254780649

254780649

nicotinic acid mononucleotide adenylyltransferase

GeneID in NCBI database:8209651Locus tag:CLIBASIA_02680
Protein GI in NCBI database:254780649Protein Accession:YP_003065062.1
Gene range:-(622804, 623454)Protein Length:216aa
Gene description:nicotinic acid mononucleotide adenylyltransferase
COG prediction:[H] Nicotinic acid mononucleotide adenylyltransferase
KEGG prediction:nadD; nicotinic acid mononucleotide adenylyltransferase (EC:2.7.7.18); K00969 nicotinate-nucleotide adenylyltransferase [EC:2.7.7.18]
SEED prediction:Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18), bacterial NadD family
Pathway involved in KEGG:Nicotinate and nicotinamide metabolism [PATH:las00760]
Subsystem involved in SEED:NAD and NADP cofactor biosynthesis global
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MQQSQSLQDIMRMPKVEPGMKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQSLIKNPRIRITAFEAYLNHTETFHTILQVKKHNKSVNFVWIMGADNIKSFHQWHHWKRIVTTVPIAIIDRFDVTFNYISSPMAKTFEYARLDESLSHILCTTSPPSWLFIHDRHHIISSTAIRKKIIEQDNTRTLGI
cccHHHccccccccccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEccccccccccccccHHHHHHHHHHHHccccccccHHHHHccccccHHHHHHHHHHcccccEEEEEcHHHHHcccccccHHHHHHHccEEEEEcccccccHHHHHHHHHHHHHHccHHHHHHHccccccEEEEEEcccccccHHHHHHHHHcccccHHccc
ccHHHHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEcccccccccccccccHHHHHHHHHHHHccccEEEccHHHcccccccHHHHHHHHHHcccccEEEEEccHHHHHcccHHcHHHHHHHccEEEEEcccccHHHccHHHHHHHHHHcccccHHHHHHccccccEEEEEcccccccHHHHHHHHHccccHHHccc
mqqsqslqdimrmpkvepgmkiglfggnfnpphhghIEIAQIAIKKLNLDQLWWIItpfnsvknynlsSSLEKRISLSQSLIKNPRIRITAFEAYLNHTETFHTILQVKKHNKSVNFVWIMgadniksfhQWHHWKRIVTTVPIAIIDRFdvtfnyisspmaktFEYARLDESLshilcttsppswlfihdrhhiiSSTAIRKKIIeqdntrtlgi
mqqsqslqdiMRMPKVEPGMKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQSLIKNPRIRITAFEAYLNHTETFHTILQVKKHNKSVNFVWIMGADNIKSFHQWHHWKRIVTTVPIAIIDRFDVTFNYISSPMAKTFEYARLDESLSHILCTTSPPSWLFIHDRHHIisstairkkiieqdntrtlgi
MQQSQSLQDIMRMPKVEPGMKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQSLIKNPRIRITAFEAYLNHTETFHTILQVKKHNKSVNFVWIMGADNIKSFHQWHHWKRIVTTVPIAIIDRFDVTFNYISSPMAKTFEYARLDESLSHILCTTSPPSWLFIHDRHHIISSTAIRKKIIEQDNTRTLGI
******************GMKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQSLIKNPRIRITAFEAYLNHTETFHTILQVKKHNKSVNFVWIMGADNIKSFHQWHHWKRIVTTVPIAIIDRFDVTFNYISSPMAKTFEYARLDESLSHILCTTSPPSWLFIHDRHHIISSTAIRKKIIEQDNTRTLGI
********DIMRMPKVEPGMKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQSLIKNPRIRITAFEAYLNHTETFHTILQVKKHNKSVNFVWIMGADNIKSFHQWHHWKRIVTTVPIAIIDRFDVTFNYISSPMAKTFEYARLDESLSHILCTTSPPSWLFIHDRHHIISSTAIRKKIIEQDNTRTLGI
MQQSQSLQDIMRMPKVEPGMKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQSLIKNPRIRITAFEAYLNHTETFHTILQVKKHNKSVNFVWIMGADNIKSFHQWHHWKRIVTTVPIAIIDRFDVTFNYISSPMAKTFEYARLDESLSHILCTTSPPSWLFIHDRHHIISSTAIRKKIIEQDNTRTLGI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQQSQSLQDIMRMPKVEPGMKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQSLIKNPRIRITAFEAYLNHTETFHTILQVKKHNKSVNFVWIMGADNIKSFHQWHHWKRIVTTVPIAIIDRFDVTFNYISSPMAKTFEYARLDESLSHILCTTSPPSWLFIHDRHHIISSTAIRKKIIEQDNTRTLGI
MQQSQSLQDIMRMPKVEPGMKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQSLIKNPRIRITAFEAYLNHTETFHTILQVKKHNKSVNFVWIMGADNIKSFHQWHHWKRIVTTVPIAIIDRFDVTFNYISSPMAKTFEYARLDESLSHILCTTSPPSWLFIHDRHHIISSTAIRKKIIEQDNTRTLGI
MQQSQSLQDIMRMPKVEPGMKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQSLIKNPRIRITAFEAYLNHTETFHTILQVKKHNKSVNFVWIMGADNIKSFHQWHHWKRIVTTVPIAIIDRFDVTFNYISSPMAKTFEYARLDESLSHILCTTSPPSWLFIHDRHHIISSTAIRKKIIEQDNTRTLGI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target216 nicotinic acid mononucleotide adenylyltransferase [Cand
254780181182 phosphopantetheine adenylyltransferase [Candidatus 0.033
>gi|254780181|ref|YP_003064594.1| phosphopantetheine adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 182 Back     alignment
 Score = 30.0 bits (66), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 8/80 (10%)

Query: 20 MKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQ 79
          M+  ++ G+F+P  +GH++   I I+ L+  +   I    NSVK     S  E+   + Q
Sbjct: 2  MRKAVYTGSFDPITNGHMD---IIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQ 58

Query: 80 SLI-----KNPRIRITAFEA 94
          S+       + R+ + +FE 
Sbjct: 59 SIFHFIPDSSNRVSVISFEG 78

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target216 nicotinic acid mononucleotide adenylyltransferase [Cand
315122165226 nicotinic acid mononucleotide adenylyltransferase [Cand 1 1e-95
222150154218 nicotinic acid mononucleotide adenylyltransferase [Agro 1 1e-56
150398207202 nicotinic acid mononucleotide adenylyltransferase [Sino 1 5e-56
227823687202 nicotinic acid mononucleotide adenylyltransferase [Sino 1 7e-56
195970126195 nicotinic acid mononucleotide adenylyltransferase [Sino 1 2e-55
222087879193 nicotinate (nicotinamide) nucleotide adenylyltransferas 1 2e-54
325294149207 Nicotinic acid mononucleotide adenylyltransferase [Agro 1 3e-54
159185377194 nicotinic acid mononucleotide adenylyltransferase [Agro 1 4e-54
218662757219 nicotinic acid mononucleotide adenylyltransferase [Rhiz 1 6e-54
161619761224 nicotinic acid mononucleotide adenylyltransferase [Bruc 1 7e-54
>gi|315122165|ref|YP_004062654.1| nicotinic acid mononucleotide adenylyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 226 Back     alignment and organism information
 Score =  352 bits (904), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 170/211 (80%), Positives = 188/211 (89%), Gaps = 2/211 (0%)

Query: 1   MQQSQSLQDIMRMPKVEPGMKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFN 60
           MQ  QSL+DI RMPKVE GMKIGLFGG FNPPH+GHIEIA IAIKKLNLDQLWWII+P++
Sbjct: 1   MQYYQSLKDITRMPKVEAGMKIGLFGGTFNPPHYGHIEIAHIAIKKLNLDQLWWIISPYH 60

Query: 61  SVKNYNLSSSLEKRISLSQSLIKNPRIRITAFEA--YLNHTETFHTILQVKKHNKSVNFV 118
            +K+YN  S L KRI+LS+SL+KNPRIRITAFE    LNHT+TFHTILQVKKHNK VNF+
Sbjct: 61  PIKSYNSPSPLIKRIALSKSLVKNPRIRITAFEKPLSLNHTQTFHTILQVKKHNKLVNFI 120

Query: 119 WIMGADNIKSFHQWHHWKRIVTTVPIAIIDRFDVTFNYISSPMAKTFEYARLDESLSHIL 178
           WIMGADNIKSFH WHHWKRIV TVPIAIIDRFDVTFNYISSPMAKTFE+ARLDESLSH L
Sbjct: 121 WIMGADNIKSFHHWHHWKRIVMTVPIAIIDRFDVTFNYISSPMAKTFEHARLDESLSHTL 180

