254780652

254780652

Fructose-bisphosphate aldolase

GeneID in NCBI database:8209655Locus tag:CLIBASIA_02695
Protein GI in NCBI database:254780652Protein Accession:YP_003065065.1
Gene range:+(619963, 620982)Protein Length:339aa
Gene description:Fructose-bisphosphate aldolase
COG prediction:[G] Fructose-1,6-bisphosphate aldolase
KEGG prediction:fructose-bisphosphate aldolase; K01623 fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
SEED prediction:Fructose-bisphosphate aldolase class I (EC 4.1.2.13)
Pathway involved in KEGG:Glycolysis / Gluconeogenesis [PATH:las00010]
Pentose phosphate pathway [PATH:las00030]
Fructose and mannose metabolism [PATH:las00051]
Subsystem involved in SEED:Formaldehyde assimilation: Ribulose monophosphate pathway
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MMQDLENSVAMMLQAGKGILAADESNATIQKRFKAIHLESTENSRRDYREMLFRAKDAMQYISSILLYEETLYQNAQDGTSFVDLISSSGVLVGIKVDRGLKPYPLYPGEHITVGLDDLDVRLKQYKDAGARVAKWRVVLSVSDVLPSMTVVKANMHILARYAVLCQNAGLVPIVEPEVLMEGDHTIERCAEVTEFVLRTLFNELYTMRVCFEGLVLKSNMILPGKSAPQVSDEEIASNTIKIFKRVVPCAVQGIAFLSGGQSEQDATARLSAMNSMGDCPWRLSFSYGRALQESVLRAWNGKQDNVVVAQRVLSHRAHMNSLATKGCWKKSLENSNGR
cHHHHHHHHHHHHHccccEEEEccccccHHHHHHHccccccHHHHHHHHHHHHccccccccEEEEEEcHHHHcccccccccHHHHHHHcccccEEEEcccccccccccccEEEcccccHHHHHHHHHHccccEEcHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHcccEEEEcccccccccccccHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHcccccccccEEEEEHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHccc
HHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHcEEEEEEcHHHHccEcccccEHHHHHHHcccEEEEEccccEEEcccccccEEEcccccHHHHHHHHHHccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHccccHHHcEEcccccccccccccccHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHccccccccEEEEEEcHHHcHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccHHccccccc
MMQDLENSVAMMLQAGKGILAADESNATIQKRFKAIHLESTENSRRDYREMLFRAKDAMQYISSILLYEETLYQNAQDGTSFVDLISssgvlvgikvdrglkpyplypgehitvGLDDLDVRLKQYKDAGARVAKWRVVLSVsdvlpsmtVVKANMHILARYAVLCQnaglvpivepevlmegdhtIERCAEVTEFVLRTLFNELYTMRVCFEGlvlksnmilpgksapqvsdeeIASNTIKIFKRVVPCAVQGiaflsggqsEQDATARLSAMnsmgdcpwrlsfSYGRALQESVLRAWNGKQDNVVVAQRVLSHRAhmnslatkgcwkkslensngr
MMQDLENSVAMMLQAGKGILAADESNATIQKRFkaihlestensrrDYREMLFRAKDAMQYISSILLYEETLYQNAQDGTSFVDLISSSGVLVGIKVDRGLKPYPLYPGEHITVGLDDLDVRLKQYKDagarvakwrvvLSVSDVLPSMTVVKANMHILARYAVLCQNAGLVPIVEPEVLMEGDHTIERCAEVTEFVLRTLFNELYTMRVCFEGLVLKSNMILPGKSAPQVSDEEIASNTIKIFKRVVPCAVQGIAFLSGGQSEQDATARLSAMNSMGDCPWRLSFSYGRALQESVLRAWNGKQDNVVVAQRVLSHrahmnslatkgcwkkslensngr
MMQDLENSVAMMLQAGKGILAADESNATIQKRFKAIHLESTENSRRDYREMLFRAKDAMQYISSILLYEETLYQNAQDGTSFVDLISSSGVLVGIKVDRGLKPYPLYPGEHITVGLDDLDVRLKQYKDAGARVAKWRVVLSVSDVLPSMTVVKANMHILARYAVLCQNAGLVPIVEPEVLMEGDHTIERCAEVTEFVLRTLFNELYTMRVCFEGLVLKSNMILPGKSAPQVSDEEIASNTIKIFKRVVPCAVQGIAFLSGGQSEQDATARLSAMNSMGDCPWRLSFSYGRALQESVLRAWNGKQDNVVVAQRVLSHRAHMNSLATKGCWKKSLENSNGR
**QDLENSVAMMLQAGKGILAADESNATIQKRFKAIHLESTENSRRDYREMLFRAKDAMQYISSILLYEETLYQNAQDGTSFVDLISSSGVLVGIKVDRGLKPYPLYPGEHITVGLDDLDVRLKQYKDAGARVAKWRVVLSVSDVLPSMTVVKANMHILARYAVLCQNAGLVPIVEPEVLMEGDHTIERCAEVTEFVLRTLFNELYTMRVCFEGLVLKSNMILPGKSAPQVSDEEIASNTIKIFKRVVPCAVQGIAFLSGGQSEQDATARLSAMNSMGDCPWRLSFSYGRALQESVLRAWNGKQDNVVVAQRVLSHRAHMNSLAT**************
MMQDLENSVAMMLQAGKGILAADESNATIQKRFKAIHLESTENSRRDYREMLFRAKDAMQYISSILLYEETLYQNAQDGTSFVDLISSSGVLVGIKVDRGLKPYPLYPGEHITVGLDDLDVRLKQYKDAGARVAKWRVVLSVSDVLPSMTVVKANMHILARYAVLCQNAGLVPIVEPEVLMEGDHTIERCAEVTEFVLRTLFNELYTMRVCFEGLVLKSNMILPGKSAPQVSDEEIASNTIKIFKRVVPCAVQGIAFLSGGQSEQDATARLSAMNSMGDCPWRLSFSYGRALQESVLRAWNGKQDNVVVAQRVLSHRAHMNSLATKGCWKK********
MMQDLENSVAMMLQAGKGILAADESNATIQKRFKAIHLESTENSRRDYREMLFRAKDAMQYISSILLYEETLYQNAQDGTSFVDLISSSGVLVGIKVDRGLKPYPLYPGEHITVGLDDLDVRLKQYKDAGARVAKWRVVLSVSDVLPSMTVVKANMHILARYAVLCQNAGLVPIVEPEVLMEGDHTIERCAEVTEFVLRTLFNELYTMRVCFEGLVLKSNMILPGKSAPQVSDEEIASNTIKIFKRVVPCAVQGIAFLSGGQSEQDATARLSAMNSMGDCPWRLSFSYGRALQESVLRAWNGKQDNVVVAQRVLSHRAHMNSLATK*************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMQDLENSVAMMLQAGKGILAADESNATIQKRFKAIHLESTENSRRDYREMLFRAKDAMQYISSILLYEETLYQNAQDGTSFVDLISSSGVLVGIKVDRGLKPYPLYPGEHITVGLDDLDVRLKQYKDAGARVAKWRVVLSVSDVLPSMTVVKANMHILARYAVLCQNAGLVPIVEPEVLMEGDHTIERCAEVTEFVLRTLFNELYTMRVCFEGLVLKSNMILPGKSAPQVSDEEIASNTIKIFKRVVPCAVQGIAFLSGGQSEQDATARLSAMNSMGDCPWRLSFSYGRALQESVLRAWNGKQDNVVVAQRVLSHRAHMNSLATKGCWKKSLENSNGR
MMQDLENSVAMMLQAGKGILAADESNATIQKRFKAIHLESTENSRRDYREMLFRAKDAMQYISSILLYEETLYQNAQDGTSFVDLISSSGVLVGIKVDRGLKPYPLYPGEHITVGLDDLDVRLKQYKDAGARVAKWRVVLSVSDVLPSMTVVKANMHILARYAVLCQNAGLVPIVEPEVLMEGDHTIERCAEVTEFVLRTLFNELYTMRVCFEGLVLKSNMILPGKSAPQVSDEEIASNTIKIFKRVVPCAVQGIAFLSGGQSEQDATARLSAMNSMGDCPWRLSFSYGRALQESVLRAWNGKQDNVVVAQRVLSHRAHMNSLATKGCWKKSLENSNGR
MMQDLENSVAMMLQAGKGILAADESNATIQKRFKAIHLESTENSRRDYREMLFRAKDAMQYISSILLYEETLYQNAQDGTSFVDLISSSGVLVGIKVDRGLKPYPLYPGEHITVGLDDLDVRLKQYKDAGARVAKWRVVLSVSDVLPSMTVVKANMHILARYAVLCQNAGLVPIVEPEVLMEGDHTIERCAEVTEFVLRTLFNELYTMRVCFEGLVLKSNMILPGKSAPQVSDEEIASNTIKIFKRVVPCAVQGIAFLSGGQSEQDATARLSAMNSMGDCPWRLSFSYGRALQESVLRAWNGKQDNVVVAQRVLSHRAHMNSLATKGCWKKSLENSNGR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target339 Fructose-bisphosphate aldolase [Candidatus Liberibacter
315122162339 fructose-bisphosphate aldolase [Candidatus Liberibacter 1 1e-171
227823337341 fructose-bisphosphate aldolase [Sinorhizobium fredii NG 1 1e-116
241206228341 Fructose-bisphosphate aldolase [Rhizobium leguminosarum 1 1e-115
218674743341 Fructose-bisphosphate aldolase [Rhizobium etli GR56] Le 1 1e-115
209550818341 fructose-bisphosphate aldolase [Rhizobium leguminosarum 1 1e-114
116253751332 fructose-bisphosphate aldolase [Rhizobium leguminosarum 1 1e-114
150397852341 fructose-bisphosphate aldolase [Sinorhizobium medicae W 1 1e-113
190893317340 fructose-bisphosphate aldolase [Rhizobium etli CIAT 652 1 1e-113
15966520341 fructose-bisphosphate aldolase class I protein [Sinorhi 1 1e-113
332716471341 fructose-bisphosphate aldolase [Agrobacterium sp. H13-3 1 1e-113
>gi|315122162|ref|YP_004062651.1| fructose-bisphosphate aldolase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 339 Back     alignment and organism information
 Score =  606 bits (1562), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 286/339 (84%), Positives = 315/339 (92%)

