and repair protein RecF; InterPro: IPR001238 All proteins in this family, including recF, for which functions are known are DNA binding proteins that assist the filamentation of RecA onto DNA for the initiation of recombination or recombinational repair Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0996 consensus Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>KOG0979 consensus Back     alignment and domain information
>KOG0250 consensus Back     alignment and domain information
>TIGR00606 rad50 rad50; InterPro: IPR004584 Rad50 is involved in recombination, recombinational repair, and/or non-homologous end joining Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>KOG0964 consensus Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0933 consensus Back     alignment and domain information
>KOG0962 consensus Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN; InterPro: IPR004604 DNA repair protein RecN is thought to be DNA damage inducible and involved in recombinational processes Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt ABC transporter, ATP-binding protein; InterPro: IPR005876 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information