Query: 179 CTTSPPSWLFIHDRHHIISSTAIRKKIIEQD 209
           C T PPSW FIHD+HHIISSTAIRK+ +E++
Sbjct: 181 CETPPPSWTFIHDKHHIISSTAIRKQQLEEN 211


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222150154|ref|YP_002551111.1| nicotinic acid mononucleotide adenylyltransferase [Agrobacterium vitis S4] Length = 218 Back     alignment and organism information
>gi|150398207|ref|YP_001328674.1| nicotinic acid mononucleotide adenylyltransferase [Sinorhizobium medicae WSM419] Length = 202 Back     alignment and organism information
>gi|227823687|ref|YP_002827660.1| nicotinic acid mononucleotide adenylyltransferase [Sinorhizobium fredii NGR234] Length = 202 Back     alignment and organism information
>gi|195970126|ref|NP_387268.2| nicotinic acid mononucleotide adenylyltransferase [Sinorhizobium meliloti 1021] Length = 195 Back     alignment and organism information
>gi|222087879|ref|YP_002546417.1| nicotinate (nicotinamide) nucleotide adenylyltransferase [Agrobacterium radiobacter K84] Length = 193 Back     alignment and organism information
>gi|325294149|ref|YP_004280013.1| Nicotinic acid mononucleotide adenylyltransferase [Agrobacterium sp. H13-3] Length = 207 Back     alignment and organism information
>gi|159185377|ref|NP_355708.2| nicotinic acid mononucleotide adenylyltransferase [Agrobacterium tumefaciens str. C58] Length = 194 Back     alignment and organism information
>gi|218662757|ref|ZP_03518687.1| nicotinic acid mononucleotide adenylyltransferase [Rhizobium etli IE4771] Length = 219 Back     alignment and organism information
>gi|161619761|ref|YP_001593648.1| nicotinic acid mononucleotide adenylyltransferase [Brucella canis ATCC 23365] Length = 224 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target216 nicotinic acid mononucleotide adenylyltransferase [Cand
PRK00071203 PRK00071, nadD, nicotinic acid mononucleotide adenylylt 6e-43
TIGR00482193 TIGR00482, TIGR00482, nicotinate (nicotinamide) nucleot 2e-28
cd02165192 cd02165, NMNAT, Nicotinamide/nicotinate mononucleotide 2e-27
PRK07152 342 PRK07152, nadD, putative nicotinate-nucleotide adenylyl 2e-22
pfam01467148 pfam01467, CTP_transf_2, Cytidylyltransferase 6e-16
PRK06973243 PRK06973, PRK06973, nicotinic acid mononucleotide adeny 1e-11
COG1057197 COG1057, NadD, Nicotinic acid mononucleotide adenylyltr 3e-30
cd02039143 cd02039, cytidylyltransferase_like, Cytidylyltransferas 2e-04
PRK13964140 PRK13964, coaD, phosphopantetheine adenylyltransferase; 0.001
COG0669159 COG0669, CoaD, Phosphopantetheine adenylyltransferase [ 7e-04
TIGR0012566 TIGR00125, cyt_tran_rel, cytidyltransferase-related dom 9e-04
>gnl|CDD|178839 PRK00071, nadD, nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|161899 TIGR00482, TIGR00482, nicotinate (nicotinamide) nucleotide adenylyltransferase Back     alignment and domain information
>gnl|CDD|185680 cd02165, NMNAT, Nicotinamide/nicotinate mononucleotide adenylyltransferase Back     alignment and domain information
>gnl|CDD|180860 PRK07152, nadD, putative nicotinate-nucleotide adenylyltransferase; Validated Back     alignment and domain information
>gnl|CDD|144891 pfam01467, CTP_transf_2, Cytidylyltransferase Back     alignment and domain information
>gnl|CDD|180781 PRK06973, PRK06973, nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31257 COG1057, NadD, Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|185678 cd02039, cytidylyltransferase_like, Cytidylyltransferase-like domain Back     alignment and domain information
>gnl|CDD|184424 PRK13964, coaD, phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31013 COG0669, CoaD, Phosphopantetheine adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|161722 TIGR00125, cyt_tran_rel, cytidyltransferase-related domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 216 nicotinic acid mononucleotide adenylyltransferase [Cand
TIGR00482229 TIGR00482 nicotinate (nicotinamide) nucleotide adenylyl 100.0
COG1057197 NadD Nicotinic acid mononucleotide adenylyltransferase 100.0
PRK00071200 nadD nicotinic acid mononucleotide adenylyltransferase; 100.0
PRK07152 343 nadD putative nicotinate-nucleotide adenylyltransferase 100.0
cd02165194 NMNAT This family contains the predominant bacterial/eu 100.0
PRK08887173 nicotinic acid mononucleotide adenylyltransferase; Prov 100.0
PRK06973196 nicotinic acid mononucleotide adenylyltransferase; Prov 100.0
pfam01467148 CTP_transf_2 Cytidylyltransferase. This family includes 100.0
KOG3199234 consensus 99.9
PRK00168159 coaD phosphopantetheine adenylyltransferase; Provisiona 99.89
cd02163152 PPAT_a Phosphopantetheine adenylyltransferase (PPAT) is 99.81
PRK01153170 nicotinamide-nucleotide adenylyltransferase; Provisiona 99.73
TIGR01510163 coaD_prev_kdtB pantetheine-phosphate adenylyltransferas 99.72
COG0669159 CoaD Phosphopantetheine adenylyltransferase [Coenzyme m 99.67
cd02166163 NMNAT_Archaea This family of archaeal proteins exhibits 99.6
cd00517356 ATPS ATP-sulfurylase (ATPS), also known as sulfate aden 97.84
COG2046397 MET3 ATP sulfurylase (sulfate adenylyltransferase) [Ino 97.76
pfam01747310 ATP-sulfurylase ATP-sulfurylase. This family consists o 97.66
PRK04149390 sat sulfate adenylyltransferase; Reviewed 97.63
PRK05537 568 bifunctional sulfate adenylyltransferase subunit 1/aden 97.03
TIGR00339424 sopT sulfate adenylyltransferase; InterPro: IPR002650 T 96.86
cd02039141 cytidylyltransferase_like Cytidylyltransferase-like dom 99.93
PRK13964140 coaD phosphopantetheine adenylyltransferase; Provisiona 99.6
cd02156147 nt_trans nt_trans (nucleotidyl transferase) This superf 99.45
cd02064179 Flavokinase_C Riboflavin kinase (Flavokinase). This fam 98.54
cd02173152 ECT CTP:phosphoethanolamine cytidylyltransferase (ECT) 98.13
COG0615140 TagD Cytidylyltransferase [Cell envelope biogenesis, ou 97.9
pfam06574158 FAD_syn FAD synthetase. This family corresponds to the 97.36
TIGR01518126 g3p_cytidyltrns glycerol-3-phosphate cytidylyltransfera 96.95
cd02167157 NMNAT_NadR The NMNAT domain of NadR protein. The NadR p 99.41
cd02168179 NMNAT_Nudix This domain represents the N-terminal NMNAT 99.04
PRK08099 411 nicotinamide-nucleotide adenylyltransferase; Provisiona 98.97
PRK01170 328 phosphopantetheine adenylyltransferase/unknown domain f 98.85
PRK00777155 phosphopantetheine adenylyltransferase; Provisional 98.76
PRK13793188 nicotinamide-nucleotide adenylyltransferase; Provisiona 98.73
PRK05379 340 bifunctional nicotinamide mononucleotide adenylyltransf 98.73
cd02164142 PPAT_CoAS The PPAT domain of the bifunctional enzyme wi 98.62
TIGR0012563 cyt_tran_rel cytidyltransferase-related domain; InterPr 98.61
TIGR01526 346 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransfe 98.6
COG1056172 NadR Nicotinamide mononucleotide adenylyltransferase [C 98.46
PRK13670 390 hypothetical protein; Provisional 98.23
pfam05636 389 DUF795 Protein of unknown function (DUF795). This famil 98.19
PRK13671 298 hypothetical protein; Provisional 98.06
smart00764182 Citrate_ly_lig Citrate lyase ligase C-terminal domain. 98.05
pfam08218182 Citrate_ly_lig Citrate lyase ligase C-terminal domain. 98.04
TIGR01527171 arch_NMN_Atrans nicotinamide-nucleotide adenylyltransfe 97.82
cd02169296 Citrate_lyase_ligase Citrate lyase ligase, also known a 97.78
KOG3351293 consensus 97.46
COG1019158 Predicted nucleotidyltransferase [General function pred 97.36
COG3053352 CitC Citrate lyase synthetase [Energy production and co 96.44
COG1323 358 Predicted nucleotidyltransferase [General function pred 96.31
PTZ00308 353 ethanolamine-phosphate cytidylytransferase; Provisional 94.74
cd02171129 G3P_Cytidylyltransferase These sequences describe glyce 99.38
cd02172143 RfaE_N RfaE is a protein involved in the biosynthesis o 98.94
cd02170136 cytidylyltransferase The cytidylyltransferase family in 98.92
PRK07143277 hypothetical protein; Provisional 98.61
PRK05627303 bifunctional riboflavin kinase/FMN adenylyltransferase; 98.53
cd02174150 CCT CTP:phosphocholine cytidylyltransferase (CCT) catal 98.48
TIGR00083296 ribF riboflavin biosynthesis protein RibF; InterPro: IP 98.4
COG0196304 RibF FAD synthase [Coenzyme metabolism] 98.1
PRK11316473 bifunctional heptose 7-phosphate kinase/heptose 1-phosp 97.5
TIGR02199144 rfaE_dom_II rfaE bifunctional protein, domain II; Inter 94.81
>TIGR00482 TIGR00482 nicotinate (nicotinamide) nucleotide adenylyltransferase; InterPro: IPR005248 This family contains the predominant bacterial/eukaryotic adenylyltransferases for nicotinamide-nucleotide and for the deamido form, nicotinate nucleotide Back     alignment and domain information
>COG1057 NadD Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK00071 nadD nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PRK07152 nadD putative nicotinate-nucleotide adenylyltransferase; Validated Back     alignment and domain information
>cd02165 NMNAT This family contains the predominant bacterial/eukaryotic adenylyltransferases for nicotinamide-nucleotide and for the deamido form, nicotinate nucleotide Back     alignment and domain information
>PRK08887 nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PRK06973 nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>pfam01467 CTP_transf_2 Cytidylyltransferase Back     alignment and domain information
>KOG3199 consensus Back     alignment and domain information
>PRK00168 coaD phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>cd02163 PPAT_a Phosphopantetheine adenylyltransferase (PPAT) is an essential enzyme in bacteria that catalyses a rate-limiting step in coenzyme A (CoA) biosynthesis, by transferring an adenylyl group from ATP to 4'-phosphopantetheine, yielding dephospho-CoA (dPCoA) Back     alignment and domain information