Query: 1   MMQDLENSVAMMLQAGKGILAADESNATIQKRFKAIHLESTENSRRDYREMLFRAKDAMQ 60
           M+++L+ +VA +LQ GKGILAADESNATIQKRF AI++ESTEN RRDYREMLFR+KDAMQ
Sbjct: 1   MVEELKRNVATILQEGKGILAADESNATIQKRFNAINVESTENLRRDYREMLFRSKDAMQ 60

Query: 61  YISSILLYEETLYQNAQDGTSFVDLISSSGVLVGIKVDRGLKPYPLYPGEHITVGLDDLD 120
           YISSILLYEETLYQ +QDGT  VDLISSSGVL+GIKVDRGLKP PLYPGE IT+GLDDLD
Sbjct: 61  YISSILLYEETLYQKSQDGTPLVDLISSSGVLIGIKVDRGLKPCPLYPGECITIGLDDLD 120

Query: 121 VRLKQYKDAGARVAKWRVVLSVSDVLPSMTVVKANMHILARYAVLCQNAGLVPIVEPEVL 180
           VRLK YKDAGARVAKWRVVLSVSDVLPS+ VVKANMHILARYA LCQ+AG+VPIVEPEVL
Sbjct: 121 VRLKLYKDAGARVAKWRVVLSVSDVLPSVAVVKANMHILARYAALCQSAGIVPIVEPEVL 180

Query: 181 MEGDHTIERCAEVTEFVLRTLFNELYTMRVCFEGLVLKSNMILPGKSAPQVSDEEIASNT 240
           M+GDHTIERCAEVTEFVLRTLF+ELYTMRVCFEGLVLKSNMILPGK APQVSDEEIA+ T
Sbjct: 181 MDGDHTIERCAEVTEFVLRTLFDELYTMRVCFEGLVLKSNMILPGKDAPQVSDEEIANKT 240

Query: 241 IKIFKRVVPCAVQGIAFLSGGQSEQDATARLSAMNSMGDCPWRLSFSYGRALQESVLRAW 300
           I+I KRVVPC+VQGIAFLSGGQSEQDATARLSAMN+MG+ PWRLSFSYGRALQES LR W
Sbjct: 241 IRILKRVVPCSVQGIAFLSGGQSEQDATARLSAMNAMGNSPWRLSFSYGRALQESALRVW 300

Query: 301 NGKQDNVVVAQRVLSHRAHMNSLATKGCWKKSLENSNGR 339
           NGKQ+N++ AQRVLSHRA MNSLATKGCW++ LE +N +
Sbjct: 301 NGKQENIIAAQRVLSHRAQMNSLATKGCWERHLERNNDK 339


