254780648

254780648

GTPase ObgE

GeneID in NCBI database:8209650Locus tag:CLIBASIA_02675
Protein GI in NCBI database:254780648Protein Accession:YP_003065061.1
Gene range:-(623661, 624668)Protein Length:335aa
Gene description:GTPase ObgE
COG prediction:[R] Predicted GTPase
KEGG prediction:obgE; GTPase ObgE; K03979 GTP-binding protein
SEED prediction:GTP-binding protein Obg
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Universal GTPases;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-----
MKFLDEAKVYIRSGDGGAGGISFRREKFIEFGGPDGGSGGRGGDVWIQATSNLNTLIDFRYQQHFKAQHGEKGMKRNRSGAKGEDVVLTVPVGTQVFEEDGISLICDLDQEGQRIILAPGGNGGFGNAHFKSSTNQAPYYANPGILGQEKIIWLKLKLIADIGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEGYKEFILADIPGIIKNAHQGAGIGDRFLKHTERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELATQCGQVPFEFSSITGHGIPQILECLHDKIFSIRGENEF
ccccEEEEEEEEEcccccccEEcHHccccccccccccccccccEEEEEEccccccHHHEEEEEEEEccccccccccccccccccEEEEEcccccEEEEccccEEEEEEEcccEEEEEEcccccccccccccccccccccHHHcccccHHHHHHHHcccccEEEEEEcccccHHHHHHHHHccccEEcccccccEEEEEEEEEEccEEEEEEEccccccccHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHHccHHccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHccccccc
cccccEEEEEEEEccccccEEEEEEcEEEcccccccccccccccEEEEEccccccEEEEEHHHEEEcccccccccccccccccccEEEEccccEEEEEccccEEEEEccccccEEEEEEcccccccccEEccccccccccccccccccHHEEEEEHHHHHcccccccccccHHHHHHHHHHccccccccccccccccccEEEEcccEEEEEccccHHcccHccccHHHHHHHHHHHcHEEEEEEccccccHHHHHHHHHHHHHHHcHHHHccccEEEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHccHHHHc
MKFLDEAKVYIrsgdggaggiSFRREKFiefggpdggsggrggdVWIQATSNLNTLIDFRYQQHFKAqhgekgmkrnrsgakgedvvltvpvgtqvfeedGISLICDldqegqriilapggnggfgnahfksstnqapyyanpgilgQEKIIWLKLKLIADIgiiglpnagkstFLASVtrakpkiadypfttlypnlgivkeGYKEFILADIPgiiknahqgagigdrflkhTERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIvglsqidtvdsdTLARKKNELatqcgqvpfefssitghgipQILECLHDKIFSIRGENEF
MKFLDEAKvyirsgdggaggiSFRREKFIEFGGPDGGSGGRGGDVWIQATSNLNTLIDFRYQQHFKAQhgekgmkrnrsgakgedvVLTVPVGTQVFEEDGISLICDLDQEGQRIILAPGGNGGFGNAHFKSSTNQAPYYANPGILGQEKIIWLKLKLIADIGIIGLPNAGKSTFLASVTRakpkiadypfttlypnLGIVKEGYKEFILADIPGIIKNAHQGAGIGDRFLKHTERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEivglsqidtvdsDTLARKKNELATQCGQVPFEFSSITGHGIPQILECLHDKIFSIRGENEF
MKFLDEAKVYIRSGDGGAGGISFRREKFIEFggpdggsggrggDVWIQATSNLNTLIDFRYQQHFKAQHGEKGMKRNRSGAKGEDVVLTVPVGTQVFEEDGISLICDLDQEGQRIILAPGGNGGFGNAHFKSSTNQAPYYANPGILGQEKIIWLKLKLIADIGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEGYKEFILADIPGIIKNAHQGAGIGDRFLKHTERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELATQCGQVPFEFSSITGHGIPQILECLHDKIFSIRGENEF
MKFLDEAKVYIRSGDGGAGGISFRREKFIEFGGPDGGSGGRGGDVWIQATSNLNTLIDFRYQ***********************VVLTVPVGTQVFEEDGISLICDLDQEGQRIILAPGGNGGFGNAHFKSSTNQAPYY***GILGQEKIIWLKLKLIADIGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEGYKEFILADIPGIIKNAHQGAGIGDRFLKHTERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELATQCGQVPFEFSSITGHGIPQILECLHDKIFSI******
MKFLDEAKVYIRSGDGGAGGISFRREKFIEFGGPDGGSGGRGGDVWIQATSNLNTLIDFRYQQHF*****************GEDVVLTVPVGTQVFEEDGISLICDLDQEGQRIILAPGGNGGFGNAHFKSSTNQAPYYANPGILGQEKIIWLKLKLIADIGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEGYKEFILADIPGIIKNAHQGAGIGDRFLKHTERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELATQCGQVPFEFSSITGHGIPQILECLHDKIFSIRGENEF
*KFLDEAKVYIRSGDGGAGGISFRREKFIEFGGPDGGSGGRGGDVWIQATSNLNTLIDFRYQQHFKAQHGEKGMKRNRSGAKGEDVVLTVPVGTQVFEEDGISLICDLDQEGQRIILAPGGNGGFGNAHFKSSTNQAPYYANPGILGQEKIIWLKLKLIADIGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEGYKEFILADIPGIIKNAHQGAGIGDRFLKHTERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELATQCGQVPFEFSSITGHGIPQILECLHDKIFSIRGE***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKFLDEAKVYIRSGDGGAGGISFRREKFIEFGGPDGGSGGRGGDVWIQATSNLNTLIDFRYQQHFKAQHGEKGMKRNRSGAKGEDVVLTVPVGTQVFEEDGISLICDLDQEGQRIILAPGGNGGFGNAHFKSSTNQAPYYANPGILGQEKIIWLKLKLIADIGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEGYKEFILADIPGIIKNAHQGAGIGDRFLKHTERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELATQCGQVPFEFSSITGHGIPQILECLHDKIFSIRGENEF
MKFLDEAKVYIRSGDGGAGGISFRREKFIEFGGPDGGSGGRGGDVWIQATSNLNTLIDFRYQQHFKAQHGEKGMKRNRSGAKGEDVVLTVPVGTQVFEEDGISLICDLDQEGQRIILAPGGNGGFGNAHFKSSTNQAPYYANPGILGQEKIIWLKLKLIADIGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEGYKEFILADIPGIIKNAHQGAGIGDRFLKHTERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELATQCGQVPFEFSSITGHGIPQILECLHDKIFSIRGENEF
MKFLDEAKVYIRSGDGGAGGISFRREKFIEFGGPDGGSGGRGGDVWIQATSNLNTLIDFRYQQHFKAQHGEKGMKRNRSGAKGEDVVLTVPVGTQVFEEDGISLICDLDQEGQRIILAPGGNGGFGNAHFKSSTNQAPYYANPGILGQEKIIWLKLKLIADIGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEGYKEFILADIPGIIKNAHQGAGIGDRFLKHTERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELATQCGQVPFEFSSITGHGIPQILECLHDKIFSIRGENEF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target335 GTPase ObgE [Candidatus Liberibacter asiaticus str. psy
254780226 367 translation-associated GTPase [Candidatus Liberiba 6e-12
254780941 311 GTP-binding protein Era [Candidatus Liberibacter a 7e-05
255764471 470 GTP-binding protein EngA [Candidatus Liberibacter 0.045
>gi|254780226|ref|YP_003064639.1| translation-associated GTPase [Candidatus Liberibacter asiaticus str. psy62] Length = 367 Back     alignment
 Score = 63.2 bits (152), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 57/108 (52%), Gaps = 19/108 (17%)

Query: 163 GIIGLPNAGKSTFLASVTR-AKPKIADYPFTTLYPNLGIVK------------EGYKEFI 209
           GIIGLPN GKST   ++TR A  + A+YPF T+ PN G V                K+ +
Sbjct: 6   GIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLV 65

Query: 210 -----LADIPGIIKNAHQGAGIGDRFLKHTERTHVLLHIVSAL-EENV 251
                  DI G+++ A +G G+G++FL H      ++H++    +EN+
Sbjct: 66  PTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENI 113

>gi|254780941|ref|YP_003065354.1| GTP-binding protein Era [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Back     alignment
 Score = 39.7 bits (91), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 78/168 (46%), Gaps = 17/168 (10%)

Query: 162 IGIIGLPNAGKSTFLASVTRAKPKIADYPF-TTLYPNLGIVKEGYKEFILADIPGII--K 218
           + ++G  NAGKST +     AK  I  +   TT     GIV E   + +  D PGI   K
Sbjct: 25  VALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKESQIVFLDTPGIFNAK 84

Query: 219 NAHQGAGIGDRF--LKHTERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIV 276
           +++    I   +  +KH +   +++     L+ N+      +L E++  +S L     I+
Sbjct: 85  DSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHD----LLKEIAKRSSRL-----IL 135

Query: 277 GLSQIDTVDSDTLARKKNELATQCGQV--PFEFSSITGHGIPQILECL 322
            L++ID V  + L  ++ E+A +   +   F  S+  GHG   +L  L
Sbjct: 136 ILNKIDCVKPERLL-EQAEIANKLVFIEKTFMVSATKGHGCDDVLNYL 182

>gi|255764471|ref|YP_003064835.2| GTP-binding protein EngA [Candidatus Liberibacter asiaticus str. psy62] Length = 470 Back     alignment
 Score = 30.4 bits (67), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 11/72 (15%)

Query: 158 LIADIGIIGLPNAGKSTFLASVTRAKPKIA-DYPFTTLYPNLGIVKEGYKEFILADIPGI 216
           +I  I I+G PN GKST    + + K  +  ++P        GI ++  + +  A I G+
Sbjct: 1   MIYTIAIVGAPNVGKSTLFNRLVKKKMAVVGNHP--------GITRD--RLYGQAIINGV 50

Query: 217 IKNAHQGAGIGD 228
           I N    AGI D
Sbjct: 51  IFNIVDTAGIAD 62

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target335 GTPase ObgE [Candidatus Liberibacter asiaticus str. psy
315122166331 GTPase ObgE [Candidatus Liberibacter solanacearum CLso- 1 1e-159
86359645363 GTPase ObgE [Rhizobium etli CFN 42] Length = 363 1 1e-122
190893919362 GTP-binding protein [Rhizobium etli CIAT 652] Length = 1 1e-121
116254405364 GTPase ObgE [Rhizobium leguminosarum bv. viciae 3841] L 1 1e-115
209551445364 GTPase ObgE [Rhizobium leguminosarum bv. trifolii WSM23 1 1e-114
163761373367 putative gtp-binding protein [Hoeflea phototrophica DFL 1 1e-114
241206882364 GTPase ObgE [Rhizobium leguminosarum bv. trifolii WSM13 1 1e-114
13473421343 GTPase ObgE [Mesorhizobium loti MAFF303099] Length = 34 1 1e-114
222087876371 GTP-binding protein Obg/CgtA [Agrobacterium radiobacter 1 1e-114
319780946343 GTP-binding protein Obg/CgtA [Mesorhizobium ciceri biov 1 1e-113
>gi|315122166|ref|YP_004062655.1| GTPase ObgE [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 331 Back     alignment and organism information
 Score =  566 bits (1460), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 288/330 (87%), Positives = 308/330 (93%)

Query: 1   MKFLDEAKVYIRSGDGGAGGISFRREKFIEFGGPDGGSGGRGGDVWIQATSNLNTLIDFR 60
           MKFLDEAKVYIRSGDGGAGGISFRREKFIEFGGPDGGSGGRGGD+WI+A +NLNTL+D+R
Sbjct: 1   MKFLDEAKVYIRSGDGGAGGISFRREKFIEFGGPDGGSGGRGGDIWIKAINNLNTLVDYR 60

Query: 61  YQQHFKAQHGEKGMKRNRSGAKGEDVVLTVPVGTQVFEEDGISLICDLDQEGQRIILAPG 120
           YQQHFKAQ G KGMKRNR+GAKG DVVLTVPVGTQVFEED  SLICDLDQEGQ ++LAPG
Sbjct: 61  YQQHFKAQSGTKGMKRNRTGAKGSDVVLTVPVGTQVFEEDRTSLICDLDQEGQCVLLAPG 120

Query: 121 GNGGFGNAHFKSSTNQAPYYANPGILGQEKIIWLKLKLIADIGIIGLPNAGKSTFLASVT 180
           GNGGFGN HFKSSTNQ+P YAN GI GQEKIIWLKLKLIADIGIIGLPNAGKSTFLASVT
Sbjct: 121 GNGGFGNLHFKSSTNQSPRYANLGIPGQEKIIWLKLKLIADIGIIGLPNAGKSTFLASVT 180

Query: 181 RAKPKIADYPFTTLYPNLGIVKEGYKEFILADIPGIIKNAHQGAGIGDRFLKHTERTHVL 240
           RAKPKIADYPFTTLYPNLGI K GY+EF+LADIPGIIKNAH+GAGIGDRFLKHTERT++L
Sbjct: 181 RAKPKIADYPFTTLYPNLGIAKVGYEEFVLADIPGIIKNAHKGAGIGDRFLKHTERTYIL 240

Query: 241 LHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELATQC 300
           LHI+SALEEN+Q AYQ IL EL +YNSELR+KIEIVGLSQIDTVDSDTL RKKNELA+ C
Sbjct: 241 LHIISALEENIQEAYQSILHELHSYNSELRQKIEIVGLSQIDTVDSDTLIRKKNELASIC 300

Query: 301 GQVPFEFSSITGHGIPQILECLHDKIFSIR 330
           GQ+PF FSSITG GIPQILECLHDKI SIR
Sbjct: 301 GQMPFAFSSITGSGIPQILECLHDKIVSIR 330


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86359645|ref|YP_471537.1| GTPase ObgE [Rhizobium etli CFN 42] Length = 363 Back     alignment and organism information
>gi|190893919|ref|YP_001980461.1| GTP-binding protein [Rhizobium etli CIAT 652] Length = 362 Back     alignment and organism information
>gi|116254405|ref|YP_770243.1| GTPase ObgE [Rhizobium leguminosarum bv. viciae 3841] Length = 364 Back     alignment and organism information
>gi|209551445|ref|YP_002283362.1| GTPase ObgE [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 364 Back     alignment and organism information
>gi|163761373|ref|ZP_02168447.1| putative gtp-binding protein [Hoeflea phototrophica DFL-43] Length = 367 Back     alignment and organism information
>gi|241206882|ref|YP_002977978.1| GTPase ObgE [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 364 Back     alignment and organism information
>gi|13473421|ref|NP_104988.1| GTPase ObgE [Mesorhizobium loti MAFF303099] Length = 343 Back     alignment and organism information
>gi|222087876|ref|YP_002546414.1| GTP-binding protein Obg/CgtA [Agrobacterium radiobacter K84] Length = 371 Back     alignment and organism information
>gi|319780946|ref|YP_004140422.1| GTP-binding protein Obg/CgtA [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 343 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target335 GTPase ObgE [Candidatus Liberibacter asiaticus str. psy
PRK12299335 PRK12299, obgE, GTPase CgtA; Reviewed 1e-153
TIGR02729329 TIGR02729, Obg_CgtA, Obg family GTPase CgtA 1e-139
PRK12298390 PRK12298, obgE, GTPase CgtA; Reviewed 1e-127
PRK12297424 PRK12297, obgE, GTPase CgtA; Reviewed 1e-121
PRK12296 500 PRK12296, obgE, GTPase CgtA; Reviewed 3e-88
KOG1489366 KOG1489, KOG1489, KOG1489, Predicted GTP-binding protei 3e-74
COG0536369 COG0536, Obg, Predicted GTPase [General function predic 1e-123
pfam01018156 pfam01018, GTP1_OBG, GTP1/OBG 4e-59
cd01898170 cd01898, Obg, Obg subfamily 5e-58
cd01881176 cd01881, Obg_like, The Obg-like subfamily consists of f 1e-41
KOG1491 391 KOG1491, KOG1491, KOG1491, Predicted GTP-binding protei 5e-18
cd01897168 cd01897, NOG, NOG1 is a nucleolar GTP-binding protein p 6e-14
COG1084346 COG1084, COG1084, Predicted GTPase [General function pr 5e-13
cd00880163 cd00880, Era_like, Era (E 2e-12
COG1159 298 COG1159, Era, GTPase [General function prediction only] 5e-09
COG2262411 COG2262, HflX, GTPases [General function prediction onl 8e-09
PRK11058426 PRK11058, PRK11058, GTPase HflX; Provisional 5e-08
cd04163168 cd04163, Era, Era subfamily 1e-07
KOG1490 620 KOG1490, KOG1490, KOG1490, GTP-binding protein CRFG/NOG 1e-07
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [Inorgan 2e-07
PRK00089 292 PRK00089, era, GTPase Era; Reviewed 4e-06
TIGR00231161 TIGR00231, small_GTP, small GTP-binding protein domain 2e-05
TIGR03156351 TIGR03156, GTP_HflX, GTP-binding protein HflX 3e-05
COG1160 444 COG1160, COG1160, Predicted GTPases [General function p 4e-05
cd01879158 cd01879, FeoB, Ferrous iron transport protein B (FeoB) 4e-05
COG1160444 COG1160, COG1160, Predicted GTPases [General function p 3e-04
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA 3e-04
KOG0410410 KOG0410, KOG0410, KOG0410, Predicted GTP binding protei 4e-04
pfam02421188 pfam02421, FeoB_N, Ferrous iron transport protein B 7e-04
cd01878204 cd01878, HflX, HflX subfamily 0.002
cd00882157 cd00882, Ras_like_GTPase, Ras-like GTPase superfamily 0.002
COG0012 372 COG0012, COG0012, Predicted GTPase, probable translatio 2e-20
cd01899 318 cd01899, Ygr210, Ygr210 subfamily 2e-19
PRK09602 396 PRK09602, PRK09602, translation-associated GTPase; Revi 1e-17
PRK09601 364 PRK09601, PRK09601, GTP-binding protein YchF; Reviewed 2e-17
pfam01926106 pfam01926, MMR_HSR1, GTPase of unknown function 8e-17
cd01900274 cd01900, YchF, YchF subfamily 2e-16
PTZ00258 390 PTZ00258, PTZ00258, GTP-binding protein; Provisional 6e-15
cd01896233 cd01896, DRG, The developmentally regulated GTP-binding 1e-14
KOG1486 364 KOG1486, KOG1486, KOG1486, GTP-binding protein DRG2 (OD 2e-11
TIGR00092 368 TIGR00092, TIGR00092, GTP-binding protein YchF 2e-07
KOG1487 358 KOG1487, KOG1487, KOG1487, GTP-binding protein DRG1 (OD 1e-06
TIGR00436270 TIGR00436, era, GTP-binding protein Era 4e-06
cd01895174 cd01895, EngA2, EngA2 subfamily 0.003
COG1163 365 COG1163, DRG, Predicted GTPase [General function predic 3e-16
KOG1423379 KOG1423, KOG1423, KOG1423, Ras-like GTPase ERA [Cell cy 4e-08
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 0.003
>gnl|CDD|183417 PRK12299, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|162989 TIGR02729, Obg_CgtA, Obg family GTPase CgtA Back     alignment and domain information
>gnl|CDD|183416 PRK12298, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|183415 PRK12297, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|183414 PRK12296, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|36702 KOG1489, KOG1489, KOG1489, Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|30882 COG0536, Obg, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|110047 pfam01018, GTP1_OBG, GTP1/OBG Back     alignment and domain information
>gnl|CDD|133298 cd01898, Obg, Obg subfamily Back     alignment and domain information
>gnl|CDD|133281 cd01881, Obg_like, The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|36704 KOG1491, KOG1491, KOG1491, Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|133297 cd01897, NOG, NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>gnl|CDD|31281 COG1084, COG1084, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|133256 cd00880, Era_like, Era (E Back     alignment and domain information
>gnl|CDD|31353 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|32443 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|182934 PRK11058, PRK11058, GTPase HflX; Provisional Back     alignment and domain information
>gnl|CDD|133363 cd04163, Era, Era subfamily Back     alignment and domain information
>gnl|CDD|36703 KOG1490, KOG1490, KOG1490, GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|30719 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|178854 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|161778 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|163162 TIGR03156, GTP_HflX, GTP-binding protein HflX Back     alignment and domain information
>gnl|CDD|31354 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|133280 cd01879, FeoB, Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>gnl|CDD|31354 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|163343 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|35631 KOG0410, KOG0410, KOG0410, Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|145523 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|133279 cd01878, HflX, HflX subfamily Back     alignment and domain information
>gnl|CDD|133258 cd00882, Ras_like_GTPase, Ras-like GTPase superfamily Back     alignment and domain information
>gnl|CDD|30362 COG0012, COG0012, Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133299 cd01899, Ygr210, Ygr210 subfamily Back     alignment and domain information
>gnl|CDD|181982 PRK09602, PRK09602, translation-associated GTPase; Reviewed Back     alignment and domain information
>gnl|CDD|181981 PRK09601, PRK09601, GTP-binding protein YchF; Reviewed Back     alignment and domain information
>gnl|CDD|145217 pfam01926, MMR_HSR1, GTPase of unknown function Back     alignment and domain information
>gnl|CDD|133300 cd01900, YchF, YchF subfamily Back     alignment and domain information
>gnl|CDD|185530 PTZ00258, PTZ00258, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|133296 cd01896, DRG, The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>gnl|CDD|36699 KOG1486, KOG1486, KOG1486, GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|129200 TIGR00092, TIGR00092, GTP-binding protein YchF Back     alignment and domain information
>gnl|CDD|36700 KOG1487, KOG1487, KOG1487, GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era Back     alignment and domain information
>gnl|CDD|133295 cd01895, EngA2, EngA2 subfamily Back     alignment and domain information
>gnl|CDD|31357 COG1163, DRG, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|36637 KOG1423, KOG1423, KOG1423, Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning, Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|181957 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 335 GTPase ObgE [Candidatus Liberibacter asiaticus str. psy
TIGR02729296 Obg_CgtA GTP-binding protein Obg/CgtA; InterPro: IPR014 100.0
PRK12298380 obgE GTPase ObgE; Reviewed 100.0
COG0536369 Obg Predicted GTPase [General function prediction only] 100.0
PRK12299334 obgE GTPase ObgE; Reviewed 100.0
PRK12296 495 obgE GTPase ObgE; Reviewed 100.0
PRK12297429 obgE GTPase ObgE; Reviewed 100.0
KOG1489366 consensus 100.0
pfam01018156 GTP1_OBG GTP1/OBG. The N-terminal domain of the Spo0B-a 100.0
cd01898170 Obg Obg subfamily. The Obg nucleotide binding protein s 100.0
cd01896233 DRG The developmentally regulated GTP-binding protein ( 100.0
cd01881176 Obg_like The Obg-like subfamily consists of five well-d 100.0
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg-like 100.0
PTZ00258 392 GTP-binding protein; Provisional 100.0
COG0012372 Predicted GTPase, probable translation factor [Translat 100.0
PRK09601364 translation-associated GTPase; Reviewed 100.0
PRK09602 396 translation-associated GTPase; Reviewed 100.0
COG1163365 DRG Predicted GTPase [General function prediction only] 100.0
cd01878204 HflX HflX subfamily. A distinct conserved domain with a 100.0
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein present in 100.0
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfamily. 100.0
pfam02421188 FeoB_N Ferrous iron transport protein B. Escherichia co 100.0
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein family 100.0
TIGR00092 390 TIGR00092 GTP-binding protein YchF; InterPro: IPR004396 100.0
cd01900274 YchF YchF subfamily. YchF is a member of the Obg family 100.0
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) is a 100.0
PRK00089 296 era GTP-binding protein Era; Reviewed 100.0
cd01895174 EngA2 EngA2 subfamily. This CD represents the second GT 100.0
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein foun 100.0
cd01894157 EngA1 EngA1 subfamily. This CD represents the first GTP 100.0
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This fami 100.0
PRK11058426 putative GTPase HflX; Provisional 99.97
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamily of 99.97
KOG1491391 consensus 99.97
COG1084346 Predicted GTPase [General function prediction only] 99.97
PRK09518714 bifunctional cytidylate kinase/GTP-binding protein; Rev 99.97
PRK04213195 GTP-binding protein; Provisional 99.97
PRK00454196 engB GTPase EngB; Reviewed 99.96
COG1159 298 Era GTPase [General function prediction only] 99.96
COG2262411 HflX GTPases [General function prediction only] 99.96
COG1160444 Predicted GTPases [General function prediction only] 99.96
PRK03003474 engA GTP-binding protein EngA; Reviewed 99.96
PRK00093438 engA GTP-binding protein EngA; Reviewed 99.96
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 99.96
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 99.96
PRK03003 474 engA GTP-binding protein EngA; Reviewed 99.96
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.96
PRK00093 438 engA GTP-binding protein EngA; Reviewed 99.96
PRK09518 714 bifunctional cytidylate kinase/GTP-binding protein; Rev 99.95
TIGR00437 733 feoB ferrous iron transport protein B; InterPro: IPR003 99.95
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic ion tra 99.95
KOG1486364 consensus 99.95
PRK05291445 trmE tRNA modification GTPase TrmE; Reviewed 99.94
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protein Ysx 99.94
COG1160 444 Predicted GTPases [General function prediction only] 99.93
COG0486454 ThdF Predicted GTPase [General function prediction only 99.93
KOG1490 620 consensus 99.93
pfam10662143 PduV-EutP Ethanolamine utilisation - propanediol utilis 99.93
cd04171164 SelB SelB subfamily. SelB is an elongation factor neede 99.92
pfam00009185 GTP_EFTU Elongation factor Tu GTP binding domain. This 99.92
KOG1487358 consensus 99.91
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic i 99.9
TIGR00450473 thdF tRNA modification GTPase TrmE; InterPro: IPR004520 99.88
cd00881189 GTP_translation_factor GTP translation factor family. T 99.86
pfam00025174 Arf ADP-ribosylation factor family. Pfam combines a num 99.86
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 99.86
KOG1191531 consensus 99.85
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 99.84
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 99.84
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 99.84
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was identif 99.83
COG0218200 Predicted GTPase [General function prediction only] 99.82
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 99.82
KOG0410410 consensus 99.81
PTZ00133182 ADP-ribosylation factor; Provisional 99.8
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential component of 99.8
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor suppres 99.79
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor doma 99.78
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation facto 99.78
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 99.78
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 99.78
smart00178184 SAR Sar1p-like members of the Ras-family of small GTPas 99.77
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (Arl2- 99.77
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) is hig 99.76
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 6) p 99.76
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes to the 99.74
pfam00071162 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ra 99.74
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from other Rab 99.7
cd00154159 Rab Rab family. Rab GTPases form the largest family wit 99.69
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-li 99.69
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase family 99.69
cd04112191 Rab26 Rab26 subfamily. First identified in rat pancreat 99.68
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily. Rab 99.68
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab prot 99.68
cd04125188 RabA_like RabA-like subfamily. RabA was first identifie 99.68
cd00876160 Ras Ras family. The Ras family of the Ras superfamily i 99.67
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases are imp 99.66
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicated in 99.66
PTZ00132209 GTP-binding nuclear protein; Provisional 99.66
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Ypt2 ar 99.66
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 (Arf- 99.65
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found primari 99.65
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associated w 99.65
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the trans 99.65
cd04123162 Rab21 Rab21 subfamily. The localization and function of 99.64
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in every e 99.64
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab40a, 99.64
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was first i 99.64
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exclusiv 99.63
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) subfa 99.63
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in fold 99.63
cd01889192 SelB_euk SelB subfamily. SelB is an elongation factor n 99.63
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 are cl 99.63
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG (Ras- 99.63
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized to b 99.63
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in numero 99.62
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 are 99.62
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are novel pro 99.62
KOG0073185 consensus 99.62
cd01860163 Rab5_related Rab5-related subfamily. This subfamily inc 99.62
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, N-Ra 99.62
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamily. Rh 99.62
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains Rab3A, 99.61
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily consists 99.61
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 is ma 99.61
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily o 99.61
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase that re 99.61
cd04109215 Rab28 Rab28 subfamily. First identified in maize, Rab28 99.6
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosomes, t 99.6
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Kir) su 99.6
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in many p 99.6
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associated wi 99.6
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golgi mem 99.6
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation fact 99.59
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily consists 99.59
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of the Ra 99.59
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subfamily 99.59
PRK12312 610 infB translation initiation factor IF-2; Provisional 99.58
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of the Ra 99.58
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small GTPa 99.58
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member of th 99.58
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified in ca 99.57
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab prot 99.57
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the Rap s 99.57
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase that co 99.57
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is ubiqui 99.56
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubule-de 99.56
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-ventra 99.56
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA 99.55
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like protei 99.55
cd00157171 Rho Rho (Ras homology) family. Members of the Rho famil 99.55
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related protein fr 99.55
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) protein 99.55
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily consi 99.55
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily o 99.55
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog member I) 99.54
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) protein 99.53
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho family 99.53
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that plays 99.52
KOG0070181 consensus 99.52
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfamily 99.51
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein on ch 99.5
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein that 99.5
CHL00189 770 infB translation initiation factor 2; Provisional 99.5
PRK05306 839 infB translation initiation factor IF-2; Validated 99.48
cd04143247 Rhes_like Rhes_like subfamily. This subfamily includes 99.48
PRK04000 410 translation initiation factor IF-2 subunit gamma; Valid 99.47
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive Cdc42 99.46
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high sequenc 99.46
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPase tha 99.45
PRK10512 615 selenocysteinyl-tRNA-specific translation factor; Provi 99.45
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding protein 99.45
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (alpha, 99.44
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1/Rho6 99.43
KOG0075186 consensus 99.43
PRK04004 592 translation initiation factor IF-2; Validated 99.43
KOG0076197 consensus 99.4
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB subfamil 99.4
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), Tet(W) 99.39
PTZ00327 460 eukaryotic translation initiation factor 2 gamma subuni 99.39
TIGR00475 627 selB selenocysteine-specific translation elongation fac 99.38
KOG0092200 consensus 99.36
KOG0090238 consensus 99.35
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ortholog 99.34
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha su 99.32
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a member of 99.31
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase) [Tr 99.3
COG3596296 Predicted GTPase [General function prediction only] 99.29
PRK12317 426 elongation factor 1-alpha; Reviewed 99.29
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE/Rho8 99.28
TIGR00436278 era GTP-binding protein Era; InterPro: IPR005662 Era is 99.27
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 99.27
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a member of 99.27
KOG1145 683 consensus 99.25
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translocatio 99.25
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with prot 99.25
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Translo 99.24
PTZ00141 443 elongation factor 1 alpha; Provisional 99.23
KOG0078207 consensus 99.22
KOG0084205 consensus 99.22
PRK13768253 GTPase; Provisional 99.21
PRK00049 397 elongation factor Tu; Reviewed 99.2
PRK05433 601 GTP-binding protein LepA; Provisional 99.2
PRK12736 394 elongation factor Tu; Reviewed 99.19
TIGR00231186 small_GTP small GTP-binding protein domain; InterPro: I 99.19
COG1100219 GTPase SAR1 and related small G proteins [General funct 99.18
KOG0071180 consensus 99.16
PRK12735 396 elongation factor Tu; Reviewed 99.16
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPase) [ 99.15
COG5257 415 GCD11 Translation initiation factor 2, gamma subunit (e 99.13
PTZ00336 449 elongation factor 1-alpha; Provisional 99.12
KOG0462 650 consensus 99.08
COG3276 447 SelB Selenocysteine-specific translation elongation fac 99.07
KOG0094221 consensus 99.06
KOG0395196 consensus 99.06
CHL00071 409 tufA elongation factor Tu 99.05
KOG0087222 consensus 99.05
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 98.95
COG2229187 Predicted GTPase [General function prediction only] 98.94
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of several pr 98.94
KOG0098216 consensus 98.93
KOG0072182 consensus 98.92
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase famil 98.91
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 98.89
KOG0080209 consensus 98.88
PRK10218 607 GTP-binding protein; Provisional 98.88
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation requir 98.87
pfam04548200 AIG1 AIG1 family. Arabidopsis protein AIG1 appears to b 98.84
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesis, ou 98.84
KOG1532366 consensus 98.82
KOG0394210 consensus 98.81
KOG0093193 consensus 98.79
PRK05124 475 cysN sulfate adenylyltransferase subunit 1; Provisional 98.78
KOG0074185 consensus 98.78
PRK05506 613 bifunctional sulfate adenylyltransferase subunit 1/aden 98.75
COG4917148 EutP Ethanolamine utilization protein [Amino acid trans 98.74
KOG0091213 consensus 98.74
KOG0095213 consensus 98.73
KOG0461 522 consensus 98.72
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are novel pro 98.69
KOG0077193 consensus 98.69
KOG2486320 consensus 98.66
KOG0458 603 consensus 98.63
KOG0088218 consensus 98.63
KOG0079198 consensus 98.56
pfam05049 375 IIGP Interferon-inducible GTPase (IIGP). Interferon-ind 98.56
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represents Ara 98.51
KOG0083192 consensus 98.5
KOG1144 1064 consensus 98.47
KOG0081219 consensus 98.46
COG5258 527 GTPBP1 GTPase [General function prediction only] 98.42
TIGR00483 445 EF-1_alpha translation elongation factor EF-1, subunit 98.39
COG0480 697 FusA Translation elongation factors (GTPases) [Translat 98.37
COG1217 603 TypA Predicted membrane GTPase involved in stress respo 98.25
TIGR01394 609 TypA_BipA GTP-binding protein TypA; InterPro: IPR006298 98.23
TIGR00487 594 IF-2 translation initiation factor IF-2; InterPro: IPR0 98.16
KOG1143 591 consensus 98.14
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 98.12
KOG0448 749 consensus 98.12
KOG1707625 consensus 98.08
KOG3883198 consensus 98.04
KOG0086214 consensus 97.91
KOG4252246 consensus 97.88
KOG0393198 consensus 97.81
KOG1673205 consensus 97.8
COG0050 394 TufB GTPases - translation elongation factors [Translat 97.77
KOG0097215 consensus 97.76
pfam09547 492 Spore_IV_A Stage IV sporulation protein A (spore_IV_A). 97.74
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.73
TIGR02836 492 spore_IV_A stage IV sporulation protein A; InterPro: IP 97.71
KOG1707 625 consensus 97.39
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.21
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 97.04
KOG1547336 consensus 96.97
COG3523 1188 IcmF Type VI protein secretion system component VasK [I 96.84
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 96.8
KOG0460 449 consensus 96.79
PRK11144 352 modC molybdate transporter ATP-binding protein; Provisi 96.72
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 96.6
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 96.51
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 96.42
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 96.27
COG4148 352 ModC ABC-type molybdate transport system, ATPase compon 96.26
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 96.24
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 96.14
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.01
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 95.97
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 95.85
TIGR00484 705 EF-G translation elongation factor G; InterPro: IPR0045 95.82
TIGR02769267 nickel_nikE nickel import ATP-binding protein NikE; Int 95.79
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 95.58
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 95.47
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 95.41
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 95.27
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.22
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 95.22
KOG1423379 consensus 99.88
KOG0459 501 consensus 97.17
COG5019 373 CDC3 Septin family protein [Cell division and chromosom 97.11
pfam01926106 MMR_HSR1 GTPase of unknown function. 99.76
cd04105203 SR_beta Signal recognition particle receptor, beta subu 99.5
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 (RF3) 99.33
pfam09439181 SRPRB Signal recognition particle receptor beta subunit 99.31
PRK00741 526 prfC peptide chain release factor 3; Provisional 99.13
pfam00350168 Dynamin_N Dynamin family. 99.08
pfam08477118 Miro Miro-like protein. Mitochondrial Rho proteins (Mir 98.95
KOG1954 532 consensus 98.92
PRK13351 687 elongation factor G; Reviewed 98.86
PRK12740 670 elongation factor G; Reviewed 98.76
pfam04670230 Gtr1_RagA Gtr1/RagA G protein conserved region. GTR1 wa 98.7
PRK12739 693 elongation factor G; Reviewed 98.63
PRK00007 693 elongation factor G; Reviewed 98.46
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-envelope 98.46
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of this 97.92
PRK07560 730 elongation factor EF-2; Reviewed 97.91
pfam00735280 Septin Septin. Members of this family include CDC3, CDC 97.87
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved family o 97.8
KOG0468 971 consensus 97.69
PRK01889353 ribosome-associated GTPase; Reviewed 97.61
KOG3886 295 consensus 97.42
TIGR00991 328 3a0901s02IAP34 GTP-binding protein; InterPro: IPR005688 97.15
KOG0465 721 consensus 97.11
KOG1533290 consensus 96.64
KOG0467 887 consensus 96.61
KOG2655 366 consensus 95.82
KOG1534273 consensus 95.69
KOG3887 347 consensus 94.96
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protein gen 99.32
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to the hu 99.27
PRK09563282 rbgA ribosomal biogenesis GTPase; Reviewed 99.25
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin (NS) 99.25
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These protein 99.24
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all sequ 99.22
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protein Ylq 99.22
cd01859156 MJ1464 MJ1464. This family represents archaeal GTPase t 99.19
COG1161322 Predicted GTPases [General function prediction only] 99.14
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protein. De 99.04
KOG1424562 consensus 98.88
PRK13796367 GTP-binding protein YqeH; Provisional 98.87
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This famil 98.87
KOG2423572 consensus 98.52
PRK00098298 ribosome-associated GTPase; Reviewed 98.22
PRK12289351 ribosome-associated GTPase; Reviewed 98.17
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) r 97.95
TIGR00650123 MG442 GTP-binding conserved hypothetical protein; Inter 97.81
COG1162301 Predicted GTPases [General function prediction only] 97.73
PRK12288344 ribosome-associated GTPase; Reviewed 97.64
COG4108 528 PrfC Peptide chain release factor RF-3 [Translation, ri 97.48
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 97.22
pfam03193161 DUF258 Protein of unknown function, DUF258. 97.17
COG1134249 TagH ABC-type polysaccharide/polyol phosphate transport 96.95
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 96.87
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 96.75
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 96.72
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 96.64
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 96.51
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 96.42
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 96.38
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 96.34
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 96.3
KOG1249 572 consensus 96.23
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 96.22
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 96.2
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 96.14
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 96.08
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 96.0
cd03116159 MobB Molybdenum is an essential trace element in the fo 95.99
PRK09452 378 potA putrescine/spermidine ABC transporter ATPase prote 95.96
COG4586325 ABC-type uncharacterized transport system, ATPase compo 95.89
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 95.83
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 95.79
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 95.77
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 95.7
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 95.7
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 95.7
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 95.64
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 95.56
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 95.56
KOG2749 415 consensus 95.55
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 95.52
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 95.47
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 95.42
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein; Int 95.41
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 95.38
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 95.32
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.26
PRK11607 377 potG putrescine transporter ATP-binding subunit; Provis 95.12
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 95.04
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 95.04
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 95.02
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 94.99
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provisiona 94.98
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 94.87
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 94.81
PTZ00099176 rab6; Provisional 99.22
TIGR01393 598 lepA GTP-binding protein LepA; InterPro: IPR006297 LepA 99.2
TIGR00491 1145 aIF-2 translation initiation factor aIF-2; InterPro: IP 99.17
TIGR02034 411 CysN sulfate adenylyltransferase, large subunit; InterP 98.9
COG2895 431 CysN GTPases - Sulfate adenylate transferase subunit 1 98.48
COG1161 322 Predicted GTPases [General function prediction only] 97.95
KOG0082354 consensus 97.18
PRK09866 742 hypothetical protein; Provisional 97.09
cd00066317 G-alpha G protein alpha subunit. The alpha subunit of G 97.06
pfam00503350 G-alpha G-protein alpha subunit. G proteins couple rece 96.97
KOG2485 335 consensus 96.48
smart00275342 G_alpha G protein alpha subunit. Subunit of G proteins 96.28
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 99.1
PRK09435325 arginine/ornithine transport system ATPase; Provisional 98.99
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 98.86
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These protein 98.78
PRK10463290 hydrogenase nickel incorporation protein HypB; Provisio 98.65
KOG0466 466 consensus 98.27
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 98.21
PRK12288 344 ribosome-associated GTPase; Reviewed 98.14
KOG0463 641 consensus 98.07
pfam05783 490 DLIC Dynein light intermediate chain (DLIC). This famil 97.99
PRK00098 298 ribosome-associated GTPase; Reviewed 97.59
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 97.42
PRK01889 353 ribosome-associated GTPase; Reviewed 97.42
COG1162 301 Predicted GTPases [General function prediction only] 97.34
COG0523 323 Putative GTPases (G3E family) [General function predict 96.93
KOG3905 473 consensus 96.85
PRK12289 351 ribosome-associated GTPase; Reviewed 96.78
cd01854 287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) r 96.47
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 96.32
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 96.13
smart00010124 small_GTPase Small GTPase of the Ras superfamily; ill-d 95.32
cd01859156 MJ1464 MJ1464. This family represents archaeal GTPase t 98.98
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all sequ 98.98
TIGR03596 276 GTPase_YlqF ribosome biogenesis GTP-binding protein Ylq 98.88
PRK09563 282 rbgA ribosomal biogenesis GTPase; Reviewed 98.78
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protein gen 98.75
PRK13796 367 GTP-binding protein YqeH; Provisional 98.57
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This famil 98.51
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protein. De 98.44
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to the hu 98.3
KOG2484 435 consensus 98.0
KOG1424 562 consensus 97.88
KOG2423 572 consensus 97.29
KOG2484435 consensus 98.58
KOG2485335 consensus 98.3
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate vesicl 98.14
pfam0685858 NOG1 Nucleolar GTP-binding protein 1 (NOG1). This famil 97.36
KOG0447 980 consensus 97.0
COG3640255 CooC CO dehydrogenase maturation factor [Cell division 94.91
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 97.56
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin (NS) 97.5
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome biog 97.24
PRK11537 317 putative GTP-binding protein YjiA; Provisional 97.14
cd03114148 ArgK-like The function of this protein family is unkown 96.93
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 96.78
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 96.77
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 96.43
KOG0054 1381 consensus 96.34
PRK11000 369 maltose/maltodextrin transporter ATP-binding protein; P 96.16
PRK10762501 D-ribose transporter ATP binding protein; Provisional 96.1
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 96.08
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 96.06
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 96.04
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.91
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.81
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 95.81
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.8
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.69
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.68
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.65
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 95.64
TIGR02858282 spore_III_AA stage III sporulation protein AA; InterPro 95.63
PRK13536306 nodulation factor exporter subunit NodI; Provisional 95.62
PRK10070 400 glycine betaine transporter ATP-binding subunit; Provis 95.59
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 95.58
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 95.5
PRK11153 343 metN DL-methionine transporter ATP-binding subunit; Pro 95.38
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 95.35
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 95.33
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 95.32
cd03112158 CobW_like The function of this protein family is unkown 95.31
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.3
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 95.28
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 95.25
PRK10851 352 sulfate/thiosulfate transporter subunit; Provisional 95.25
PRK09700510 D-allose transporter ATP-binding protein; Provisional 95.21
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 95.19
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase component 95.18
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.16
PRK10908222 cell division protein FtsE; Provisional 95.14
COG0488530 Uup ATPase components of ABC transporters with duplicat 95.11
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 95.11
PRK11650 358 ugpC glycerol-3-phosphate transporter ATP-binding subun 95.09
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.02
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 94.99
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.93
PTZ002651467 multidrug resistance protein (mdr1); Provisional 94.88
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 94.85
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.79
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 94.79
TIGR012711534 CFTR_protein cystic fibrosis transmembrane conductor re 97.02
TIGR00503 530 prfC peptide chain release factor 3; InterPro: IPR00454 96.69
KOG0446 657 consensus 94.77
TIGR00993 772 3a0901s04IAP86 chloroplast protein import component Toc 94.83
>TIGR02729 Obg_CgtA GTP-binding protein Obg/CgtA; InterPro: IPR014100 This entry describes a universal, mostly one-gene-per-genome GTP-binding protein that associates with ribosomal subunits and appears to play a role in ribosomal RNA maturation Back     alignment and domain information
>PRK12298 obgE GTPase ObgE; Reviewed Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK12299 obgE GTPase ObgE; Reviewed Back     alignment and domain information
>PRK12296 obgE GTPase ObgE; Reviewed Back     alignment and domain information
>PRK12297 obgE GTPase ObgE; Reviewed Back     alignment and domain information
>KOG1489 consensus Back     alignment and domain information
>pfam01018 GTP1_OBG GTP1/OBG Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information