>PRK01153 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>TIGR01510 coaD_prev_kdtB pantetheine-phosphate adenylyltransferase; InterPro: IPR001980 Temperature-sensitive mutants of Escherichia coli, defective in the transfer of 3-deoxy-D-manno-octulosonic acid (KDO) from CMP-KDO to a tetraacyldisaccharide 1,4'-bisphosphate precursor of lipid A, have been used to map KDO transferase activity on the E Back     alignment and domain information
>COG0669 CoaD Phosphopantetheine adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>cd02166 NMNAT_Archaea This family of archaeal proteins exhibits nicotinamide-nucleotide adenylyltransferase (NMNAT) activity utilizing the salvage pathway to synthesize NAD Back     alignment and domain information
>cd00517 ATPS ATP-sulfurylase (ATPS), also known as sulfate adenylate transferase, catalyzes the transfer of an adenylyl group from ATP to sulfate, forming adenosine 5'-phosphosulfate (APS) Back     alignment and domain information
>COG2046 MET3 ATP sulfurylase (sulfate adenylyltransferase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam01747 ATP-sulfurylase ATP-sulfurylase Back     alignment and domain information
>PRK04149 sat sulfate adenylyltransferase; Reviewed Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>TIGR00339 sopT sulfate adenylyltransferase; InterPro: IPR002650 This entry consists of ATP-sulphurylase or sulphate adenylyltransferase (2 Back     alignment and domain information
>cd02039 cytidylyltransferase_like Cytidylyltransferase-like domain Back     alignment and domain information
>PRK13964 coaD phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>cd02156 nt_trans nt_trans (nucleotidyl transferase) This superfamily includes the class I amino-acyl tRNA synthetases, pantothenate synthetase (PanC), ATP sulfurylase, and the cytidylyltransferases, all of which have a conserved dinucleotide-binding domain Back     alignment and domain information
>cd02064 Flavokinase_C Riboflavin kinase (Flavokinase) Back     alignment and domain information
>cd02173 ECT CTP:phosphoethanolamine cytidylyltransferase (ECT) catalyzes the conversion of phosphoethanolamine to CDP-ethanolamine as part of the CDP#ethanolamine biosynthesis pathway Back     alignment and domain information
>COG0615 TagD Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism] Back     alignment and domain information
>pfam06574 FAD_syn FAD synthetase Back     alignment and domain information
>TIGR01518 g3p_cytidyltrns glycerol-3-phosphate cytidylyltransferase; InterPro: IPR006409 These sequences describe glycerol-3-phosphate cytidyltransferase, also called CDP-glycerol pyrophosphorylase Back     alignment and domain information
>cd02167 NMNAT_NadR The NMNAT domain of NadR protein Back     alignment and domain information
>cd02168 NMNAT_Nudix This domain represents the N-terminal NMNAT (Nicotinamide/nicotinate mononucleotide adenylyltransferase) domain of a novel bifunctional enzyme endowed with NMN adenylyltransferase and #Nudix' hydrolase activities Back     alignment and domain information
>PRK08099 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PRK01170 phosphopantetheine adenylyltransferase/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK00777 phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>PRK13793 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>cd02164 PPAT_CoAS The PPAT domain of the bifunctional enzyme with PPAT and DPCK functions Back     alignment and domain information
>TIGR00125 cyt_tran_rel cytidyltransferase-related domain; InterPro: IPR004821 Protein families that contain at least one copy of this domain include citrate lyase ligase, pantoate-beta-alanine ligase, glycerol-3-phosphate cytidyltransferase, ADP-heptose synthase, phosphocholine cytidylyltransferase, lipopolysaccharide core biosynthesis protein KdtB, the bifunctional protein NadR, and a number whose function is unknown Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase; InterPro: IPR006417 The NadR protein of Escherichia coli and closely related bacteria is both enzyme and regulatory protein Back     alignment and domain information
>COG1056 NadR Nicotinamide mononucleotide adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK13670 hypothetical protein; Provisional Back     alignment and domain information
>pfam05636 DUF795 Protein of unknown function (DUF795) Back     alignment and domain information
>PRK13671 hypothetical protein; Provisional Back     alignment and domain information
>smart00764 Citrate_ly_lig Citrate lyase ligase C-terminal domain Back     alignment and domain information
>pfam08218 Citrate_ly_lig Citrate lyase ligase C-terminal domain Back     alignment and domain information
>TIGR01527 arch_NMN_Atrans nicotinamide-nucleotide adenylyltransferase; InterPro: IPR006418 This family of archaeal proteins exhibits NAD salvage biosynthesis enzyme nicotinamide-nucleotide adenylyltransferase (2 Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase, also known as [Citrate (pro-3S)-lyase] ligase, is responsible for acetylation of the (2-(5''-phosphoribosyl)-3'-dephosphocoenzyme-A) prosthetic group of the gamma subunit of citrate lyase, converting the inactive thiol form of this enzyme to the active form Back     alignment and domain information
>KOG3351 consensus Back     alignment and domain information
>COG1019 Predicted nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>COG3053 CitC Citrate lyase synthetase [Energy production and conversion] Back     alignment and domain information
>COG1323 Predicted nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00308 ethanolamine-phosphate cytidylytransferase; Provisional Back     alignment and domain information
>cd02171 G3P_Cytidylyltransferase These sequences describe glycerol-3-phosphate cytidylyltransferase, also called CDP-glycerol pyrophosphorylase Back     alignment and domain information
>cd02172 RfaE_N RfaE is a protein involved in the biosynthesis of ADP-L-glycero-D-manno-heptose, a precursor for LPS inner core biosynthesis Back     alignment and domain information
>cd02170 cytidylyltransferase The cytidylyltransferase family includes cholinephosphate cytidylyltransferase (CCT), glycerol-3-phosphate cytidylyltransferase, RafE and phosphoethanolamine cytidylyltransferase (ECT) Back     alignment and domain information
>PRK07143 hypothetical protein; Provisional Back     alignment and domain information
>PRK05627 bifunctional riboflavin kinase/FMN adenylyltransferase; Reviewed Back     alignment and domain information
>cd02174 CCT CTP:phosphocholine cytidylyltransferase (CCT) catalyzes the condensation of CTP and phosphocholine to form CDP-choline as the rate-limiting and regulatory step in the CDP-choline pathway Back     alignment and domain information
>TIGR00083 ribF riboflavin biosynthesis protein RibF; InterPro: IPR002606 Riboflavin is converted into catalytically active cofactors (FAD and FMN) by the actions of riboflavin kinase (2 Back     alignment and domain information
>COG0196 RibF FAD synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional Back     alignment and domain information
>TIGR02199 rfaE_dom_II rfaE bifunctional protein, domain II; InterPro: IPR011914 RfaE is a protein involved in the biosynthesis of ADP-L-glycero-D-manno-heptose, a precursor for LPS inner core biosynthesis Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target216 nicotinic acid mononucleotide adenylyltransferase [Cand
1yum_A242 Crystal Structure Of Nicotinic Acid Mononucleotide 1e-29
1k4k_A213 Crystal Structure Of E. Coli Nicotinic Acid Mononuc 2e-29
1yul_A242 Crystal Structure Of Nicotinic Acid Mononucleotide 7e-29
1kam_A194 Structure Of Bacillus Subtilis Nicotinic Acid Monon 3e-28
3dv2_A201 Crystal Structure Of Nicotinic Acid Mononucleotide 4e-28
3hfj_A191 Bacillus Anthracis Nicotinate Mononucleotide Adenyl 6e-28
2qtm_A189 Crystal Structure Of Nicotinate Mononucleotide Aden 8e-28
2qtr_A189 Crystal Structure Of Nicotinate Mononucleotide Aden 8e-28
2h29_A189 Crystal Structure Of Nicotinic Acid Mononucleotide 4e-23
2h2a_A189 Crystal Structure Of Nicotinic Acid Mononucleotide 7e-23
1kku_A279 Crystal Structure Of Nuclear Human Nicotinamide Mon 2e-11
1kqn_A279 Crystal Structure Of NmnNAMN ADENYLYLTRANSFERASE CO 4e-11
1gzu_A290 Crystal Structure Of Human Nicotinamide Mononucleot 5e-10
1nup_A252 Crystal Structure Of Human Cytosolic NmnNAMN Adenyl 9e-10
3h05_A177 The Crystal Structure Of A Putative Nicotinate-Nucl 2e-06
1vlh_A173 Crystal Structure Of Phosphopantetheine Adenylyltra 3e-06
1qjc_A158 Phosphopantetheine Adenylyltransferase In Complex W 3e-05
1b6t_A159 Phosphopantetheine Adenylyltransferase In Complex W 4e-05
3f3m_A168 Six Crystal Structures Of Two Phosphopantetheine Ad 2e-04
3l92_A162 Phosphopantetheine Adenylyltransferase From Yersini 7e-04
1o6b_A169 Crystal Structure Of Phosphopantetheine Adenylyltra 0.001
3nba_A177 Phosphopantetheine Adenylyltranferase From Mycobact 0.001
1tfu_A157 Phosphopantetheine Adenylyltransferase From Mycobac 0.001
3lcj_A161 Phosphopantetheine Adenylyltransferase From Mycobac 0.001
1od6_A160 The Crystal Structure Of Phosphopantetheine Adenyly 0.001
>gi|83753741|pdb|1YUM|A Chain A, Crystal Structure Of Nicotinic Acid Mononucleotide Adenylyltransferase From Pseudomonas Aeruginosa Length = 242 Back     alignment and structure
 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/198 (18%), Positives = 72/198 (36%), Gaps = 6/198 (3%)