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227823337|ref|YP_002827309.1| fructose-bisphosphate aldolase [Sinorhizobium fredii NGR234] Length = 341 Back     alignment and organism information
>gi|241206228|ref|YP_002977324.1| Fructose-bisphosphate aldolase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 341 Back     alignment and organism information
>gi|218674743|ref|ZP_03524412.1| Fructose-bisphosphate aldolase [Rhizobium etli GR56] Length = 341 Back     alignment and organism information
>gi|209550818|ref|YP_002282735.1| fructose-bisphosphate aldolase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 341 Back     alignment and organism information
>gi|116253751|ref|YP_769589.1| fructose-bisphosphate aldolase [Rhizobium leguminosarum bv. viciae 3841] Length = 332 Back     alignment and organism information
>gi|150397852|ref|YP_001328319.1| fructose-bisphosphate aldolase [Sinorhizobium medicae WSM419] Length = 341 Back     alignment and organism information
>gi|190893317|ref|YP_001979859.1| fructose-bisphosphate aldolase [Rhizobium etli CIAT 652] Length = 340 Back     alignment and organism information
>gi|15966520|ref|NP_386873.1| fructose-bisphosphate aldolase class I protein [Sinorhizobium meliloti 1021] Length = 341 Back     alignment and organism information
>gi|332716471|ref|YP_004443937.1| fructose-bisphosphate aldolase [Agrobacterium sp. H13-3] Length = 341 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target339 Fructose-bisphosphate aldolase [Candidatus Liberibacter
cd00948330 cd00948, FBP_aldolase_I_a, Fructose-1,6-bisphosphate al 1e-125
PTZ00019355 PTZ00019, PTZ00019, fructose-bisphosphate aldolase; Pro 1e-112
COG3588332 COG3588, COG3588, Fructose-1,6-bisphosphate aldolase [C 1e-107
KOG1557363 KOG1557, KOG1557, KOG1557, Fructose-biphosphate aldolas 1e-107
PLN02455358 PLN02455, PLN02455, fructose-bisphosphate aldolase 1e-107
PLN02425390 PLN02425, PLN02425, probable fructose-bisphosphate aldo 3e-80
PLN02227399 PLN02227, PLN02227, fructose-bisphosphate aldolase I 2e-72
cd00344328 cd00344, FBP_aldolase_I, Fructose-bisphosphate aldolase 6e-64
pfam00274348 pfam00274, Glycolytic, Fructose-bisphosphate aldolase c 1e-126
cd00949292 cd00949, FBP_aldolase_I_bact, Fructose-1 1e-05
PRK05377296 PRK05377, PRK05377, fructose-1,6-bisphosphate aldolase; 7e-04
>gnl|CDD|29941 cd00948, FBP_aldolase_I_a, Fructose-1,6-bisphosphate aldolase Back     alignment and domain information
>gnl|CDD|185401 PTZ00019, PTZ00019, fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>gnl|CDD|33388 COG3588, COG3588, Fructose-1,6-bisphosphate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|36770 KOG1557, KOG1557, KOG1557, Fructose-biphosphate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|178074 PLN02455, PLN02455, fructose-bisphosphate aldolase Back     alignment and domain information
>gnl|CDD|178045 PLN02425, PLN02425, probable fructose-bisphosphate aldolase Back     alignment and domain information
>gnl|CDD|177872 PLN02227, PLN02227, fructose-bisphosphate aldolase I Back     alignment and domain information
>gnl|CDD|29935 cd00344, FBP_aldolase_I, Fructose-bisphosphate aldolase class I Back     alignment and domain information
>gnl|CDD|144019 pfam00274, Glycolytic, Fructose-bisphosphate aldolase class-I Back     alignment and domain information
>gnl|CDD|29942 cd00949, FBP_aldolase_I_bact, Fructose-1 Back     alignment and domain information
>gnl|CDD|180045 PRK05377, PRK05377, fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 339 Fructose-bisphosphate aldolase [Candidatus Liberibacter
PTZ00019356 fructose-bisphosphate aldolase; Provisional 100.0
pfam00274348 Glycolytic Fructose-bisphosphate aldolase class-I. 100.0
cd00948330 FBP_aldolase_I_a Fructose-1,6-bisphosphate aldolase. Th 100.0
cd00344328 FBP_aldolase_I Fructose-bisphosphate aldolase class I. 100.0
KOG1557363 consensus 100.0
COG3588332 Fructose-1,6-bisphosphate aldolase [Carbohydrate transp 100.0
PRK04161326 tagatose 1,6-diphosphate aldolase; Reviewed 95.41
cd00949292 FBP_aldolase_I_bact Fructose-1.6-bisphosphate aldolase 100.0
PRK05377296 fructose-1,6-bisphosphate aldolase; Reviewed 100.0
PRK12399324 tagatose 1,6-diphosphate aldolase; Reviewed 94.19
>PTZ00019 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>pfam00274 Glycolytic Fructose-bisphosphate aldolase class-I Back     alignment and domain information
>cd00948 FBP_aldolase_I_a Fructose-1,6-bisphosphate aldolase Back     alignment and domain information
>cd00344 FBP_aldolase_I Fructose-bisphosphate aldolase class I Back     alignment and domain information
>KOG1557 consensus Back     alignment and domain information
>COG3588 Fructose-1,6-bisphosphate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04161 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>cd00949 FBP_aldolase_I_bact Fructose-1 Back     alignment and domain information
>PRK05377 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK12399 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target339 Fructose-bisphosphate aldolase [Candidatus Liberibacter
1zah_A363 Fructose-1,6-Bisphosphate Aldolase From Rabbit Musc 1e-134
4ald_A363 Human Muscle Fructose 1,6-Bisphosphate Aldolase Com 1e-134
3b8d_A363 Fructose 1,6-Bisphosphate Aldolase From Rabbit Musc 1e-133
1ex5_A363 Fructose 1,6-Bisphosphate Aldolase From Rabbit Musc 1e-133
1ado_A363 Fructose 1,6-Bisphosphate Aldolase From Rabbit Musc 1e-133
6ald_A363 Rabbit Muscle Aldolase AFRUCTOSE-1,6-Bisphosphate C 1e-133
2quu_A363 Dihydroxyacetone Phosphate Schiff Base Intermediate 1e-133
1ewe_A363 Fructose 1,6-Bisphosphate Aldolase From Rabbit Musc 1e-133
1ewd_A363 Fructose 1,6-Bisphosphate Aldolase From Rabbit Musc 1e-132
3dfn_A363 D33n Mutant Fructose-1,6-Bisphosphate Aldolase From 1e-132
3bv4_A341 Crystal Structure Of A Rabbit Muscle Fructose-1,6- 1e-132
3dfq_A363 D33s Mutant Fructose-1,6-Bisphosphate Aldolase From 1e-132
1j4e_A363 Fructose-1,6-Bisphosphate Aldolase Covalently Bound 1e-132
1xfb_A365 Human Brain Fructose 1,6-(Bis)phosphate Aldolase (C 1e-131
1fba_A361 The Crystal Structure Of Fructose-1,6-Bisphosphate 1e-128
1fdj_A363 Fructose 1,6-Bisphosphate Aldolase From Rabbit Live 1e-119
1qo5_A363 Fructose 1,6-Bisphosphate Aldolase From Human Liver 1e-118
1xdl_A365 Structure Of Human Aldolase B Associated With Hered 1e-118
3mmt_A347 Crystal Structure Of Fructose Bisphosphate Aldolase 1e-118
3kx6_A379 Crystal Structure Of Fructose-1,6-Bisphosphate Aldo 1e-114
1a5c_A368 Fructose-1,6-Bisphosphate Aldolase From Plasmodium 1e-112
2eph_A369 Crystal Structure Of Fructose-Bisphosphate Aldolase 1e-112
1f2j_A370 Crystal Structure Analysis Of Aldolase From T. Bruc 1e-109
2qap_A391 Fructose-1,6-Bisphosphate Aldolase From Leishmania 1e-106
1epx_A370 Crystal Structure Analysis Of Aldolase From L. Mexi 1e-106
3mbf_A342 Crystal Structure Of Fructose Bisphosphate Aldolase 1e-89
2iqt_A296 Crystal Structure Of Fructose-Bisphosphate Aldolase 8e-30
>gi|67464529|pdb|1ZAH|A Chain A, Fructose-1,6-Bisphosphate Aldolase From Rabbit Muscle Length = 363 Back     alignment and structure
 Score =  481 bits (1239), Expect = e-134,   Method: Composition-based stats.
 Identities = 156/339 (46%), Positives = 209/339 (61%), Gaps = 3/339 (0%)

Query: 3   QDLENSVAMMLQAGKGILAADESNATIQKRFKAIHLESTENSRRDYREMLFRAKD-AMQY 61
           ++L +    ++  GKGILAADES  +I KR ++I  E+TE +RR YR++L  A D     
Sbjct: 13  KELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPC 72

Query: 62  ISSILLYEETLYQNAQDGTSFVDLISSSGVLVGIKVDRGLKPYPLYPGEHITVGLDDLDV 121
           I  ++L+ ETLYQ A DG  F  +I S G +VGIKVD+G+ P     GE  T GLD L  
Sbjct: 73  IGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSE 132

Query: 122 RLKQYKDAGARVAKWRVVLSVSDVLPSMTVVKANMHILARYAVLCQNAGLVPIVEPEVLM 181
           R  QYK  GA  AKWR VL + +  PS   +  N ++LARYA +CQ  G+VPIVEPE+L 
Sbjct: 133 RCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILP 192

Query: 182 EGDHTIERCAEVTEFVLRTLFNELYTMRVCFEGLVLKSNMILPGKSA-PQVSDEEIASNT 240
           +GDH ++RC  VTE VL  ++  L    +  EG +LK NM+ PG +   + S EEIA  T
Sbjct: 193 DGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKYSHEEIAMAT 252

Query: 241 IKIFKRVVPCAVQGIAFLSGGQSEQDATARLSAMNSMG-DCPWRLSFSYGRALQESVLRA 299
           +   +R VP AV G+ FLSGGQSE++A+  L+A+N      PW L+FSYGRALQ S L+A
Sbjct: 253 VTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKA 312

Query: 300 WNGKQDNVVVAQRVLSHRAHMNSLATKGCWKKSLENSNG 338
           W GK++N+  AQ     RA  NSLA +G +  S +    
Sbjct: 313 WGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAA 351


