254780641

254780641

hypothetical protein CLIBASIA_02640

GeneID in NCBI database:8209642Locus tag:CLIBASIA_02640
Protein GI in NCBI database:254780641Protein Accession:YP_003065054.1
Gene range:-(627893, 628258)Protein Length:121aa
Gene description:hypothetical protein
COG prediction:[D] Chromosome segregation ATPases
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MQISAKIEFLDGQKYTIARQMHEKGEGSFTLIDDIPSGNDFKTIGAQSLEFFYPVVAQKELQSFIHITPKNRRDKLSDILGFGEMTSLKTALRELQQSLQSRKPNMVSAAMDPLKKCVGTR
ccccEEEEEEccccHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccc
ccEEEEEEEccccHHHHHHHHHccccccEEEEcccccccccHHHccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHccccHHHccccc
mqisakiefldgqKYTIARQMhekgegsftliddipsgndfktigaqsleFFYPVVAQKELQSfihitpknrrdklsdilgfgeMTSLKTALRELQQSLQsrkpnmvsaamdplkkcvgtr
mqisakiefldgqKYTIARQMHEKGEGSFTLIDDIPSGNDFKTIGAQSLEFFYPVVAQKELQsfihitpknrrdKLSDILGFGEMTSLKTALRELQQSlqsrkpnmvsaamdplkkcvgtr
MQISAKIEFLDGQKYTIARQMHEKGEGSFTLIDDIPSGNDFKTIGAQSLEFFYPVVAQKELQSFIHITPKNRRDKLSDILGFGEMTSLKTALRELQQSLQSRKPNMVSAAMDPLKKCVGTR
****AKI*FLDGQKYTIARQM*EKGEGSFTLIDDIPSGNDFKTIGAQSLEFFYPVVAQKELQSFIHITPKNRRDKLSDILGFGEMTSLKTA******************AMDPLKKCVG**
MQISAKIEFLDGQKYTIARQMHEKGEGSFTLIDDIPSGNDFKTIGAQSLEFFYPVVAQKELQSFIHITPKNRRDKLSDILGFGEMTSLKTALRELQQSLQSRKPNMVSAAMDPLKKCVGTR
*QISAKIEFLDGQKYTIARQMHEKGEGSFTLIDDIPSGNDFKTIGAQSLEFFYPVVAQKELQSFIHITPKNRRDKLSDILGFGEMTSLKTALRELQQSLQSR*******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQISAKIEFLDGQKYTIARQMHEKGEGSFTLIDDIPSGNDFKTIGAQSLEFFYPVVAQKELQSFIHITPKNRRDKLSDILGFGEMTSLKTALRELQQSLQSRKPNMVSAAMDPLKKCVGTR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

No hits with e-value below 0.005 within the first 2 iteration


Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target121 hypothetical protein CLIBASIA_02640 [Candidatus Liberib
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 2e-04
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
 Score = 39.2 bits (90), Expect = 2e-04
 Identities = 10/29 (34%), Positives = 16/29 (55%), Gaps = 5/29 (17%)

Query: 89  KTALRELQQSLQ----SRKPNM-VSAAMD 112
           K AL++LQ SL+       P + + A M+
Sbjct: 19  KQALKKLQASLKLYADDSAPALAIKATME 47


Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00