Query: 19  GMKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLS 78
           G +IGLFGG F+P H GH+  A    ++  LD+L  +       +     S+ ++   + 
Sbjct: 22  GKRIGLFGGTFDPVHIGHMRSAVEMAEQFALDELRLLPNARPPHRETPQVSAAQRLAMVE 81

Query: 79  QSLIKNPRIRITAFEAYLNHTETFHTILQVKKHN--KSVNFVWIMGADNIKSFHQWHHWK 136
           +++    R+ +   E   +        L+  +           ++G D       WH W+
Sbjct: 82  RAVAGVERLTVDPRELQRDKPSYTIDTLESVRAELAADDQLFMLIGWDAFCGLPTWHRWE 141

Query: 137 RIVTTVPIAIIDRFDVTFNYISSPMAKTFEYARLDESLSHILCTTSPPSWLFIHDRHHII 196
            ++    I ++ R D       S +        + +  +            F+      +
Sbjct: 142 ALLDHCHIVVLQRPDADSEPPES-LRDLLAARSVADPQA---LKGPGGQITFVWQTPLAV 197

Query: 197 SSTAIRKKIIEQDNTRTL 214
           S+T IR  +    + R L
Sbjct: 198 SATQIRALLGAGRSVRFL 215


gi|24987436|pdb|1K4K|A Chain A, Crystal Structure Of E. Coli Nicotinic Acid Mononucleotide Adenylyltransferase Length = 213 Back     alignment and structure
>gi|83753740|pdb|1YUL|A Chain A, Crystal Structure Of Nicotinic Acid Mononucleotide Adenylyltransferase From Pseudomonas Aeruginosa Length = 242 Back     alignment and structure
>gi|22218984|pdb|1KAM|A Chain A, Structure Of Bacillus Subtilis Nicotinic Acid Mononucleotide Adenylyl Transferase Length = 194 Back     alignment and structure
>gi|211939185|pdb|3DV2|A Chain A, Crystal Structure Of Nicotinic Acid Mononucleotide Adenylyltransferase From Bacillus Anthracis Length = 201 Back     alignment and structure
>gi|257471912|pdb|3HFJ|A Chain A, Bacillus Anthracis Nicotinate Mononucleotide Adenylytransferase (Nadd) In Complex With Inhibitor Cid 3289443 Length = 191 Back     alignment and structure
gi|194319951|pdb|2QTM|A Chain A, Crystal Structure Of Nicotinate Mononucleotide Adenylyltransferase Length = 189 Back     alignment and structure
gi|194319955|pdb|2QTR|A Chain A, Crystal Structure Of Nicotinate Mononucleotide Adenylyltransferase Length = 189 Back     alignment and structure
gi|114794185|pdb|2H29|A Chain A, Crystal Structure Of Nicotinic Acid Mononucleotide Adenylyltransferase From Staphylococcus Aureus: Product Bound Form 1 Length = 189 Back     alignment and structure
>gi|114794187|pdb|2H2A|A Chain A, Crystal Structure Of Nicotinic Acid Mononucleotide Adenylyltransferase From Staphylococcus Aureus: Product Bound Form 2 Length = 189 Back     alignment and structure
>gi|21730493|pdb|1KKU|A Chain A, Crystal Structure Of Nuclear Human Nicotinamide Mononucleotide Adenylyltransferase Length = 279 Back     alignment and structure
gi|28373465|pdb|1KQN|A Chain A, Crystal Structure Of NmnNAMN ADENYLYLTRANSFERASE COMPLEXED With Nad Length = 279 Back     alignment and structure
>gi|22218688|pdb|1GZU|A Chain A, Crystal Structure Of Human Nicotinamide Mononucleotide Adenylyltransferase In Complex With Nmn Length = 290 Back     alignment and structure
>gi|31615714|pdb|1NUP|A Chain A, Crystal Structure Of Human Cytosolic NmnNAMN Adenylyltransferase Complex With Nmn Length = 252 Back     alignment and structure
gi|227343879|pdb|3H05|A Chain A, The Crystal Structure Of A Putative Nicotinate-Nucleotide Adenylyltransferase From Vibrio Parahaemolyticus Length = 177 Back     alignment and structure
>gi|52696203|pdb|1VLH|A Chain A, Crystal Structure Of Phosphopantetheine Adenylyltransferase (Tm0741) From Thermotoga Maritima At 2.20 A Resolution Length = 173 Back     alignment and structure
>gi|14719581|pdb|1QJC|A Chain A, Phosphopantetheine Adenylyltransferase In Complex With Ampcpp And 4'-Phosphopantetheine From Escherichia Coli Length = 158 Back     alignment and structure
gi|7767003|pdb|1B6T|A Chain A, Phosphopantetheine Adenylyltransferase In Complex With 3'- Dephospho-Coa From Escherichia Coli Length = 159 Back     alignment and structure
>gi|261824810|pdb|3F3M|A Chain A, Six Crystal Structures Of Two Phosphopantetheine Adenylyltransferases Reveal An Alternative Ligand Binding Mode And An Associated Structural Change Length = 168 Back     alignment and structure
>gi|284055782|pdb|3L92|A Chain A, Phosphopantetheine Adenylyltransferase From Yersinia Pestis Complexed With Coenzyme A. Length = 162 Back     alignment and structure
>gi|39654326|pdb|1O6B|A Chain A, Crystal Structure Of Phosphopantetheine Adenylyltransferase With Adp Length = 169 Back     alignment and structure
>gi|306991780|pdb|3NBA|A Chain A, Phosphopantetheine Adenylyltranferase From Mycobacterium Tuberculosis In Complex With Adenosine-5'-[(Alpha,Beta)-Methyleno]triphosphate (Ampcpp) Length = 177 Back     alignment and structure
>gi|55669913|pdb|1TFU|A Chain A, Phosphopantetheine Adenylyltransferase From Mycobacterium Tuberculosis Length = 157 Back     alignment and structure
gi|301015833|pdb|3LCJ|A Chain A, Phosphopantetheine Adenylyltransferase From Mycobacterium Tuberculosis Complexed With Coa Length = 161 Back     alignment and structure
gi|29726926|pdb|1OD6|A Chain A, The Crystal Structure Of Phosphopantetheine Adenylyltransferase From Thermus Thermophilus In Complex With 4'-Phosphopantetheine Length = 160 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target216 nicotinic acid mononucleotide adenylyltransferase [Cand
1yum_A242 'probable nicotinate-nucleotide adenylyltransferase; al 8e-25
1k4m_A213 NAMN adenylyltransferase; nucleotidyltransferase; HET: 2e-20
1nup_A252 FKSG76; NAD biosynthesis, cytoplasm, mitochondria, pyri 9e-19
1kqn_A279 Nmnat, nicotinamide mononucleotide adenylyl transferase 7e-17
1kam_A194 Deamido-NAD(+), nicotinate-nucleotide adenylyltransfera 1e-14
2h29_A189 Probable nicotinate-nucleotide adenylyltransferase; NAD 8e-12
3gmi_A 357 UPF0348 protein MJ0951; protein with unknown function, 1e-10
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl trans 6e-10
2qtr_A189 Nicotinate (nicotinamide) nucleotide adenylyltransferas 7e-10
3h05_A177 Uncharacterized protein VPA0413; nucleotidylyl, transfe 3e-09
2qjo_A 341 Bifunctional NMN adenylyltransferase/nudix hydrolase; t 3e-10
1f9a_A168 Hypothetical protein MJ0541; alpha/beta, transferase, s 3e-10
1ej2_A181 Nicotinamide mononucleotide adenylyltransferase; dinucl 2e-09
3k9w_A170 Phosphopantetheine adenylyltransferase; niaid, ssgcid, 9e-09
3nbk_A177 Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: 1e-08
1o6b_A169 Phosphopantetheine adenylyltransferase; structural geno 5e-08
1od6_A160 PPAT, phosphopantetheine adenylyltransferase; coenzyme 8e-08
1qjc_A158 Phosphopantetheine adenylyltransferase; coenzyme A bios 4e-07
3f3m_A168 Phosphopantetheine adenylyltransferase; PPAT, coenzyme 4e-07
1vlh_A173 Phosphopantetheine adenylyltransferase; TM0741, structu 3e-06
3do8_A148 Phosphopantetheine adenylyltransferase; protein with un 3e-05
1tfu_A157 Phosphopantetheine adenylyltransferase; transport prote 3e-05
2qjt_B 352 Nicotinamide-nucleotide adenylyltransferase; two indivi 2e-06
>1yum_A 'probable nicotinate-nucleotide adenylyltransferase; alpha/beta domain; HET: CIT NCN; 1.70A {Pseudomonas aeruginosa} PDB: 1yul_A* 1yun_A* Length = 242 Back     alignment and structure
 Score =  108 bits (271), Expect = 8e-25
 Identities = 37/198 (18%), Positives = 72/198 (36%), Gaps = 6/198 (3%)