>gi|4557976|pdb|4ALD|A Chain A, Human Muscle Fructose 1,6-Bisphosphate Aldolase Complexed With Fructose 1,6-Bisphosphate Length = 363 Back     alignment and structure
>gi|160286558|pdb|3B8D|A Chain A, Fructose 1,6-Bisphosphate Aldolase From Rabbit Muscle Length = 363 Back     alignment and structure
>gi|253722152|pdb|1EX5|A Chain A, Fructose 1,6-Bisphosphate Aldolase From Rabbit Muscle Length = 363 Back     alignment and structure
>gi|2781027|pdb|1ADO|A Chain A, Fructose 1,6-Bisphosphate Aldolase From Rabbit Muscle Length = 363 Back     alignment and structure
>gi|6730618|pdb|6ALD|A Chain A, Rabbit Muscle Aldolase AFRUCTOSE-1,6-Bisphosphate Complex Length = 363 Back     alignment and structure
>gi|158430448|pdb|2QUU|A Chain A, Dihydroxyacetone Phosphate Schiff Base Intermediate In Mutant Fructose-1,6-Bisphosphate Aldolase From Rabbit Muscle Length = 363 Back     alignment and structure
>gi|13096351|pdb|1EWE|A Chain A, Fructose 1,6-Bisphosphate Aldolase From Rabbit Muscle Length = 363 Back     alignment and structure
>gi|13096347|pdb|1EWD|A Chain A, Fructose 1,6-Bisphosphate Aldolase From Rabbit Muscle Length = 363 Back     alignment and structure
>gi|228311978|pdb|3DFN|A Chain A, D33n Mutant Fructose-1,6-Bisphosphate Aldolase From Rabbit Muscle Length = 363 Back     alignment and structure
>gi|192988474|pdb|3BV4|A Chain A, Crystal Structure Of A Rabbit Muscle Fructose-1,6- Bisphosphate Aldolase A Dimer Variant Length = 341 Back     alignment and structure
>gi|228311995|pdb|3DFQ|A Chain A, D33s Mutant Fructose-1,6-Bisphosphate Aldolase From Rabbit Muscle Length = 363 Back     alignment and structure
>gi|20150311|pdb|1J4E|A Chain A, Fructose-1,6-Bisphosphate Aldolase Covalently Bound To The Substrate Dihydroxyacetone Phosphate Length = 363 Back     alignment and structure
>gi|61680382|pdb|1XFB|A Chain A, Human Brain Fructose 1,6-(Bis)phosphate Aldolase (C Isozyme) Length = 365 Back     alignment and structure
>gi|253722156|pdb|1FBA|A Chain A, The Crystal Structure Of Fructose-1,6-Bisphosphate Aldolase From Drosophila Melanogaster At 2.5 Angstroms Resolution Length = 361 Back     alignment and structure
>gi|15826063|pdb|1FDJ|A Chain A, Fructose 1,6-Bisphosphate Aldolase From Rabbit Liver Length = 363 Back     alignment and structure
>gi|11514029|pdb|1QO5|A Chain A, Fructose 1,6-Bisphosphate Aldolase From Human Liver Tissue Length = 363 Back     alignment and structure
>gi|62738407|pdb|1XDL|A Chain A, Structure Of Human Aldolase B Associated With Hereditary Fructose Intolerance (A149p), At 277k Length = 365 Back     alignment and structure
>gi|296278578|pdb|3MMT|A Chain A, Crystal Structure Of Fructose Bisphosphate Aldolase From Bar Henselae, Bound To Fructose Bisphosphate Length = 347 Back     alignment and structure
>gi|281500998|pdb|3KX6|A Chain A, Crystal Structure Of Fructose-1,6-Bisphosphate Aldolase From Babesia Bovis At 2.1a Resolution Length = 379 Back     alignment and structure
>gi|3319034|pdb|1A5C|A Chain A, Fructose-1,6-Bisphosphate Aldolase From Plasmodium Falciparum Length = 368 Back     alignment and structure
gi|146386478|pdb|2EPH|A Chain A, Crystal Structure Of Fructose-Bisphosphate Aldolase From Plasmodium Falciparum In Complex With Trap-Tail Determined At 2.7 Angstrom Resolution Length = 369 Back     alignment and structure
>gi|9955243|pdb|1F2J|A Chain A, Crystal Structure Analysis Of Aldolase From T. Brucei Length = 370 Back     alignment and structure
>gi|159795189|pdb|2QAP|A Chain A, Fructose-1,6-Bisphosphate Aldolase From Leishmania Mexicana Length = 391 Back     alignment and structure
>gi|9955237|pdb|1EPX|A Chain A, Crystal Structure Analysis Of Aldolase From L. Mexicana Length = 370 Back     alignment and structure
>gi|293652067|pdb|3MBF|A Chain A, Crystal Structure Of Fructose Bisphosphate Aldolase From Encephalitozoon Cuniculi, Bound To Fructose 1,6-Bisphosphate Length = 342 Back     alignment and structure
>gi|119390276|pdb|2IQT|A Chain A, Crystal Structure Of Fructose-Bisphosphate Aldolase, Class I From Porphyromonas Gingivalis Length = 296 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target339 Fructose-bisphosphate aldolase [Candidatus Liberibacter
3bv4_A341 Fructose-bisphosphate aldolase A; lyase, acetylation, g 1e-126
3mmt_A347 Fructose-bisphosphate aldolase; ssgcid, structural geno 1e-116
3kx6_A379 Fructose-bisphosphate aldolase; ssgcid, NIH, niaid, SBR 1e-115
3mbd_A342 Fructose-bisphosphate aldolase; glycolysis, lyase, schi 1e-107
2qap_A391 Fructose-1,6-bisphosphate aldolase; beta barrel, C-temi 1e-97
2pc4_A369 41 kDa antigen, fructose-bisphosphate aldolase; invasio 6e-95
2iqt_A296 Fructose-bisphosphate aldolase class 1; TIM berrel, str 7e-68
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 0.003
>3bv4_A Fructose-bisphosphate aldolase A; lyase, acetylation, glycolysis, phosphoprotein, schiff base; HET: 13P; 1.70A {Oryctolagus cuniculus} PDB: 1ado_A* 1ewd_A 1zai_A* 1zah_A* 1zaj_A* 1zal_A 2ot0_A 2ot1_A* 2qut_A 2quv_A 3lge_A 3b8d_A 6ald_A* 1ex5_A 1ewe_A 2quu_A 3dfn_A 3dfo_A 3dfp_A 3dfq_A ... Length = 341 Back     alignment and structure
 Score =  445 bits (1147), Expect = e-126
 Identities = 154/330 (46%), Positives = 206/330 (62%), Gaps = 3/330 (0%)

Query: 3   QDLENSVAMMLQAGKGILAADESNATIQKRFKAIHLESTENSRRDYREMLFRAKDAM-QY 61
           ++L +    ++  GKGILAADES  +I KR ++I  E+TE +RR YR++L  A D +   
Sbjct: 10  KELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPC 69

Query: 62  ISSILLYEETLYQNAQDGTSFVDLISSSGVLVGIKVDRGLKPYPLYPGEHITVGLDDLDV 121
           I  ++L+ ETLYQ A DG  F  +I S G +VGIKVD+G+ P     GE  T GL  L  
Sbjct: 70  IGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLVGLSE 129

Query: 122 RLKQYKDAGARVAKWRVVLSVSDVLPSMTVVKANMHILARYAVLCQNAGLVPIVEPEVLM 181
           R  QYK  GA  AKWR VL + +  PS   +  N ++LARYA +CQ  G+VPIVEPE+L 
Sbjct: 130 RCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILP 189

Query: 182 EGDHTIERCAEVTEFVLRTLFNELYTMRVCFEGLVLKSNMILPGK-SAPQVSDEEIASNT 240
           +GDH ++RC  VTE VL  ++  L    +  EG +LK NM+ PG     + S EEIA  T
Sbjct: 190 DGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKYSHEEIAMAT 249

Query: 241 IKIFKRVVPCAVQGIAFLSGGQSEQDATARLSAMNSMGDC-PWRLSFSYGRALQESVLRA 299
           +   +R VP AV G+ FLSGGQSE++A+  L+A+N      PW L+FSYGRALQ S L+A
Sbjct: 250 VTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKA 309

Query: 300 WNGKQDNVVVAQRVLSHRAHMNSLATKGCW 329
           W GK++N+  AQ     RA  NSLA +G +
Sbjct: 310 WGGKKENLKAAQEEYVKRALANSLACQGKY 339


>3mmt_A Fructose-bisphosphate aldolase; ssgcid, structural genomics, seattle structural GE center for infectious disease, hydrolase; HET: 2FP; 2.35A {Bartonella henselae} Length = 347 Back     alignment and structure
>3kx6_A Fructose-bisphosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, glycolysis, lyase, structural genomics; HET: CIT; 2.10A {Babesia bovis} Length = 379 Back     alignment and structure
>3mbd_A Fructose-bisphosphate aldolase; glycolysis, lyase, schiff base, structural genomics; 2.00A {Encephalitozoon cuniculi} PDB: 3mbf_A* Length = 342 Back     alignment and structure
>2qap_A Fructose-1,6-bisphosphate aldolase; beta barrel, C-teminal tail, lyase; 1.59A {Leishmania mexicana} SCOP: c.1.10.1 PDB: 2qdg_A* 2qdh_A* 1epx_A 1f2j_A Length = 391 Back     alignment and structure
>2pc4_A 41 kDa antigen, fructose-bisphosphate aldolase; invasion machinery, structural genomics, PSI, protein structure initiative; 2.40A {Plasmodium falciparum} PDB: 2eph_A 1a5c_A Length = 369 Back     alignment and structure
>2iqt_A Fructose-bisphosphate aldolase class 1; TIM berrel, structural genomics, PSI-2, protein structure initiative; 2.46A {Porphyromonas gingivalis W83} Length = 296 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target339 Fructose-bisphosphate aldolase [Candidatus Liberibacter
2qap_A391 Fructose-1,6-bisphosphate aldolase; beta barrel, C-temi 100.0
3mmt_A347 Fructose-bisphosphate aldolase; ssgcid, structural geno 100.0
2pc4_A369 41 kDa antigen, fructose-bisphosphate aldolase; invasio 100.0
3kx6_A379 Fructose-bisphosphate aldolase; ssgcid, NIH, niaid, SBR 100.0
3bv4_A341 Fructose-bisphosphate aldolase A; lyase, acetylation, g 100.0
3mbd_A342 Fructose-bisphosphate aldolase; glycolysis, lyase, schi 100.0
2iqt_A296 Fructose-bisphosphate aldolase class 1; TIM berrel, str 100.0
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosph 97.54
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structural g 95.49
>2qap_A Fructose-1,6-bisphosphate aldolase; beta barrel, C-teminal tail, lyase; 1.59A {Leishmania mexicana} SCOP: c.1.10.1 PDB: 2qdg_A* 2qdh_A* 1epx_A 1f2j_A Back     alignment and structure
Probab=100.00  E-value=0  Score=1031.04  Aligned_cols=337  Identities=41%  Similarity=0.675  Sum_probs=331.0