Query: 19  GMKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLS 78
           G +IGLFGG F+P H GH+  A    ++  LD+L  +       +     S+ ++   + 
Sbjct: 22  GKRIGLFGGTFDPVHIGHMRSAVEMAEQFALDELRLLPNARPPHRETPQVSAAQRLAMVE 81

Query: 79  QSLIKNPRIRITAFEAYLNHTETFHTILQVKKHNKSVN--FVWIMGADNIKSFHQWHHWK 136
           +++    R+ +   E   +        L+  +   + +     ++G D       WH W+
Sbjct: 82  RAVAGVERLTVDPRELQRDKPSYTIDTLESVRAELAADDQLFMLIGWDAFCGLPTWHRWE 141

Query: 137 RIVTTVPIAIIDRFDVTFNYISSPMAKTFEYARLDESLSHILCTTSPPSWLFIHDRHHII 196
            ++    I ++ R D       S        +  D                F+      +
Sbjct: 142 ALLDHCHIVVLQRPDADSEPPESLRDLLAARSVADPQALK----GPGGQITFVWQTPLAV 197

Query: 197 SSTAIRKKIIEQDNTRTL 214
           S+T IR  +    + R L
Sbjct: 198 SATQIRALLGAGRSVRFL 215


>1k4m_A NAMN adenylyltransferase; nucleotidyltransferase; HET: NAD CIT; 1.90A {Escherichia coli} SCOP: c.26.1.3 PDB: 1k4k_A* Length = 213 Back     alignment and structure
>1nup_A FKSG76; NAD biosynthesis, cytoplasm, mitochondria, pyridine adenylyltransferase, enzyme catalysi; HET: NMN; 1.90A {Homo sapiens} SCOP: c.26.1.3 PDB: 1nuq_A* 1nur_A 1nus_A* 1nut_A* 1nuu_A* Length = 252 Back     alignment and structure
>1kqn_A Nmnat, nicotinamide mononucleotide adenylyl transferase; nucleotidyltransferase superfamily; HET: NAD; 2.20A {Homo sapiens} SCOP: c.26.1.3 PDB: 1kqo_A* 1kr2_A* 1kku_A 1gzu_A* Length = 279 Back     alignment and structure
>1kam_A Deamido-NAD(+), nicotinate-nucleotide adenylyltransferase; rossman fold; 2.10A {Bacillus subtilis} SCOP: c.26.1.3 PDB: 1kaq_A* Length = 194 Back     alignment and structure
>2h29_A Probable nicotinate-nucleotide adenylyltransferase; NADD, namnat, nmnat; HET: DND; 2.00A {Staphylococcus aureus} PDB: 2h2a_A* Length = 189 Back     alignment and structure
>3gmi_A UPF0348 protein MJ0951; protein with unknown function, structural genomics, PSI, MCSG, protein structure initiative; 1.91A {Methanocaldococcus jannaschii DSM2661} Length = 357 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide kinase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Length = 365 Back     alignment and structure
>2qtr_A Nicotinate (nicotinamide) nucleotide adenylyltransferase; NAD, nucleotidyltransferase, pyridine nucleotide biosynthesis; HET: NXX; 1.70A {Bacillus anthracis} PDB: 3dv2_A 3e27_A* 2qtn_A* 2qtm_A* Length = 189 Back     alignment and structure
>3h05_A Uncharacterized protein VPA0413; nucleotidylyl, transferase, MCSG, midwest center for structural genomics, PSI; 1.65A {Vibrio parahaemolyticus} Length = 177 Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrolase; two individual domains; HET: APR NAD; 2.60A {Synechocystis SP} Length = 341 Back     alignment and structure
>1f9a_A Hypothetical protein MJ0541; alpha/beta, transferase, structural genomics; HET: ATP; 2.00A {Methanocaldococcus jannaschii} SCOP: c.26.1.3 Length = 168 Back     alignment and structure
>1ej2_A Nicotinamide mononucleotide adenylyltransferase; dinucleotide binding fold, structural genomics, PSI; HET: NAD; 1.90A {Methanothermobacterthermautotrophicus} SCOP: c.26.1.3 PDB: 1m8g_A* 1hyb_A* 1m8j_A* 1m8f_A* 1m8k_A* Length = 181 Back     alignment and structure
>3k9w_A Phosphopantetheine adenylyltransferase; niaid, ssgcid, seattle structural genomics center for infectious disease, coenzyme A; HET: 4PS ADE PG4; 1.60A {Burkholderia pseudomallei 1710B} PDB: 3ikz_A* Length = 170 Back     alignment and structure
>3nbk_A Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: PNS; 1.58A {Mycobacterium tuberculosis} PDB: 3nba_A* 3lcj_A* 1tfu_A Length = 177 Back     alignment and structure
>1o6b_A Phosphopantetheine adenylyltransferase; structural genomics; HET: ADP; 2.20A {Bacillus subtilis} SCOP: c.26.1.3 Length = 169 Back     alignment and structure
>1od6_A PPAT, phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.5A {Thermus thermophilus} SCOP: c.26.1.3 Length = 160 Back     alignment and structure
>1qjc_A Phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.64A {Escherichia coli} SCOP: c.26.1.3 PDB: 1h1t_A* 1gn8_A* 1b6t_A* Length = 158 Back     alignment and structure
>3f3m_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A biosynthetic pathway, coenzyme A biosynthesis, cytoplasm, nucleotidyltransferase; HET: PPS; 2.40A {Staphylococcus aureus} Length = 168 Back     alignment and structure
>1vlh_A Phosphopantetheine adenylyltransferase; TM0741, structural genomics, JCSG, protein structure initiative, PSI; HET: PNS; 2.20A {Thermotoga maritima} SCOP: c.26.1.3 Length = 173 Back     alignment and structure
>3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} Length = 148 Back     alignment and structure
>1tfu_A Phosphopantetheine adenylyltransferase; transport protein, structural genomics, PSI, protein structure initiative; 1.99A {Mycobacterium tuberculosis} SCOP: c.26.1.3 Length = 157 Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Length = 352 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target216 nicotinic acid mononucleotide adenylyltransferase [Cand
1yum_A242 'probable nicotinate-nucleotide adenylyltransferase; al 100.0