Q ss_pred             HHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHCCCCCCHHHHHHHHHHHEECCCCHHEEEEEECCHHHHHHCCCCCCC
Q ss_conf             47999999999747990999146887757878857899986788754564100778023046434677884100048874
Q gi|254780652|r    2 MQDLENSVAMMLQAGKGILAADESNATIQKRFKAIHLESTENSRRDYREMLFRAKDAMQYISSILLYEETLYQNAQDGTS   81 (339)
Q Consensus         2 ~~eL~~~a~~~~~~gKGilAaDeS~gt~~Krl~~igventeenr~~~R~~l~tsp~~~~~IsGvILfeeTl~q~~~~g~~   81 (339)
                      -+||..||++|++|||||||||||+|||||||++|||||||||||+||+||||||+|++||||||||||||+|+++||++
T Consensus        42 ~~eL~~~a~~~~~~GKGiLAADES~gT~~Krl~~igventeenRr~yR~~Lftsp~~~~~IsGvILFEETl~q~~~dG~~  121 (391)
T 2qap_A           42 ESELIATVKKLTTPGKGLLAADESIGSCTKRFQPIGLSNTEEHRRQYRALMLEAEGFEQYISGVILHDETVGQKASNGQT  121 (391)
T ss_dssp             HHHHHHHHHHHTCTTCEEEEECCCTTTHHHHHGGGTCCCCHHHHHHHHHHHHTCTTGGGTEEEEEECHHHHTCBCTTSSB
T ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHCCCCCCHHHHHHHHHHHHCCCCHHHCEEEEECCHHHCCCCCCCCCC
T ss_conf             99999999998069986997158887277778865999979999999987617986454557898036640772789982


Q ss_pred             HHHHHHHCCCEEEEEECCCEEEC-CCCCCCCCCCCHHHHHHHHHHHHHCCCEEECCEECCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             67989957987899427854217-89998621578357999999854339555010002336778740888899899999
Q gi|254780652|r   82 FVDLISSSGVLVGIKVDRGLKPY-PLYPGEHITVGLDDLDVRLKQYKDAGARVAKWRVVLSVSDVLPSMTVVKANMHILA  160 (339)
Q Consensus        82 ~~~~l~~kGIvpgIKVDkGl~~l-~g~~~e~~t~GLD~L~eR~~~y~~~Ga~faKwRaVi~i~~~~Ps~~~I~~na~~la  160 (339)
                      |+++|+++||||||||||||+|+ +|+++|++|+|||+|++||++||++|||||||||||+|++++||+.||.+|+++||
T Consensus       122 ~~~ll~~kGIvPgIKVDkGl~p~~~G~~~ek~t~GLD~L~~R~~ey~~~Ga~faKwRsVi~i~~~~Ps~~~I~~na~~La  201 (391)
T 2qap_A          122 FPEYLTARGVVPGIKTDMGLCPLLEGAEGEQMTEGLDGYVKRASAYYKKGCRFCKWRNVYKIQNGTVSESAVRFNAETLA  201 (391)
T ss_dssp             HHHHHHHTTCEEEEECCCCEEECSSSSTTCEEECCCTTHHHHHHHHHHTTCCEEEEEEEECCBTTBCCHHHHHHHHHHHH
T ss_pred             HHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCHHHHHHHHHHHH
T ss_conf             48999868982579717764667689986713777788999999999769853222232124568997899999999999


Q ss_pred             HHHHHHHHCCCCCEECHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC-CCCHHHHHHH
Q ss_conf             999999844787201101103775798999999999999999998763853111000025565764443-5898899877
Q gi|254780652|r  161 RYAVLCQNAGLVPIVEPEVLMEGDHTIERCAEVTEFVLRTLFNELYTMRVCFEGLVLKSNMILPGKSAP-QVSDEEIASN  239 (339)
Q Consensus       161 rYA~i~Q~~GLVPIVEPEVl~dG~H~ie~~~~vte~vL~~lf~~L~~~~V~leg~lLKpnMv~pG~~~~-~~~~eevA~~  239 (339)
                      |||++||++||||||||||+|||+|++++|++||++||+++|++|.+|+|+|||+|||||||+||.+|+ ++++++||.+
T Consensus       202 ryA~i~Q~~GLVPIVEPEVlidg~h~ie~~~~vte~vL~~~~~~L~~~~V~leG~lLKpnMv~~G~~~~~~~~~~eva~~  281 (391)
T 2qap_A          202 RYAILSQMSGLVPIVEPEVMIDGKHDIDTCQRVSEHVWREVVAALQRHGVIWEGCLLKPNMVVPGAESGKTAAPEQVAHY  281 (391)
T ss_dssp             HHHHHHHHTTCEEEEEEEECCCSSCCHHHHHHHHHHHHHHHHHHHHHHTCCGGGCEECCCCCCCCTTSSCCCCHHHHHHH
T ss_pred             HHHHHHHHCCCCCCCCCEECCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             99999998299764450220366655788999999999999999985577655742011332477532223786777677


Q ss_pred             HHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCC-CCCCEEEEEHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             799985028743862586058888999999899986278-9980599851078637889881899889999999999999
Q gi|254780652|r  240 TIKIFKRVVPCAVQGIAFLSGGQSEQDATARLSAMNSMG-DCPWRLSFSYGRALQESVLRAWNGKQDNVVVAQRVLSHRA  318 (339)
Q Consensus       240 T~~~l~~~vP~~VpgIvFLSGGqs~eeAt~~LnaiNk~~-~~pW~lsfSygRALQ~~~Lk~W~G~~eN~~~aQ~~~~~Ra  318 (339)
                      |+.||++|||++||||||||||||++|||.|||+||+.. ..||.||||||||||+++|++|+||.+|+.+||++|++||
T Consensus       282 Tv~~l~~tVP~~VpgIvfLSGGqS~eeAt~~LnaiN~~~~~~pw~LsfSfgRALQ~s~lk~W~g~~~n~~~aQ~~~~~ra  361 (391)
T 2qap_A          282 TVMTLARTMPAMLPGVMFLSGGLSEVQASEYLNAINNSPLPRPYFLSFSYARALQSSALKAWGGKESGLAAGRRAFLHRA  361 (391)
T ss_dssp             HHHHHHHHSBTTCCEEEECCTTCCHHHHHHHHHHHTTCCSCCCSEEEEEESHHHHHHHHHHHTTSGGGHHHHHHHHHHHH
T ss_pred             HHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCEEEEEECHHHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             89998515787778688787987789999999998524678998589984276606899984887161899999999999


Q ss_pred             HHHHHHHCCCCCCCCCCCCC
Q ss_conf             74158978974867682125
Q gi|254780652|r  319 HMNSLATKGCWKKSLENSNG  338 (339)
Q Consensus       319 k~ns~A~~G~y~~~~e~~~~  338 (339)
                      ++||+|++|+|+.++|++++
T Consensus       362 k~ns~A~~G~y~~~~~~~~~  381 (391)
T 2qap_A          362 RMNSMAQLGKYKRSDDDASS  381 (391)
T ss_dssp             HHHHHHHTTCCCGGGCC---
T ss_pred             HHCCHHHCCCCCCCCCCCCC
T ss_conf             85219867774799986566



>3mmt_A Fructose-bisphosphate aldolase; ssgcid, structural genomics, seattle structural GE center for infectious disease, hydrolase; HET: 2FP; 2.35A {Bartonella henselae} Back     alignment and structure
>2pc4_A 41 kDa antigen, fructose-bisphosphate aldolase; invasion machinery, structural genomics, PSI, protein structure initiative; 2.40A {Plasmodium falciparum} PDB: 2eph_A 1a5c_A Back     alignment and structure
>3kx6_A Fructose-bisphosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, glycolysis, lyase, structural genomics; HET: CIT; 2.10A {Babesia bovis} Back     alignment and structure
>3bv4_A Fructose-bisphosphate aldolase A; lyase, acetylation, glycolysis, phosphoprotein, schiff base; HET: 13P; 1.70A {Oryctolagus cuniculus} PDB: 1ado_A* 1ewd_A 1zai_A* 1zah_A* 1zaj_A* 1zal_A 2ot0_A 2ot1_A* 2qut_A 2quv_A 3lge_A 3b8d_A 6ald_A* 1ex5_A 1ewe_A 2quu_A 3dfn_A 3dfo_A 3dfp_A 3dfq_A ... Back     alignment and structure
>3mbd_A Fructose-bisphosphate aldolase; glycolysis, lyase, schiff base, structural genomics; 2.00A {Encephalitozoon cuniculi} PDB: 3mbf_A* Back     alignment and structure
>2iqt_A Fructose-bisphosphate aldolase class 1; TIM berrel, structural genomics, PSI-2, protein structure initiative; 2.46A {Porphyromonas gingivalis W83} Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolase, D-tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 339 Fructose-bisphosphate aldolase [Candidatus Liberibacter
d1zaia1363 c.1.10.1 (A:1-363) Fructose-1,6-bisphosphate aldolase { 7e-96
d1a5ca_342 c.1.10.1 (A:) Fructose-1,6-bisphosphate aldolase {Plasm 2e-95
d2qapa1357 c.1.10.1 (A:1-357) Fructose-1,6-bisphosphate aldolase { 2e-94
d1qo5a_360 c.1.10.1 (A:) Fructose-1,6-bisphosphate aldolase {Human 4e-91
>d1zaia1 c.1.10.1 (A:1-363) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]} Length = 363 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: Class I aldolase
domain: Fructose-1,6-bisphosphate aldolase
species: Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]
 Score =  344 bits (883), Expect = 7e-96
 Identities = 156/339 (46%), Positives = 209/339 (61%), Gaps = 3/339 (0%)

Query: 1   MMQDLENSVAMMLQAGKGILAADESNATIQKRFKAIHLESTENSRRDYREMLFRAKDAM- 59
             ++L +    ++  GKGILAADES  +I KR ++I  E+TE +RR YR++L  A D + 
Sbjct: 11  QKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN 70

Query: 60  QYISSILLYEETLYQNAQDGTSFVDLISSSGVLVGIKVDRGLKPYPLYPGEHITVGLDDL 119
             I  ++L+ ETLYQ A DG  F  +I S G +VGIKVD+G+ P     GE  T GLD L
Sbjct: 71  PCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGL 130

Query: 120 DVRLKQYKDAGARVAKWRVVLSVSDVLPSMTVVKANMHILARYAVLCQNAGLVPIVEPEV 179
             R  QYK  GA  AKWR VL + +  PS   +  N ++LARYA +CQ  G+VPIVEPE+
Sbjct: 131 SERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEI 190

Query: 180 LMEGDHTIERCAEVTEFVLRTLFNELYTMRVCFEGLVLKSNMILPGKSAPQVSD-EEIAS 238
           L +GDH ++RC  VTE VL  ++  L    +  EG +LK NM+ PG +  Q    EEIA 
Sbjct: 191 LPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKYSHEEIAM 250

Query: 239 NTIKIFKRVVPCAVQGIAFLSGGQSEQDATARLSAMNSMGDC-PWRLSFSYGRALQESVL 297
            T+   +R VP AV G+ FLSGGQSE++A+  L+A+N      PW L+FSYGRALQ S L
Sbjct: 251 ATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASAL 310

Query: 298 RAWNGKQDNVVVAQRVLSHRAHMNSLATKGCWKKSLENS 336
           +AW GK++N+  AQ     RA  NSLA +G +  S +  
Sbjct: 311 KAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAG 349


>d1a5ca_ c.1.10.1 (A:) Fructose-1,6-bisphosphate aldolase {Plasmodium falciparum [TaxId: 5833]} Length = 342 Back     information, alignment and structure
>d2qapa1 c.1.10.1 (A:1-357) Fructose-1,6-bisphosphate aldolase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Length = 357 Back     information, alignment and structure
>d1qo5a_ c.1.10.1 (A:) Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens), liver isozyme [TaxId: 9606]} Length = 360 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target339 Fructose-bisphosphate aldolase [Candidatus Liberibacter
d1qo5a_360 Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens 100.0
d2qapa1357 Fructose-1,6-bisphosphate aldolase {Trypanosome (Leishm 100.0
d1zaia1363 Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus 100.0
d1a5ca_342 Fructose-1,6-bisphosphate aldolase {Plasmodium falcipar 100.0
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [TaxId: 97.09
>d1qo5a_ c.1.10.1 (A:) Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens), liver isozyme [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: Class I aldolase
domain: Fructose-1,6-bisphosphate aldolase
species: Human (Homo sapiens), liver isozyme [TaxId: 9606]
Probab=100.00  E-value=0  Score=1031.45  Aligned_cols=336  Identities=43%  Similarity=0.707  Sum_probs=329.2

Q ss_pred             HHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHCCCCCCHHHHHHHHHHHEEC-CCCHHEEEEEECCHHHHHHCCCCCC
Q ss_conf             479999999997479909991468877578788578999867887545641007-7802304643467788410004887
Q gi|254780652|r    2 MQDLENSVAMMLQAGKGILAADESNATIQKRFKAIHLESTENSRRDYREMLFRA-KDAMQYISSILLYEETLYQNAQDGT   80 (339)
Q Consensus         2 ~~eL~~~a~~~~~~gKGilAaDeS~gt~~Krl~~igventeenr~~~R~~l~ts-p~~~~~IsGvILfeeTl~q~~~~g~   80 (339)
                      .+||.+||++|+++||||||||||+|||||||+.|||||||||||+||+||||| |++++||||||||||||||+++||+
T Consensus        12 ~~eL~~~a~~~~~~GKGiLAaDeS~gT~~Krl~~igventeenr~~yR~~l~tt~~~~~~~IsGvILfeeTl~q~~~~g~   91 (360)
T d1qo5a_          12 KKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIGGVILFHETLYQKDSQGK   91 (360)
T ss_dssp             HHHHHHHHHHHSTTSCEEEEECCCHHHHHHHHHHTTCCCCHHHHHHHHHHHHTSCGGGGGTEEEEEECTTGGGCBCTTSC
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHCCCCCCHHHHHHHHHHHHCCCHHHHCCEEEEECCHHHHHHHCCCCC
T ss_conf             99999999998148987998268998377789876999977999999888851870343565689836999841423677


Q ss_pred             CHHHHHHHCCCEEEEEECCCEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEECCEECCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             46798995798789942785421789998621578357999999854339555010002336778740888899899999
Q gi|254780652|r   81 SFVDLISSSGVLVGIKVDRGLKPYPLYPGEHITVGLDDLDVRLKQYKDAGARVAKWRVVLSVSDVLPSMTVVKANMHILA  160 (339)
Q Consensus        81 ~~~~~l~~kGIvpgIKVDkGl~~l~g~~~e~~t~GLD~L~eR~~~y~~~Ga~faKwRaVi~i~~~~Ps~~~I~~na~~la  160 (339)
                      +|+++|+++|||||||||||++|+++.++|++|+|||||++||++||++|||||||||||+|++++||+.+|.+|+++||
T Consensus        92 ~~~~ll~~kGIvPgIKVDkGl~~l~~~~ge~~t~gLdgL~~Rl~~y~~~Ga~faKwRaVi~i~~~~ps~~~I~~na~~la  171 (360)
T d1qo5a_          92 LFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALA  171 (360)
T ss_dssp             BHHHHHHHTTCEEEEECCCCEEECTTSSSCEEECCCTTHHHHHHHHHHTTCCEEEEEEEECCBTTBSCHHHHHHHHHHHH
T ss_pred             CHHHHHHHCCCEEEEECCCCEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHH
T ss_conf             46689986596357834875000766776533566201889999998647444521220024557774588999999999


Q ss_pred             HHHHHHHHCCCCCEECHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC-CCCHHHHHHH
Q ss_conf             999999844787201101103775798999999999999999998763853111000025565764443-5898899877
Q gi|254780652|r  161 RYAVLCQNAGLVPIVEPEVLMEGDHTIERCAEVTEFVLRTLFNELYTMRVCFEGLVLKSNMILPGKSAP-QVSDEEIASN  239 (339)
Q Consensus       161 rYA~i~Q~~GLVPIVEPEVl~dG~H~ie~~~~vte~vL~~lf~~L~~~~V~leg~lLKpnMv~pG~~~~-~~~~eevA~~  239 (339)
                      |||++||++||||||||||+|||+|++++|++||++||+.||++|.+|+|+|||+|||||||+||.+|+ ++++++||++
T Consensus       172 ryA~i~q~~GLVPIVEPEVlidg~h~~e~~~~vt~~vl~~l~~~l~~~~V~LeG~lLKpnMv~pG~~~~~~~~~~~va~~  251 (360)
T d1qo5a_         172 RYASICQQNGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHACTKKYTPEQVAMA  251 (360)
T ss_dssp             HHHHHHHTTTCEEEEEEEECCCSSCCHHHHHHHHHHHHHHHHHHHHHTTCCGGGCEECCBCCCCCTTCCCCCCHHHHHHH
T ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             99999997197643143324578874688999999999999988765213467874200102551105555787888899


Q ss_pred             HHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCC-CCCCEEEEEHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             799985028743862586058888999999899986278-9980599851078637889881899889999999999999
Q gi|254780652|r  240 TIKIFKRVVPCAVQGIAFLSGGQSEQDATARLSAMNSMG-DCPWRLSFSYGRALQESVLRAWNGKQDNVVVAQRVLSHRA  318 (339)
Q Consensus       240 T~~~l~~~vP~~VpgIvFLSGGqs~eeAt~~LnaiNk~~-~~pW~lsfSygRALQ~~~Lk~W~G~~eN~~~aQ~~~~~Ra  318 (339)
                      |++||+++||++||||||||||||++|||.|||+||+++ +.||.||||||||||+|+|++|+||.+|+++||++|++||
T Consensus       252 Tv~~l~~~vp~~VpgIvfLSGGqS~eeAt~~LnamN~~~~~~pW~lsfSygRALQ~s~Lk~W~g~~~n~~~aQ~~~~~ra  331 (360)
T d1qo5a_         252 TVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRA  331 (360)
T ss_dssp             HHHHHHHHSCTTCCEEEEBCTTCCHHHHHHHHHHHHHCSSCCCSEEEEEESGGGTHHHHHHHTTCGGGHHHHHHHHHHHH
T ss_pred             HHHHHHHCCCCCCCCEECCCCCCCHHHHHHHHHHHHCCCCCCCCEEEEECCHHHHHHHHHHHCCCCHHHHHHHHHHHHHH
T ss_conf             88776430366787100168874488899999998615789997689964375618999985788142899999999999


Q ss_pred             HHHHHHHCCCCCCCCCCCC
Q ss_conf             7415897897486768212
Q gi|254780652|r  319 HMNSLATKGCWKKSLENSN  337 (339)
Q Consensus       319 k~ns~A~~G~y~~~~e~~~  337 (339)
                      ++||+|++|+|+++++...
T Consensus       332 ~~Ns~A~~G~y~~~~~~~~  350 (360)
T d1qo5a_         332 MANCQAAKGQYVHTGSSGA  350 (360)
T ss_dssp             HHHHHHTTTCCCCCSCCCH
T ss_pred             HHHHHHHCCCCCCCCCCCC
T ss_conf             8606875674078888786



>d2qapa1 c.1.10.1 (A:1-357) Fructose-1,6-bisphosphate aldolase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1zaia1 c.1.10.1 (A:1-363) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]} Back     information, alignment and structure
>d1a5ca_ c.1.10.1 (A:) Fructose-1,6-bisphosphate aldolase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 339 Fructose-bisphosphate aldolase [Candidatus Liberib
3bv4_A_341 (A:) Fructose-bisphosphate aldolase A; lyase, acet 1e-104
2qap_A_391 (A:) Fructose-1,6-bisphosphate aldolase; beta barr 1e-102
2pc4_A_369 (A:) 41 kDa antigen, fructose-bisphosphate aldolas 1e-101
3kx6_A_379 (A:) Fructose-bisphosphate aldolase; ssgcid, NIH, 1e-100
2iqt_A_296 (A:) Fructose-bisphosphate aldolase class 1; TIM b 1e-76
3iv3_A_332 (A:) Tagatose 1,6-diphosphate aldolase 2; TIM barr 1e-48
>3bv4_A (A:) Fructose-bisphosphate aldolase A; lyase, acetylation, glycolysis, phosphoprotein, schiff base; HET: 13P; 1.70A {Oryctolagus cuniculus} PDB: 1ado_A* 1ewd_A 1zai_A* 1zah_A* 1zaj_A* 1zal_A 2ot0_A 2ot1_A* 2qut_A 2quv_A 3lge_A 3b8d_A 6ald_A* 1ex5_A 1ewe_A 2quu_A 3dfn_A 3dfo_A 3dfp_A 3dfq_A ...Length = 341 Back     alignment and structure
 Score =  371 bits (953), Expect = e-104
 Identities = 154/330 (46%), Positives = 207/330 (62%), Gaps = 3/330 (0%)

Query: 3   QDLENSVAMMLQAGKGILAADESNATIQKRFKAIHLESTENSRRDYREMLFRAKDAM-QY 61
           ++L +    ++  GKGILAADES  +I KR ++I  E+TE +RR YR++L  A D +   
Sbjct: 10  KELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPC 69

Query: 62  ISSILLYEETLYQNAQDGTSFVDLISSSGVLVGIKVDRGLKPYPLYPGEHITVGLDDLDV 121
           I  ++L+ ETLYQ A DG  F  +I S G +VGIKVD+G+ P     GE  T GL  L  
Sbjct: 70  IGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLVGLSE 129

Query: 122 RLKQYKDAGARVAKWRVVLSVSDVLPSMTVVKANMHILARYAVLCQNAGLVPIVEPEVLM 181
           R  QYK  GA  AKWR VL + +  PS   +  N ++LARYA +CQ  G+VPIVEPE+L 
Sbjct: 130 RCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILP 189

Query: 182 EGDHTIERCAEVTEFVLRTLFNELYTMRVCFEGLVLKSNMILPGKSAP-QVSDEEIASNT 240
           +GDH ++RC  VTE VL  ++  L    +  EG +LK NM+ PG +   + S EEIA  T
Sbjct: 190 DGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKYSHEEIAMAT 249

Query: 241 IKIFKRVVPCAVQGIAFLSGGQSEQDATARLSAMNSMG-DCPWRLSFSYGRALQESVLRA 299
           +   +R VP AV G+ FLSGGQSE++A+  L+A+N      PW L+FSYGRALQ S L+A
Sbjct: 250 VTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKA 309

Query: 300 WNGKQDNVVVAQRVLSHRAHMNSLATKGCW 329
           W GK++N+  AQ     RA  NSLA +G +
Sbjct: 310 WGGKKENLKAAQEEYVKRALANSLACQGKY 339


>2qap_A (A:) Fructose-1,6-bisphosphate aldolase; beta barrel, C-teminal tail, lyase; 1.59A {Leishmania mexicana}Length = 391 Back     alignment and structure
>2pc4_A (A:) 41 kDa antigen, fructose-bisphosphate aldolase; invasion machinery, structural genomics, PSI, protein structure initiative; 2.40A {Plasmodium falciparum} PDB: 2eph_A 1a5c_ALength = 369 Back     alignment and structure
>3kx6_A (A:) Fructose-bisphosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, glycolysis, lyase, structural genomics; HET: CIT; 2.10A {Babesia bovis}Length = 379 Back     alignment and structure
>2iqt_A (A:) Fructose-bisphosphate aldolase class 1; TIM berrel, structural genomics, PSI-2, protein structure initiative; 2.46A {Porphyromonas gingivalis W83}Length = 296 Back     alignment and structure
>3iv3_A (A:) Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolase, D-tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3jrk_ALength = 332 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target339 Fructose-bisphosphate aldolase [Candidatus Liberibacter
2qap_A_391 Fructose-1,6-bisphosphate aldolase; beta barrel, C 100.0
2pc4_A_369 41 kDa antigen, fructose-bisphosphate aldolase; in 100.0
3kx6_A_379 Fructose-bisphosphate aldolase; ssgcid, NIH, niaid 100.0
3bv4_A_341 Fructose-bisphosphate aldolase A; lyase, acetylati 100.0
2iqt_A_296 Fructose-bisphosphate aldolase class 1; TIM berrel 100.0
3iv3_A_332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 100.0
1to3_A_304 Putative aldolase YIHT; beta-alpha barrel, structu 90.61
>2qap_A (A:) Fructose-1,6-bisphosphate aldolase; beta barrel, C-teminal tail, lyase; 1.59A {Leishmania mexicana} Back     alignment and structure
Probab=100.00  E-value=0  Score=1021.58  Aligned_cols=338  Identities=41%  Similarity=0.671  Sum_probs=332.5

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHCCCCCCHHHHHHHHHHHEECCCCHHEEEEEECCHHHHHHCCCCCC
Q ss_conf             94799999999974799099914688775787885789998678875456410077802304643467788410004887
Q gi|254780652|r    1 MMQDLENSVAMMLQAGKGILAADESNATIQKRFKAIHLESTENSRRDYREMLFRAKDAMQYISSILLYEETLYQNAQDGT   80 (339)
Q Consensus         1 m~~eL~~~a~~~~~~gKGilAaDeS~gt~~Krl~~igventeenr~~~R~~l~tsp~~~~~IsGvILfeeTl~q~~~~g~   80 (339)
                      +.+||.+||++|+++||||||||||+|||||||++|||||||||||+||+||||||+|++||||||||||||||++++|+
T Consensus        41 ~~~eL~~~a~~i~~~GkGIlAaDES~gT~~Krl~~iGventeenrr~~R~ll~tsp~~~~~IsGaILFeeTl~q~~~~g~  120 (391)
T 2qap_A           41 YESELIATVKKLTTPGKGLLAADESIGSCTKRFQPIGLSNTEEHRRQYRALMLEAEGFEQYISGVILHDETVGQKASNGQ  120 (391)
T ss_dssp             THHHHHHHHHHHTCTTCEEEEECCCTTTHHHHHGGGTCCCCHHHHHHHHHHHHTCTTGGGTEEEEEECHHHHTCBCTTSS
T ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHCCCCCCHHHHHHHHHHHHCCCCHHHCEEEEECCHHHCCCCCCCCC
T ss_conf             89999999999816998698715889827777886599997999999999873797655554689813554077157998


Q ss_pred             CHHHHHHHCCCEEEEEECCCEEECC-CCCCCCCCCCHHHHHHHHHHHHHCCCEEECCEECCCCCCCCCHHHHHHHHHHHH
Q ss_conf             4679899579878994278542178-999862157835799999985433955501000233677874088889989999
Q gi|254780652|r   81 SFVDLISSSGVLVGIKVDRGLKPYP-LYPGEHITVGLDDLDVRLKQYKDAGARVAKWRVVLSVSDVLPSMTVVKANMHIL  159 (339)
Q Consensus        81 ~~~~~l~~kGIvpgIKVDkGl~~l~-g~~~e~~t~GLD~L~eR~~~y~~~Ga~faKwRaVi~i~~~~Ps~~~I~~na~~l  159 (339)
                      +|+++|+++|||||||||||++|++ |+++|++|+|||||++||++||+.|||||||||||+|+++.||+++|.+|+++|
T Consensus       121 ~~~~ll~~kGIvPgIKVDkGl~~l~~G~~~e~~t~GLD~L~~R~~~y~~~Ga~faKwRsVi~i~~~~ps~~~I~~na~~l  200 (391)
T 2qap_A          121 TFPEYLTARGVVPGIKTDMGLCPLLEGAEGEQMTEGLDGYVKRASAYYKKGCRFCKWRNVYKIQNGTVSESAVRFNAETL  200 (391)
T ss_dssp             BHHHHHHHTTCEEEEECCCCEEECSSSSTTCEEECCCTTHHHHHHHHHHTTCCEEEEEEEECCBTTBCCHHHHHHHHHHH
T ss_pred             CHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHCCCCCCCCHHHHHHHHHHHH
T ss_conf             55899984666254543765146778997352056635799999988742332130234213677774167777667999


Q ss_pred             HHHHHHHHHCCCCCEECHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC-CCCHHHHHH
Q ss_conf             9999999844787201101103775798999999999999999998763853111000025565764443-589889987
Q gi|254780652|r  160 ARYAVLCQNAGLVPIVEPEVLMEGDHTIERCAEVTEFVLRTLFNELYTMRVCFEGLVLKSNMILPGKSAP-QVSDEEIAS  238 (339)
Q Consensus       160 arYA~i~Q~~GLVPIVEPEVl~dG~H~ie~~~~vte~vL~~lf~~L~~~~V~leg~lLKpnMv~pG~~~~-~~~~eevA~  238 (339)
                      ||||+|||++||||||||||+|||+|++++|+.||++||++||++|.+|+|+|||+|||||||+||.+|+ +++|++||.
T Consensus       201 aryA~icq~~GLVPIVEPEVlidg~h~~e~~~~vte~vl~~v~~~l~~~~V~LEg~lLKpnMv~pG~~~~k~~~peeva~  280 (391)
T 2qap_A          201 ARYAILSQMSGLVPIVEPEVMIDGKHDIDTCQRVSEHVWREVVAALQRHGVIWEGCLLKPNMVVPGAESGKTAAPEQVAH  280 (391)
T ss_dssp             HHHHHHHHHTTCEEEEEEEECCCSSCCHHHHHHHHHHHHHHHHHHHHHHTCCGGGCEECCCCCCCCTTSSCCCCHHHHHH
T ss_pred             HHHHHHHHHCCCCCCCCHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             99999999739774235223314667526889999999999998886401434477453245567742122389666223


Q ss_pred             HHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCC-CCCCEEEEEHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             7799985028743862586058888999999899986278-998059985107863788988189988999999999999
Q gi|254780652|r  239 NTIKIFKRVVPCAVQGIAFLSGGQSEQDATARLSAMNSMG-DCPWRLSFSYGRALQESVLRAWNGKQDNVVVAQRVLSHR  317 (339)
Q Consensus       239 ~T~~~l~~~vP~~VpgIvFLSGGqs~eeAt~~LnaiNk~~-~~pW~lsfSygRALQ~~~Lk~W~G~~eN~~~aQ~~~~~R  317 (339)
                      ||+++++|||||+||||||||||||++|||.||||||++. +.||.||||||||||+++|++|+|++||++++|++|++|
T Consensus       281 ~t~~~l~r~VPpaVpgVvfLSGGqS~eeAt~~LnaiN~~~~~~pw~LsfSfgRALq~s~Lk~w~g~~en~~aaq~al~~r  360 (391)
T 2qap_A          281 YTVMTLARTMPAMLPGVMFLSGGLSEVQASEYLNAINNSPLPRPYFLSFSYARALQSSALKAWGGKESGLAAGRRAFLHR  360 (391)
T ss_dssp             HHHHHHHHHSBTTCCEEEECCTTCCHHHHHHHHHHHTTCCSCCCSEEEEEESHHHHHHHHHHHTTSGGGHHHHHHHHHHH
T ss_pred             HHHHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCEEEEEECHHHHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             44443314678667722314687538999999999852357899858998217660679988489716399999999999


Q ss_pred             HHHHHHHHCCCCCCCCCCCCC
Q ss_conf             974158978974867682125
Q gi|254780652|r  318 AHMNSLATKGCWKKSLENSNG  338 (339)
Q Consensus       318 ak~ns~A~~G~y~~~~e~~~~  338 (339)
                      +++|++|++|+|.+++|.+++
T Consensus       361 a~an~~A~~Gky~~~~~~~~~  381 (391)
T 2qap_A          361 ARMNSMAQLGKYKRSDDDASS  381 (391)
T ss_dssp             HHHHHHHHTTCCCGGGCC---
T ss_pred             HHHHHHHHCCCCCCCCCCCCC
T ss_conf             986069867745799986556



>2pc4_A (A:) 41 kDa antigen, fructose-bisphosphate aldolase; invasion machinery, structural genomics, PSI, protein structure initiative; 2.40A {Plasmodium falciparum} PDB: 2eph_A 1a5c_A Back     alignment and structure
>3kx6_A (A:) Fructose-bisphosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, glycolysis, lyase, structural genomics; HET: CIT; 2.10A {Babesia bovis} Back     alignment and structure
>3bv4_A (A:) Fructose-bisphosphate aldolase A; lyase, acetylation, glycolysis, phosphoprotein, schiff base; HET: 13P; 1.70A {Oryctolagus cuniculus} PDB: 1ado_A* 1ewd_A 1zai_A* 1zah_A* 1zaj_A* 1zal_A 2ot0_A 2ot1_A* 2qut_A 2quv_A 3lge_A 3b8d_A 6ald_A* 1ex5_A 1ewe_A 2quu_A 3dfn_A 3dfo_A 3dfp_A 3dfq_A ... Back     alignment and structure
>2iqt_A (A:) Fructose-bisphosphate aldolase class 1; TIM berrel, structural genomics, PSI-2, protein structure initiative; 2.46A {Porphyromonas gingivalis W83} Back     alignment and structure
>3iv3_A (A:) Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolase, D-tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3jrk_A Back     alignment and structure
>1to3_A (A:) Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} Back     alignment and structure