2h29_A189 Probable nicotinate-nucleotide adenylyltransferase; NAD 100.0
1kqn_A279 Nmnat, nicotinamide mononucleotide adenylyl transferase 100.0
1nup_A252 FKSG76; NAD biosynthesis, cytoplasm, mitochondria, pyri 100.0
3h05_A177 Uncharacterized protein VPA0413; nucleotidylyl, transfe 100.0
1k4m_A213 NAMN adenylyltransferase; nucleotidyltransferase; HET: 100.0
1kam_A194 Deamido-NAD(+), nicotinate-nucleotide adenylyltransfera 100.0
2qtr_A189 Nicotinate (nicotinamide) nucleotide adenylyltransferas 100.0
3nbk_A177 Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: 99.94
1ej2_A181 Nicotinamide mononucleotide adenylyltransferase; dinucl 99.9
1od6_A160 PPAT, phosphopantetheine adenylyltransferase; coenzyme 99.89
1vlh_A173 Phosphopantetheine adenylyltransferase; TM0741, structu 99.89
1f9a_A168 Hypothetical protein MJ0541; alpha/beta, transferase, s 99.88
3k9w_A170 Phosphopantetheine adenylyltransferase; niaid, ssgcid, 99.88
1qjc_A158 Phosphopantetheine adenylyltransferase; coenzyme A bios 99.88
3f3m_A168 Phosphopantetheine adenylyltransferase; PPAT, coenzyme 99.88
3gmi_A 357 UPF0348 protein MJ0951; protein with unknown function, 99.5
1jhd_A396 Sulfate adenylyltransferase; sulfurylase, APS, chemoaut 97.81
1v47_A349 ATP sulfurylase; product binding complex, zinc, riken s 97.69
1r6x_A395 ATP:sulfate adenylyltransferase; APS kinase-like domain 97.63
1m8p_A 573 Sulfate adenylyltransferase; rossmann fold, phosphosulf 97.42
2gks_A 546 Bifunctional SAT/APS kinase; transferase, sulfurylase; 97.38
1g8f_A 511 Sulfate adenylyltransferase; alpha-beta protein, beta-b 97.37
1x6v_B630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfate syn 97.28
2qjo_A 341 Bifunctional NMN adenylyltransferase/nudix hydrolase; t 99.9
1o6b_A169 Phosphopantetheine adenylyltransferase; structural geno 99.86
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl trans 99.68
2qjt_B 352 Nicotinamide-nucleotide adenylyltransferase; two indivi 99.62
3elb_A341 Ethanolamine-phosphate cytidylyltransferase; kennedy pa 98.93
1mrz_A293 Riboflavin kinase/FMN adenylyltransferase; rossmann fol 98.27
3do8_A148 Phosphopantetheine adenylyltransferase; protein with un 99.74
2b7l_A132 Glycerol-3-phosphate cytidylyltransferase; rossmann fol 99.45
1coz_A129 Protein (glycerol-3-phosphate cytidylyltransferase); HE 99.37
3glv_A143 Lipopolysaccharide core biosynthesis protein; structura 99.28
3hl4_A236 Choline-phosphate cytidylyltransferase A; rossmann fold 98.9
3elb_A 341 Ethanolamine-phosphate cytidylyltransferase; kennedy pa 98.86
2x0k_A 338 Riboflavin biosynthesis protein RIBF; riboflavin kinase 98.55
3op1_A308 Macrolide-efflux protein; structural genomics, PSI-2, p 98.07
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase; APS 96.96
>1yum_A 'probable nicotinate-nucleotide adenylyltransferase; alpha/beta domain; HET: CIT NCN; 1.70A {Pseudomonas aeruginosa} PDB: 1yul_A* 1yun_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=332.50  Aligned_cols=192  Identities=21%  Similarity=0.305  Sum_probs=165.0

Q ss_pred             CCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHC-CCCCCCCCHHHHHHH
Q ss_conf             8789982778971338999999999986299889999758998755566889999999986310-475321342553100
Q gi|254780649|r   19 GMKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQSLI-KNPRIRITAFEAYLN   97 (216)
Q Consensus        19 ~mkIgifGGSFdPiH~gHl~ia~~~~~~l~ld~v~~ips~~~p~K~~~~~~~~~~R~~m~~~~~-~~~~i~v~~~E~~~~   97 (216)
                      +||||||||||||||.||+.+++.|.+.+++|+|||+|+++||+|+.. .+++++|++||++++ +.+++.|+++|.+.+
T Consensus        22 ~kkIgifgGSFdP~H~GHl~i~~~a~~~~~~d~V~~~p~~~n~~K~~~-~~~~~~Rl~m~~~a~~~~~~i~vs~~E~~~~  100 (242)
T 1yum_A           22 GKRIGLFGGTFDPVHIGHMRSAVEMAEQFALDELRLLPNARPPHRETP-QVSAAQRLAMVERAVAGVERLTVDPRELQRD  100 (242)
T ss_dssp             CCEEEEEEECCTTCCHHHHHHHHHHHHHHTCSEEEEEECCCCGGGSCT-TCCHHHHHHHHHHHHTTCTTEEECCGGGGSS
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCC-CCCHHHHHHHHHHHHHHCCCEEEECCCCCCC
T ss_conf             986999675857150999999999999819998999983979887876-5588999999877765156058502433478


Q ss_pred             -HHHHHHHHHHHHCCC-CCCCEEEECCCCCHHHHHHHHHHHHHHHHCCEEEEECCCCCHHHHCCHHHHHHHHCCCCHHHH
Q ss_conf             -032899999972013-678438961688135777776199999758989993899871432158999986325881233
Q gi|254780649|r   98 -HTETFHTILQVKKHN-KSVNFVWIMGADNIKSFHQWHHWKRIVTTVPIAIIDRFDVTFNYISSPMAKTFEYARLDESLS  175 (216)
Q Consensus        98 -~syT~dtL~~lk~~~-p~~~l~fiiG~D~l~~l~~W~~~~~ll~~~~iiV~~R~g~~~~~~~~~~~~~~~~~~~~~~~~  175 (216)
                       ++||+|||.++++++ |+.+++||||+|+|.+|++|++|++|++.++|+|++|+|+......+.............   
T Consensus       101 ~~~~t~dtL~~l~~~~~~~~~~~~iiG~D~l~~i~~W~~~~~il~~~~ilV~~R~~~~~~~~~~~~~~~~~~~~~~~---  177 (242)
T 1yum_A          101 KPSYTIDTLESVRAELAADDQLFMLIGWDAFCGLPTWHRWEALLDHCHIVVLQRPDADSEPPESLRDLLAARSVADP---  177 (242)
T ss_dssp             SSCCHHHHHHHHHHHSCTTCEEEEEEEHHHHTTGGGSTTGGGSTTTCEEEEEECSSSCCCCCGGGHHHHHHHBCSCG---
T ss_pred             CCCCHHHHHHHHHHHCCCCCEEEEEECCCHHHHCCCCCCHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCH---
T ss_conf             87309999999876414675179974653064336776899996268589996898642005789999998731268---


Q ss_pred             HHHHHCCCCEEEEEECCCCCCCHHHHHHHHHCCCCCCCCC
Q ss_conf             4542058980999807468868899999998796851116
Q gi|254780649|r  176 HILCTTSPPSWLFIHDRHHIISSTAIRKKIIEQDNTRTLG  215 (216)
Q Consensus       176 ~~~~~~~~~~~~~i~~~~~~ISST~IR~~l~~~~~i~~L~  215 (216)
                       .......+.|.+++.+.++||||+||+++++|+++++|-
T Consensus       178 -~~~~~~~~~i~~~~~~~~dISST~IR~~i~~g~~i~~lv  216 (242)
T 1yum_A          178 -QALKGPGGQITFVWQTPLAVSATQIRALLGAGRSVRFLV  216 (242)
T ss_dssp             -GGCCSSSCCEEEEECCCCSCCHHHHHHHHHTTCCCBTTB
T ss_pred             -HHHHCCCCCEEEECCCCCCCCHHHHHHHHHCCCCHHHHC
T ss_conf             -887376885899689974416999999998599913708



>2h29_A Probable nicotinate-nucleotide adenylyltransferase; NADD, namnat, nmnat; HET: DND; 2.00A {Staphylococcus aureus} PDB: 2h2a_A* Back     alignment and structure
>1kqn_A Nmnat, nicotinamide mononucleotide adenylyl transferase; nucleotidyltransferase superfamily; HET: NAD; 2.20A {Homo sapiens} SCOP: c.26.1.3 PDB: 1kqo_A* 1kr2_A* 1kku_A 1gzu_A* Back     alignment and structure
>1nup_A FKSG76; NAD biosynthesis, cytoplasm, mitochondria, pyridine adenylyltransferase, enzyme catalysi; HET: NMN; 1.90A {Homo sapiens} SCOP: c.26.1.3 PDB: 1nuq_A* 1nur_A 1nus_A* 1nut_A* 1nuu_A* Back     alignment and structure
>3h05_A Uncharacterized protein VPA0413; nucleotidylyl, transferase, MCSG, midwest center for structural genomics, PSI; 1.65A {Vibrio parahaemolyticus} Back     alignment and structure
>1k4m_A NAMN adenylyltransferase; nucleotidyltransferase; HET: NAD CIT; 1.90A {Escherichia coli} SCOP: c.26.1.3 PDB: 1k4k_A* Back     alignment and structure
>1kam_A Deamido-NAD(+), nicotinate-nucleotide adenylyltransferase; rossman fold; 2.10A {Bacillus subtilis} SCOP: c.26.1.3 PDB: 1kaq_A* Back     alignment and structure
>2qtr_A Nicotinate (nicotinamide) nucleotide adenylyltransferase; NAD, nucleotidyltransferase, pyridine nucleotide biosynthesis; HET: NXX; 1.70A {Bacillus anthracis} PDB: 3dv2_A 3mla_A* 3hfj_A* 3mlb_A* 3mmx_A* 3e27_A* 2qtn_A* 2qtm_A* Back     alignment and structure
>3nbk_A Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: PNS; 1.58A {Mycobacterium tuberculosis} PDB: 3nba_A* 3lcj_A* 1tfu_A Back     alignment and structure
>1ej2_A Nicotinamide mononucleotide adenylyltransferase; dinucleotide binding fold, structural genomics, PSI; HET: NAD; 1.90A {Methanothermobacterthermautotrophicus} SCOP: c.26.1.3 PDB: 1m8g_A* 1hyb_A* 1m8j_A* 1m8f_A* 1m8k_A* Back     alignment and structure
>1od6_A PPAT, phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.5A {Thermus thermophilus} SCOP: c.26.1.3 Back     alignment and structure
>1vlh_A Phosphopantetheine adenylyltransferase; TM0741, structural genomics, JCSG, protein structure initiative, PSI; HET: PNS; 2.20A {Thermotoga maritima} SCOP: c.26.1.3 Back     alignment and structure
>1f9a_A Hypothetical protein MJ0541; alpha/beta, transferase, structural genomics; HET: ATP; 2.00A {Methanocaldococcus jannaschii} SCOP: c.26.1.3 Back     alignment and structure
>3k9w_A Phosphopantetheine adenylyltransferase; niaid, ssgcid, seattle structural genomics center for infectious disease, coenzyme A; HET: 4PS ADE PG4; 1.60A {Burkholderia pseudomallei 1710B} PDB: 3ikz_A* Back     alignment and structure
>1qjc_A Phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.64A {Escherichia coli} SCOP: c.26.1.3 PDB: 1h1t_A* 1gn8_A* 1b6t_A* 3l92_A* 3l93_A Back     alignment and structure
>3f3m_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A biosynthetic pathway, coenzyme A biosynthesis, cytoplasm, nucleotidyltransferase; HET: PPS; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3gmi_A UPF0348 protein MJ0951; protein with unknown function, structural genomics, PSI, MCSG, protein structure initiative; 1.91A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1jhd_A Sulfate adenylyltransferase; sulfurylase, APS, chemoautotroph, bromide; 1.70A {Sulfur-oxidizing endosymbiont ofriftia pachyptila} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>1v47_A ATP sulfurylase; product binding complex, zinc, riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; HET: ADX; 2.49A {Thermus thermophilus} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>1r6x_A ATP:sulfate adenylyltransferase; APS kinase-like domain; 1.40A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrolase; two individual domains; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>1o6b_A Phosphopantetheine adenylyltransferase; structural genomics; HET: ADP; 2.20A {Bacillus subtilis} SCOP: c.26.1.3 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide kinase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Back     alignment and structure
>1mrz_A Riboflavin kinase/FMN adenylyltransferase; rossmann fold, flavin binding domain, 6-stranded beta barrel, nucleotide binding domain; HET: CIT; 1.90A {Thermotoga maritima} SCOP: b.43.5.1 c.26.1.3 PDB: 1s4m_A* 1t6x_A* 1t6y_A* 1t6z_A* 2i1l_A Back     alignment and structure
>3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} Back     alignment and structure
>2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} Back     alignment and structure
>1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* Back     alignment and structure
>3glv_A Lipopolysaccharide core biosynthesis protein; structural genomics, PSI, MCSG, protein structure initiative; HET: AMP; 1.99A {Thermoplasma volcanium GSS1} Back     alignment and structure
>3hl4_A Choline-phosphate cytidylyltransferase A; rossmann fold, phospholipid synthesis, phosphatidylcholine, phosphocholine, CTP, CDP-choline; HET: CDC; 2.20A {Rattus norvegicus} Back     alignment and structure
>3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Back     alignment and structure
>2x0k_A Riboflavin biosynthesis protein RIBF; riboflavin kinase, nucleotide-binding, transferase, ATP-binding, multifunctional enzyme; 1.95A {Corynebacterium ammoniagenes} Back     alignment and structure
>3op1_A Macrolide-efflux protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PEG; 2.49A {Streptococcus pneumoniae} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 216 nicotinic acid mononucleotide adenylyltransferase [Cand
d1kr2a_271 c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenyly 2e-17
d1nuua_233 c.26.1.3 (A:) Cytosolic NMN/NAMN adenylyltransferase {H 4e-17
d1k4ma_213 c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenyly 1e-16
d1jhda2223 c.26.1.5 (A:174-396) ATP sulfurylase catalytic domain { 3e-13
d1kama_189 c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenyly 8e-11
d1lw7a1163 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN 1e-09
d1ej2a_167 c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenyly 1e-06
d1qjca_157 c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {E 2e-08
d1od6a_160 c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {T 7e-07
d1o6ba_163 c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {B 2e-06
d1tfua_157 c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {M 8e-06
d1vlha_157 c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {T 2e-05
d1f9aa_164 c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenyly 2e-06
>d1kr2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Adenylyltransferase
domain: Nicotinamide mononucleotide (NMN) adenylyltransferase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 82.6 bits (203), Expect = 2e-17
 Identities = 36/244 (14%), Positives = 74/244 (30%), Gaps = 65/244 (26%)

Query: 22  IGLFGGNFNPPHHGHIEIAQIAIKKLN----LDQLWWIITPFNSVKNYNLSSSLEKRISL 77
           + L  G+FNP  + H+ + ++A   +N       +  II+P               R+ +
Sbjct: 6   VLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIM 65

Query: 78  SQSLIK-NPRIRITAFEAYL-NHTETFHTILQVKKHNKSVN------------------- 116
           ++   K +  + +  +E+      ET   +   ++  ++ +                   
Sbjct: 66  AELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKW 125

Query: 117 ---------------------FVWIMGADNIKSFHQWHHWK-----RIVTTVPIAIIDRF 150
                                   + GAD ++SF   + WK     +IV    +  + R 
Sbjct: 126 TETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRA 185

Query: 151 DVTFNYISSPMAKTFEYARLDESLSHILCTTSPPSWLFIHDRHHIISSTAIRKKIIEQDN 210
                                   S +L        +      + ISST IR+ +    +
Sbjct: 186 GNDAQKFIYE--------------SDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQS 231

Query: 211 TRTL 214
            R L
Sbjct: 232 IRYL 235


>d1nuua_ c.26.1.3 (A:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76 [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d1k4ma_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli [TaxId: 562]} Length = 213 Back     information, alignment and structure
>d1jhda2 c.26.1.5 (A:174-396) ATP sulfurylase catalytic domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]} Length = 223 Back     information, alignment and structure
>d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Length = 189 Back     information, alignment and structure
>d1lw7a1 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN-adenylyltransferase domain {Haemophilus influenzae [TaxId: 727]} Length = 163 Back     information, alignment and structure
>d1ej2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 167 Back     information, alignment and structure
>d1qjca_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]} Length = 157 Back     information, alignment and structure
>d1od6a_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermus thermophilus [TaxId: 274]} Length = 160 Back     information, alignment and structure
>d1o6ba_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Length = 163 Back     information, alignment and structure
>d1tfua_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 157 Back     information, alignment and structure
>d1vlha_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 157 Back     information, alignment and structure
>d1f9aa_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 164 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target216 nicotinic acid mononucleotide adenylyltransferase [Cand
d1kr2a_271 Nicotinamide mononucleotide (NMN) adenylyltransferase { 100.0
d1nuua_233 Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sap 100.0
d1k4ma_213 Nicotinamide mononucleotide (NMN) adenylyltransferase { 100.0
d1jhda2223 ATP sulfurylase catalytic domain {Sulfur-oxidizing endo 100.0
d1kama_189 Nicotinamide mononucleotide (NMN) adenylyltransferase { 100.0
d1ej2a_167 Nicotinamide mononucleotide (NMN) adenylyltransferase { 99.92
d1tfua_157 Phosphopantetheine adenylyltransferase {Mycobacterium t 99.91
d1qjca_157 Phosphopantetheine adenylyltransferase {Escherichia col 99.91
d1o6ba_163 Phosphopantetheine adenylyltransferase {Bacillus subtil 99.9
d1od6a_160 Phosphopantetheine adenylyltransferase {Thermus thermop 99.9
d1f9aa_164 Nicotinamide mononucleotide (NMN) adenylyltransferase { 99.89
d1g8fa2221 ATP sulfurylase catalytic domain {Baker's yeast (Saccha 98.17
d1x6va2235 ATP sulfurylase catalytic domain {Human (Homo sapiens) 98.0
d1v47a2214 ATP sulfurylase catalytic domain {Thermus thermophilus 97.89
d1vlha_157 Phosphopantetheine adenylyltransferase {Thermotoga mari 99.89
d1lw7a1163 Transcriptional regulator NadR, NMN-adenylyltransferase 99.71
d1coza_126 CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus 99.33
d1mrza2157 FMN adenylyltransferase domain of bifunctional FAD synt 98.48
>d1kr2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Adenylyltransferase
domain: Nicotinamide mononucleotide (NMN) adenylyltransferase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=0  Score=299.62  Aligned_cols=181  Identities=18%  Similarity=0.155  Sum_probs=146.2

Q ss_pred             CCEEEEECCCCCCCCHHHHHHHHHHHHHC------CCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHCC-CCCCCCCH
Q ss_conf             87899827789713389999999999862------998899997589987555668899999999863104-75321342
Q gi|254780649|r   19 GMKIGLFGGNFNPPHHGHIEIAQIAIKKL------NLDQLWWIITPFNSVKNYNLSSSLEKRISLSQSLIK-NPRIRITA   91 (216)
Q Consensus        19 ~mkIgifGGSFdPiH~gHl~ia~~~~~~l------~ld~v~~ips~~~p~K~~~~~~~~~~R~~m~~~~~~-~~~i~v~~   91 (216)
                      .-.|++|||||||||+||+.+|+.|++.+      .+|+++|+|++.+|+|  +..++++||++||++|++ .+++.|++
T Consensus         3 ~~~v~l~~GSFdP~H~GHl~ia~~a~~~l~~~~~~~~~~~~~~P~~~~~~k--~~~~s~~~Rl~Ml~la~~~~~~~~vs~   80 (271)
T d1kr2a_           3 TEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKK--KGLIPAYHRVIMAELATKNSKWVEVDT   80 (271)
T ss_dssp             EEEEEEEEECCTTCCHHHHHHHHHHHHHHHHTSSEEEEEEEEEECCGGGCC--TTCCCHHHHHHHHHHHTTTCSSEEECC
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCC--CCCCCHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             638999704467423999999999999974425615467999648998767--788999999999999985699889952


Q ss_pred             HHHHHH-HHHHHHHHHHHHCCC----------------------------------------CCCCEEEECCCCCHHHHH
Q ss_conf             553100-032899999972013----------------------------------------678438961688135777
Q gi|254780649|r   92 FEAYLN-HTETFHTILQVKKHN----------------------------------------KSVNFVWIMGADNIKSFH  130 (216)
Q Consensus        92 ~E~~~~-~syT~dtL~~lk~~~----------------------------------------p~~~l~fiiG~D~l~~l~  130 (216)
                      +|.+++ ++||+|||++++++|                                        |+.+++||||+|++.+|.
T Consensus        81 ~E~~~~~~syTidTl~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~fiiG~D~l~~~~  160 (271)
T d1kr2a_          81 WESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFA  160 (271)
T ss_dssp             HHHHCSSCCCHHHHHHHHHHHHHC--------------------------------------CCCEEEEEEEHHHHHGGG
T ss_pred             HHHHCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCEEEEEECHHHHHHHH
T ss_conf             14306898618999999999832233211125543222222122322221000001123468875089986145887643


Q ss_pred             HHHHH-----HHHHHHCCEEEEECCCCCHHHHCCHHHHHHHHCCCCHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHH
Q ss_conf             77619-----9999758989993899871432158999986325881233454205898099980746886889999999
Q gi|254780649|r  131 QWHHW-----KRIVTTVPIAIIDRFDVTFNYISSPMAKTFEYARLDESLSHILCTTSPPSWLFIHDRHHIISSTAIRKKI  205 (216)
Q Consensus       131 ~W~~~-----~~ll~~~~iiV~~R~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~ISST~IR~~l  205 (216)
                      +|+.|     ++|++.++|+|++|+|+.......              ....+.....+.+++.+.+.++||||+||++|
T Consensus       161 ~~~~wk~~~~~~il~~~~liV~~R~g~~~~~~~~--------------~~~~l~~~~~~i~~~~~~~~~~ISST~IR~~i  226 (271)
T d1kr2a_         161 VPNLWKSEDITQIVANYGLICVTRAGNDAQKFIY--------------ESDVLWKHRSNIHVVNEWIANDISSTKIRRAL  226 (271)
T ss_dssp             STTTSCHHHHHHHHHHTCEEEEESCHHHHHHHHH--------------TCHHHHHTGGGEEEEECCSEECCCHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHCCEEEEECCCCCHHHHHH--------------HHHHHHHCCCCEEEECCCCCCCCCHHHHHHHH
T ss_conf             1276534409999965889999589998677431--------------27898756598599768886673899999999


Q ss_pred             HCCCCCCCCC
Q ss_conf             8796851116
Q gi|254780649|r  206 IEQDNTRTLG  215 (216)
Q Consensus       206 ~~~~~i~~L~  215 (216)
                      ++|+++++|-
T Consensus       227 ~~g~~i~~lv  236 (271)
T d1kr2a_         227 RRGQSIRYLV  236 (271)
T ss_dssp             HTTCCCBTTB
T ss_pred             HCCCCCHHHC
T ss_conf             8599922638



>d1nuua_ c.26.1.3 (A:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76 [TaxId: 9606]} Back     information, alignment and structure
>d1k4ma_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jhda2 c.26.1.5 (A:174-396) ATP sulfurylase catalytic domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]} Back     information, alignment and structure
>d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ej2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1tfua_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qjca_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6ba_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1od6a_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f9aa_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g8fa2 c.26.1.5 (A:169-389) ATP sulfurylase catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va2 c.26.1.5 (A:390-624) ATP sulfurylase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v47a2 c.26.1.5 (A:136-349) ATP sulfurylase catalytic domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vlha_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lw7a1 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN-adenylyltransferase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1coza_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mrza2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure