254780653

254780653

phosphoglycerate kinase

GeneID in NCBI database:8209656Locus tag:CLIBASIA_02700
Protein GI in NCBI database:254780653Protein Accession:YP_003065066.1
Gene range:+(618649, 619851)Protein Length:400aa
Gene description:phosphoglycerate kinase
COG prediction:[G] 3-phosphoglycerate kinase
KEGG prediction:pgk; phosphoglycerate kinase (EC:2.7.2.3); K00927 phosphoglycerate kinase [EC:2.7.2.3]
SEED prediction:Phosphoglycerate kinase (EC 2.7.2.3)
Pathway involved in KEGG:Glycolysis / Gluconeogenesis [PATH:las00010]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400
MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGHC
ccccccHHHHccccccEEEEEEEccccccccEEccHHHHHHHHHHHHHHHHccccEEEEcccccccccccHHHcHHHHHHHHHHHccccEEEccccccHHHHHHHHHcccccEEEEEEEccccccccccHHHHHHHHHcccEEEEcHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHHcEEEEcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccEEEccccEEEccccccccccEEEEHHccccccEEEEccHHHHHHHHHHHHHccEEEEccccccEEcccHHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHccccccccEEEccHHHHHHHHcccccHHHHHHHHcc
ccccccHHHHHcccccEEEEEccccccEEccEEcccHHHHHHHHHHHHHHHcccEEEEEcccccccccccHHHccHHHHHHHHHHHccccEEccccccHHHHHHHHccccccEEEcccHHHcHHHHHccHHHHHHHHccccEEEEccHHHcccccccccHHHHcccEEEcHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHcccccEEEEcccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccEEEcccEEEEEccccccccEEEEEHHHcccccEEEEEcHHHHHHHHHHHHcccEEEEEccccccccHHHcHHHHHHHHHHHHHHHHHccEEEEccHHHHHHHHHccccccccEEcccHHHHHHHHcccccHHHHcccccc
MSRLRTMNDLRDIRGLRCllrvdwnvpfidgkvadvtrIERVVPTILELVEKKAKVVIFshlgrpqsksdkdcslfKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIilaenvrfyseeerndpdFVRMLSrngdfyindafsvshrahaSITGLSHLLPSYIGRAMQKELSMLEscfseskkplvaivggskvsTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGvgrslcqrdfsdNVHQIAWEAKRSACEIIVPRDVVVAREmktgiptqvvsaqsvpldsiildVGFKTVEYIKQVIAQARTVmwngplgvfeiepfdrATVEVAHYVAKLTKERRIISIAGGGDTITALAHAgisneftyvstaggaflewlegkdlpgivalsghc
msrlrtmndlrdirglrcllrvdwnvpfidgkvadvtriERVVPTILELVEKKAKVVIfshlgrpqsksdkdcSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAWEakrsaceiiVPRDVVVAREMKTGiptqvvsaqsvplDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGHC
MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGHC
***LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGHC
MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGHC
***LRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSG*C
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGHC
MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGHC
MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGHC

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target400 phosphoglycerate kinase [Candidatus Liberibacter asiati
315122161421 phosphoglycerate kinase [Candidatus Liberibacter solana 1 0.0
110635765398 phosphoglycerate kinase [Mesorhizobium sp. BNC1] Length 1 1e-130
209550817400 phosphoglycerate kinase [Rhizobium leguminosarum bv. tr 1 1e-129
332716470400 phosphoglycerate kinase [Agrobacterium sp. H13-3] Lengt 1 1e-127
222087013415 phosphoglycerate kinase protein [Agrobacterium radiobac 1 1e-127
159185882400 phosphoglycerate kinase [Agrobacterium tumefaciens str. 1 1e-127
222149683400 phosphoglycerate kinase [Agrobacterium vitis S4] Length 1 1e-127
86359090418 phosphoglycerate kinase [Rhizobium etli CFN 42] Length 1 1e-126
241206227400 phosphoglycerate kinase [Rhizobium leguminosarum bv. tr 1 1e-124
116253750401 phosphoglycerate kinase [Rhizobium leguminosarum bv. vi 1 1e-124
>gi|315122161|ref|YP_004062650.1| phosphoglycerate kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 421 Back     alignment and organism information
 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/397 (80%), Positives = 356/397 (89%)

Query: 1   MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFS 60
           MS LRTM+DL DIRG RCLLRVDWNVPFI+GK+ADVTRIER VPTILELV KKAK+VI S
Sbjct: 1   MSYLRTMDDLNDIRGRRCLLRVDWNVPFIEGKIADVTRIERSVPTILELVRKKAKIVILS 60

Query: 61  HLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVR 120
           HLGRP +KSDKD SL +V+ IAESIL K ILFV DCIG +LSQS++SLSEGGIIL ENVR
Sbjct: 61  HLGRPNNKSDKDSSLCQVIPIAESILKKKILFVEDCIGFSLSQSVSSLSEGGIILTENVR 120

Query: 121 FYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSML 180
           FY  EE NDPDFV ML+ NGDFYINDAFSVSHR HASI GLS LLPSY+GRAMQKELSML
Sbjct: 121 FYPGEENNDPDFVNMLAENGDFYINDAFSVSHRVHASIEGLSRLLPSYMGRAMQKELSML 180

Query: 181 ESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLC 240
           E CFS SKKPLVAI+GGSKVSTKI LL NLVKKVDKLVIGGGMANSFLVA GMGVGRSLC
Sbjct: 181 EVCFSVSKKPLVAIIGGSKVSTKIDLLGNLVKKVDKLVIGGGMANSFLVADGMGVGRSLC 240

Query: 241 QRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFK 300
           QRDFS++V QI +EA++S+CEII+P+DVVVA+EMK GI TQ VS +SVP DS+ILD+GFK
Sbjct: 241 QRDFSESVRQIVFEAQKSSCEIILPQDVVVAKEMKKGIATQSVSTRSVPSDSMILDIGFK 300

Query: 301 TVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTIT 360
           T+EYIKQVI+QA+TV+WNGPLGVFEIEPFD ATVE+A YVAKLTKE++IISIAGGGDTIT
Sbjct: 301 TIEYIKQVISQAKTVIWNGPLGVFEIEPFDLATVEIARYVAKLTKEKKIISIAGGGDTIT 360

Query: 361 ALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
           AL+HAGI +EFTY STAGGAF EWLEGKDLPG+ ALS
Sbjct: 361 ALSHAGIVDEFTYASTAGGAFFEWLEGKDLPGLAALS 397


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|110635765|ref|YP_675973.1| phosphoglycerate kinase [Mesorhizobium sp. BNC1] Length = 398 Back     alignment and organism information
>gi|209550817|ref|YP_002282734.1| phosphoglycerate kinase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 400 Back     alignment and organism information
>gi|332716470|ref|YP_004443936.1| phosphoglycerate kinase [Agrobacterium sp. H13-3] Length = 400 Back     alignment and organism information
>gi|222087013|ref|YP_002545547.1| phosphoglycerate kinase protein [Agrobacterium radiobacter K84] Length = 415 Back     alignment and organism information
>gi|159185882|ref|NP_356882.2| phosphoglycerate kinase [Agrobacterium tumefaciens str. C58] Length = 400 Back     alignment and organism information
>gi|222149683|ref|YP_002550640.1| phosphoglycerate kinase [Agrobacterium vitis S4] Length = 400 Back     alignment and organism information
>gi|86359090|ref|YP_470982.1| phosphoglycerate kinase [Rhizobium etli CFN 42] Length = 418 Back     alignment and organism information
>gi|241206227|ref|YP_002977323.1| phosphoglycerate kinase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 400 Back     alignment and organism information
>gi|116253750|ref|YP_769588.1| phosphoglycerate kinase [Rhizobium leguminosarum bv. viciae 3841] Length = 401 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target400 phosphoglycerate kinase [Candidatus Liberibacter asiati
PRK00073389 PRK00073, pgk, phosphoglycerate kinase; Provisional 1e-148
COG0126395 COG0126, Pgk, 3-phosphoglycerate kinase [Carbohydrate t 1e-123
cd00318397 cd00318, Phosphoglycerate_kinase, Phosphoglycerate kina 1e-118
PRK13962 645 PRK13962, PRK13962, bifunctional phosphoglycerate kinas 1e-108
PTZ00005417 PTZ00005, PTZ00005, phosphoglycerate kinase; Provisiona 6e-92
KOG1367416 KOG1367, KOG1367, KOG1367, 3-phosphoglycerate kinase [C 8e-92
PLN02282401 PLN02282, PLN02282, phosphoglycerate kinase 4e-89
PLN03034481 PLN03034, PLN03034, phosphoglycerate kinase; Provisiona 9e-87
pfam00162383 pfam00162, PGK, Phosphoglycerate kinase 1e-140
>gnl|CDD|178841 PRK00073, pgk, phosphoglycerate kinase; Provisional Back     alignment and domain information
>gnl|CDD|30475 COG0126, Pgk, 3-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|29400 cd00318, Phosphoglycerate_kinase, Phosphoglycerate kinase (PGK) is a monomeric enzyme which catalyzes the transfer of the high-energy phosphate group of 1,3-bisphosphoglycerate to ADP, forming ATP and 3-phosphoglycerate Back     alignment and domain information
>gnl|CDD|184422 PRK13962, PRK13962, bifunctional phosphoglycerate kinase/triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|173310 PTZ00005, PTZ00005, phosphoglycerate kinase; Provisional Back     alignment and domain information
>gnl|CDD|36581 KOG1367, KOG1367, KOG1367, 3-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|165923 PLN02282, PLN02282, phosphoglycerate kinase Back     alignment and domain information
>gnl|CDD|178602 PLN03034, PLN03034, phosphoglycerate kinase; Provisional Back     alignment and domain information
>gnl|CDD|143930 pfam00162, PGK, Phosphoglycerate kinase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 400 phosphoglycerate kinase [Candidatus Liberibacter asiati
PRK13962 653 bifunctional phosphoglycerate kinase/triosephosphate is 100.0
PRK00073391 pgk phosphoglycerate kinase; Provisional 100.0
cd00318397 Phosphoglycerate_kinase Phosphoglycerate kinase (PGK) i 100.0
PTZ00005419 phosphoglycerate kinase; Provisional 100.0
COG0126395 Pgk 3-phosphoglycerate kinase [Carbohydrate transport a 100.0
pfam00162383 PGK Phosphoglycerate kinase. 100.0
KOG1367416 consensus 100.0
PRK09206470 pyruvate kinase; Provisional 95.86
PRK05826461 pyruvate kinase; Provisional 93.44
>PRK13962 bifunctional phosphoglycerate kinase/triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK00073 pgk phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd00318 Phosphoglycerate_kinase Phosphoglycerate kinase (PGK) is a monomeric enzyme which catalyzes the transfer of the high-energy phosphate group of 1,3-bisphosphoglycerate to ADP, forming ATP and 3-phosphoglycerate Back     alignment and domain information
>PTZ00005 phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG0126 Pgk 3-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>pfam00162 PGK Phosphoglycerate kinase Back     alignment and domain information
>KOG1367 consensus Back     alignment and domain information
>PRK09206 pyruvate kinase; Provisional Back     alignment and domain information
>PRK05826 pyruvate kinase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target400 phosphoglycerate kinase [Candidatus Liberibacter asiati
1vpe_A398 Crystallographic Analysis Of Phosphoglycerate Kinas 1e-106
1php_A394 Structure Of The Adp Complex Of The 3-Phosphoglycer 1e-102
1v6s_A390 Crystal Structure Of Phosphoglycerate Kinase From T 1e-91
2p9q_A416 Crystal Structure Of Phosphoglycerate Kinase-2 Leng 2e-90
2ie8_A390 Crystal Structure Of Thermus Caldophilus Phosphogly 5e-90
2y3i_A416 The Structure Of The Fully Closed Conformation Of H 6e-90
1zmr_A387 Crystal Structure Of The E. Coli Phosphoglycerate K 9e-90
2wzb_A416 The Catalytically Active Fully Closed Conformation 6e-89
2x14_A416 The Catalytically Active Fully Closed Conformation 7e-89
13pk_A415 Ternary Complex Of Phosphoglycerate Kinase From Try 8e-89
2xe6_A417 The Complete Reaction Cycle Of Human Phosphoglycera 9e-89
2wzd_A417 The Catalytically Active Fully Closed Conformation 1e-88
2zgv_A420 Crystal Structure Of Human Phosphoglycerate Kinase 1e-88
1vjc_A416 Structure Of Pig Muscle Pgk Complexed With Mgatp Le 2e-88
1kf0_A416 Crystal Structure Of Pig Muscle Phosphoglycerate Ki 3e-88
3pgk_A416 The Structure Of Yeast Phosphoglycerate Kinase At 0 1e-87
1qpg_A415 3-Phosphoglycerate Kinase, Mutation R65q Length = 4 4e-87
1ltk_A425 Crystal Structure Of Phosphoglycerate Kinase From P 5e-86
1hdi_A413 Pig Muscle 3-Phosphoglycerate Kinase Complexed With 7e-84
3q3v_A403 Crystal Structure Of Phosphoglycerate Kinase From C 1e-83
2cun_A410 Crystal Structure Of Phosphoglycerate Kinase From P 1e-70
1fw8_A415 Circularly Permuted Phosphoglycerate Kinase From Ye 3e-55
1fw8_A415 Circularly Permuted Phosphoglycerate Kinase From Ye 3e-23
>gi|157834149|pdb|1VPE|A Chain A, Crystallographic Analysis Of Phosphoglycerate Kinase From The Hyperthermophilic Bacterium Thermotoga Maritima Length = 398 Back     alignment and structure
 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 160/390 (41%), Positives = 247/390 (63%), Gaps = 3/390 (0%)

Query: 6   TMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRP 65
           T+ D+ D++G R ++RVD+NVP  DG V D TRI   +PTI   +E+ AKV++ SHLGRP
Sbjct: 4   TIRDV-DLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRP 62

Query: 66  QSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEE 125
           + +   + SL  V      +L K + FV   +G  + +++  L EG ++L EN RF+  E
Sbjct: 63  KGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGE 122

Query: 126 ERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCFS 185
            +NDP+  +  +   D ++NDAF  +HRAHAS  G++  +PS  G  M+KE+  L     
Sbjct: 123 TKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSKVTY 182

Query: 186 ESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFS 245
             +KP V ++GG+KVS KI ++ NL++K D+++IGG M  +FL A G  VG S  + D  
Sbjct: 183 NPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDKI 242

Query: 246 DNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQS-VPLDSIILDVGFKTVEY 304
           D   ++  +AK    EI++P D V+A++++ G+  +VV     +P   + LD+G +T+E 
Sbjct: 243 DLAKELVEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETIEL 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            KQ ++ A+TV+WNGP+GVFEI+ F   T +VA  +A LT E+  I++ GGGD+  A+  
Sbjct: 303 FKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALT-EKGAITVVGGGDSAAAVNK 361

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIV 394
            G+ ++F++VST GGA LE+LEGK+LPGI 
Sbjct: 362 FGLEDKFSHVSTGGGASLEFLEGKELPGIA 391


gi|157833493|pdb|1PHP|A Chain A, Structure Of The Adp Complex Of The 3-Phosphoglycerate Kinase From Bacillus Stearothermophilus At 1.65 Angstroms Length = 394 Back     alignment and structure
gi|40889881|pdb|1V6S|A Chain A, Crystal Structure Of Phosphoglycerate Kinase From Thermus Thermophilus Hb8 Length = 390 Back     alignment and structure
>gi|161172175|pdb|2P9Q|A Chain A, Crystal Structure Of Phosphoglycerate Kinase-2 Length = 416 Back     alignment and structure
>gi|119390124|pdb|2IE8|A Chain A, Crystal Structure Of Thermus Caldophilus Phosphoglycerate Kinase In The Open Conformation Length = 390 Back     alignment and structure
>gi|330689316|pdb|2Y3I|A Chain A, The Structure Of The Fully Closed Conformation Of Human Pgk In Complex With L-Adp, 3pg And The Tsa Aluminium Tetrafluoride Length = 416 Back     alignment and structure
gi|99031714|pdb|1ZMR|A Chain A, Crystal Structure Of The E. Coli Phosphoglycerate Kinase Length = 387 Back     alignment and structure
>gi|294662288|pdb|2WZB|A Chain A, The Catalytically Active Fully Closed Conformation Of Human Phosphoglycerate Kinase In Complex With Adp, 3pg And Magnesium Trifluoride Length = 416 Back     alignment and structure
>gi|315583375|pdb|2X14|A Chain A, The Catalytically Active Fully Closed Conformation Of Human Phosphoglycerate Kinase K219a Mutant In Complex With Amp-Pcp And 3pg Length = 416 Back     alignment and structure
>gi|2781023|pdb|13PK|A Chain A, Ternary Complex Of Phosphoglycerate Kinase From Trypanosoma Brucei Length = 415 Back     alignment and structure
gi|319443304|pdb|2XE6|A Chain A, The Complete Reaction Cycle Of Human Phosphoglycerate Kinase: The Open Binary Complex With 3pg Length = 417 Back     alignment and structure
>gi|294662290|pdb|2WZD|A Chain A, The Catalytically Active Fully Closed Conformation Of Human Phosphoglycerate Kinase K219a Mutant In Complex With Adp, 3pg And Aluminium Trifluoride Length = 417 Back     alignment and structure
>gi|193506632|pdb|2ZGV|A Chain A, Crystal Structure Of Human Phosphoglycerate Kinase Bound To D-Adp Length = 420 Back     alignment and structure
>gi|47169448|pdb|1VJC|A Chain A, Structure Of Pig Muscle Pgk Complexed With Mgatp Length = 416 Back     alignment and structure
>gi|22219037|pdb|1KF0|A Chain A, Crystal Structure Of Pig Muscle Phosphoglycerate Kinase Ternary Complex With Amp-Pcp And 3pg Length = 416 Back     alignment and structure
>gi|308198780|pdb|3PGK|A Chain A, The Structure Of Yeast Phosphoglycerate Kinase At 0.25 Nm Resolution Length = 416 Back     alignment and structure
>gi|157833610|pdb|1QPG|A Chain A, 3-Phosphoglycerate Kinase, Mutation R65q Length = 415 Back     alignment and structure
>gi|34810932|pdb|1LTK|A Chain A, Crystal Structure Of Phosphoglycerate Kinase From Plasmodium Falciparum, In The Open Conformation Length = 425 Back     alignment and structure
>gi|13399644|pdb|1HDI|A Chain A, Pig Muscle 3-Phosphoglycerate Kinase Complexed With 3-Pg And Mgadp Length = 413 Back     alignment and structure
>gi|317455537|pdb|3Q3V|A Chain A, Crystal Structure Of Phosphoglycerate Kinase From Campylobacter Jejuni. Length = 403 Back     alignment and structure
gi|71042798|pdb|2CUN|A Chain A, Crystal Structure Of Phosphoglycerate Kinase From Pyrococcus Horikoshii Ot3 Length = 410 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target400 phosphoglycerate kinase [Candidatus Liberibacter asiati
1php_A394 3-phosphoglycerate kinase; HET: ADP; 1.65A {Geobacillus 1e-118
1qpg_A415 PGK, 3-phosphoglycerate kinase; phosphotransferase (car 1e-110
1ltk_A425 Phosphoglycerate kinase; PGK, glycolysis, glycerol, ope 1e-109
2wzb_A416 Phosphoglycerate kinase 1; hereditary hemolytic anemia, 1e-104
1hdi_A413 PGK, phosphoglycerate kinase; phosphotransferase, terna 1e-100
1vpe_A398 Phosphoglycerate kinase; transferase, hyperthermostabil 6e-93
1v6s_A390 Phosphoglycerate kinase; riken structural genomics/prot 2e-86
1zmr_A387 Phosphoglycerate kinase; transferase, glycolysis; 2.40A 9e-86
16pk_A415 PGK, 3-phosphoglycerate kinase; ternary complex, glycol 2e-80
2cun_A410 Phosphoglycerate kinase; structural genomics, tanpaku 3 1e-76
1fw8_A416 PGK P72, phosphoglycerate kinase; phosphotransferase, g 4e-86
1fw8_A416 PGK P72, phosphoglycerate kinase; phosphotransferase, g 1e-07
>1php_A 3-phosphoglycerate kinase; HET: ADP; 1.65A {Geobacillus stearothermophilus} SCOP: c.86.1.1 Length = 394 Back     alignment and structure
 Score =  419 bits (1079), Expect = e-118
 Identities = 160/393 (40%), Positives = 238/393 (60%), Gaps = 4/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D+RG R   RVD+NVP   G + D TRI   +PTI  L+E  AKV++ SHLGR
Sbjct: 4   KTIRDV-DVRGKRVFCRVDFNVPMEQGAITDDTRIRAALPTIRYLIEHGAKVILASHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K  ++  L  V      +L + +   N+ +G  +  ++  L+EG ++L ENVRFY  
Sbjct: 63  PKGKVVEELRLDAVAKRLGELLERPVAKTNEAVGDEVKAAVDRLNEGDVLLLENVRFYPG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KEL +L    
Sbjct: 123 EEKNDPELAKAFAELADLYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKELEVLGKAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S   +P  AI+GG+KV  KI ++ NL++KVD L+IGGG+A +F+ A G  VG+SL + D 
Sbjct: 183 SNPDRPFTAIIGGAKVKDKIGVIDNLLEKVDNLIIGGGLAYTFVKALGHDVGKSLLEEDK 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            +       +AK       +P DVVVA        T+VV   ++P D   LD+G KT E 
Sbjct: 243 IELAKSFMEKAKEKGVRFYMPVDVVVADRFANDANTKVVPIDAIPADWSALDIGPKTREL 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            + VI +++ V+WNGP+GVFE++ F   T  +A  +A+        S+ GGGD+  A+  
Sbjct: 303 YRDVIRESKLVVWNGPMGVFEMDAFAHGTKAIAEALAEALD---TYSVIGGGDSAAAVEK 359

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            G++++  ++ST GGA LE++EGK LPG+VAL 
Sbjct: 360 FGLADKMDHISTGGGASLEFMEGKQLPGVVALE 392


>1qpg_A PGK, 3-phosphoglycerate kinase; phosphotransferase (carboxyl acceptor), acetylation, glycolysis; HET: MAP 3PG; 2.40A {Saccharomyces cerevisiae} SCOP: c.86.1.1 PDB: 3pgk_A* Length = 415 Back     alignment and structure
>1ltk_A Phosphoglycerate kinase; PGK, glycolysis, glycerol, open conformation, ADP complex, selenomethionine, transferase; HET: AMP; 3.00A {Plasmodium falciparum} SCOP: c.86.1.1 Length = 425 Back     alignment and structure
>2wzb_A Phosphoglycerate kinase 1; hereditary hemolytic anemia, transferase, phosphoprotein, glycolysis, nucleotide-binding; HET: ADP 3PG; 1.47A {Homo sapiens} PDB: 2wzc_A* 3c3b_A* 2zgv_A* 3c3a_A* 3c39_A* 3c3c_A* 2wzd_A* 1vjd_A* 1vjc_A* 1kf0_A* 1hdi_A* 2p9t_A* 2p9q_A* 2paa_A* Length = 416 Back     alignment and structure
>1hdi_A PGK, phosphoglycerate kinase; phosphotransferase, ternary complex, glycolysis; HET: AMP 3PG; 1.8A {Sus scrofa} SCOP: c.86.1.1 PDB: 1kf0_A* 1vjd_A* 1vjc_A* 3c3b_A* 2zgv_A* 3c3a_A* 3c39_A* 3c3c_A* 2p9t_A* 2p9q_A* 2paa_A* Length = 413 Back     alignment and structure
>1vpe_A Phosphoglycerate kinase; transferase, hyperthermostability, crystal, AMP-PNP, 3-PGA; HET: ANP 3PG; 2.00A {Thermotoga maritima} SCOP: c.86.1.1 Length = 398 Back     alignment and structure
>1v6s_A Phosphoglycerate kinase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 1.50A {Thermus thermophilus} SCOP: c.86.1.1 PDB: 2ie8_A Length = 390 Back     alignment and structure
>1zmr_A Phosphoglycerate kinase; transferase, glycolysis; 2.40A {Escherichia coli} Length = 387 Back     alignment and structure
>16pk_A PGK, 3-phosphoglycerate kinase; ternary complex, glycolysis, transferase, bisubstrate, analog; HET: BIS EPE; 1.60A {Trypanosoma brucei} SCOP: c.86.1.1 PDB: 13pk_A* Length = 415 Back     alignment and structure
>2cun_A Phosphoglycerate kinase; structural genomics, tanpaku 3000, riken structural genomics/proteomics initiative, RSGI, NPPSFA; HET: 3PG; 2.10A {Pyrococcus horikoshii OT3} Length = 410 Back     alignment and structure
>1fw8_A PGK P72, phosphoglycerate kinase; phosphotransferase, glycolysis, mutant, permutation, permuted sequence, protein folding; 2.30A {Saccharomyces cerevisiae} SCOP: c.86.1.1 Length = 416 Back     alignment and structure
>1fw8_A PGK P72, phosphoglycerate kinase; phosphotransferase, glycolysis, mutant, permutation, permuted sequence, protein folding; 2.30A {Saccharomyces cerevisiae} SCOP: c.86.1.1 Length = 416 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target400 phosphoglycerate kinase [Candidatus Liberibacter asiati
1php_A394 3-phosphoglycerate kinase; HET: ADP; 1.65A {Geobacillus 100.0
1v6s_A390 Phosphoglycerate kinase; riken structural genomics/prot 100.0
1vpe_A398 Phosphoglycerate kinase; transferase, hyperthermostabil 100.0
16pk_A415 PGK, 3-phosphoglycerate kinase; ternary complex, glycol 100.0
1ltk_A425 Phosphoglycerate kinase; PGK, glycolysis, glycerol, ope 100.0
2wzb_A416 Phosphoglycerate kinase 1; hereditary hemolytic anemia, 100.0
1qpg_A415 PGK, 3-phosphoglycerate kinase; phosphotransferase (car 100.0
2cun_A410 Phosphoglycerate kinase; structural genomics, tanpaku 3 100.0
1zmr_A387 Phosphoglycerate kinase; transferase, glycolysis; 2.40A 100.0
1fw8_A416 PGK P72, phosphoglycerate kinase; phosphotransferase, g 100.0
1fw8_A416 PGK P72, phosphoglycerate kinase; phosphotransferase, g 99.68
1e0t_A470 Pyruvate kinase, PK; phosphotransferase, glycolysis, al 92.28
>1php_A 3-phosphoglycerate kinase; HET: ADP; 1.65A {Geobacillus stearothermophilus} SCOP: c.86.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=1032.15  Aligned_cols=394  Identities=41%  Similarity=0.697  Sum_probs=385.6

Q ss_pred             CCCCCCHHHHCCCCCEEEEEEECCCCCCCCEECCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCHHHHHHH
Q ss_conf             88877101001599689998201671318577725899998898999998898099991377888984733224788887
Q gi|254780653|r    2 SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDCSLFKVVSI   81 (400)
Q Consensus         2 ~~~~ti~d~~d~~gk~VlvRvD~NvPi~~g~I~d~~RI~~~~pTI~~l~~~~akvii~SH~GRPkg~~~~~~Sl~~v~~~   81 (400)
                      |++|||+|+ |++||+||||+|||||+++|+|+|++||++++|||++|+++||||||+||||||+|++++++||+||+++
T Consensus         1 M~~ktl~d~-d~~~K~VlvRvD~NvPi~~g~I~d~~RI~~~~pTI~~l~~~~akvvi~sH~GRP~g~~~~~~SL~~~a~~   79 (394)
T 1php_A            1 MNKKTIRDV-DVRGKRVFCRVDFNVPMEQGAITDDTRIRAALPTIRYLIEHGAKVILASHLGRPKGKVVEELRLDAVAKR   79 (394)
T ss_dssp             CCBCBGGGS-CCTTCEEEEECCCCCCEETTEESCCHHHHHHHHHHHHHHHTTCEEEEECCCSCCCSSCCGGGCSHHHHHH
T ss_pred             CCCCCCCCC-CCCCCEEEEEECCCCCCCCCEECCHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCHHHHHHH
T ss_conf             997840003-8789989999515778529968976899999999999997899899986888999987864575999999


Q ss_pred             HHHHCCCCCCCCCCCCHHHHHHHHHHCCCCCEEECCHHHHCCCCCCCHHHHHHHHCCCCCEEEECCHHHHCCCCCCEEEC
Q ss_conf             64310133545666310255665531364648982424303432100024665312436424754404401137633302
Q gi|254780653|r   82 AESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL  161 (400)
Q Consensus        82 l~~~l~~~V~fi~d~~g~~~~~~i~~l~~g~ilLLEN~Rf~~~E~~n~~~f~k~La~laDiyVnDAF~~aHR~haS~~gi  161 (400)
                      |+++|+++|.|++|++|+.+++++++|++|+|+||||+|||+||++|+++|+++||++||+|||||||||||+|||++|+
T Consensus        80 L~~~l~~~v~f~~d~~g~~~~~~i~~l~~g~i~lLENvRf~~~E~~nd~~fak~La~l~DiyVNDAF~~sHR~haS~~gi  159 (394)
T 1php_A           80 LGELLERPVAKTNEAVGDEVKAAVDRLNEGDVLLLENVRFYPGEEKNDPELAKAFAELADLYVNDAFGAAHRAHASTEGI  159 (394)
T ss_dssp             HHHHHTSCCEECSCSSSHHHHHHHHTCCTTCEEECCCGGGSHHHHHTCHHHHHHHHTTCSEEEECCGGGTTSCCTTTTGG
T ss_pred             HHHHHCCCCCEECCCCCHHHHHHHHHCCCCCEEEHHHHHHCCCCHHCHHHHHHHHHHHCCEEEECCCCHHHCCCCCHHHH
T ss_conf             99864556410013356779999961688868633757757531105199999987538899865400121148531214


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEEECCHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             33210003325565777653310166787189996078025578899877306888862057899999830143433331
Q gi|254780653|r  162 SHLLPSYIGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ  241 (400)
Q Consensus       162 ~~~lps~aG~l~ekEi~~L~~~l~~~~~P~v~IiGGaKisdKi~~i~~L~~k~D~iiigG~lantfL~A~G~~IG~Sl~e  241 (400)
                      |+++|||||++||+|+++|++++++|+||+++||||||+||||++|++|++++|+|++||+||||||+|+|++||+|++|
T Consensus       160 ~~~lps~aG~l~ekEl~~L~k~l~~p~rP~~aIiGGaKisdKi~~l~~l~~k~D~iiigG~mantfL~a~G~~iG~sl~e  239 (394)
T 1php_A          160 AHYLPAVAGFLMEKELEVLGKALSNPDRPFTAIIGGAKVKDKIGVIDNLLEKVDNLIIGGGLAYTFVKALGHDVGKSLLE  239 (394)
T ss_dssp             GGTSCEEECHHHHHHHHHHHHHHHSCCSSEEEEECSSCHHHHHHHHHHHTTTCSEEEECTTHHHHHHHHTTCCCTTSCCC
T ss_pred             HHHCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHCCEEEECHHHHHHHHHHCCCCCCCCHHH
T ss_conf             44154777878999999999998388997699971573654899999997532415764399999999859976721134


Q ss_pred             CCCCHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCCCCEECCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             00001356889987530245543035411343232333310253212013345765200356777640577679997662
Q gi|254780653|r  242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPL  321 (400)
Q Consensus       242 ~~~~~~ak~i~~~a~~~~~~I~lP~D~~v~~~~~~~~~~~~~~~~~i~~~~~i~DIGp~Ti~~~~~~I~~AktI~WNGP~  321 (400)
                      +++++.++++++++++++++|++|+|++|+.++....+.++++++++|++|+++||||+|++.|+++|.+|+||||||||
T Consensus       240 ~~~~~~a~~i~~~~~~~~~~i~lP~D~v~~~~~~~~~~~~~~~~~~i~~~~~i~DIG~~Ti~~~~~~I~~aktI~wNGP~  319 (394)
T 1php_A          240 EDKIELAKSFMEKAKEKGVRFYMPVDVVVADRFANDANTKVVPIDAIPADWSALDIGPKTRELYRDVIRESKLVVWNGPM  319 (394)
T ss_dssp             GGGHHHHHHHHHHHHHHTCEEECCSEEEEESSSSTTSCEEEEEGGGCCTTCEEEEECHHHHHHHHHHHHTCSEEEEESCS
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCCCCEEEEHHHCCCCCEEEEECHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             55578999999988861985147851353103456566358642231468547873867899999864437889997782


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHCCCCCCCCEEECCHHHHHHHHCCCCCHHHHHHCCC
Q ss_conf             532274365889999999986111488589974804699899848876864687507998998748998689884079
Q gi|254780653|r  322 GVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH  399 (400)
Q Consensus       322 GvfE~~~F~~GT~~l~~~ia~~~~~~~~~sivGGGdT~aai~~~g~~~~~~hvSTgGGA~L~~L~G~~LPgi~aL~~~  399 (400)
                      |+||+++|+.||.++++++++.   +++|||||||||++|++++|+.++|+||||||||||+||+|++||||+||++.
T Consensus       320 G~fE~~~F~~GT~~l~~~ia~s---~~a~sivGGGdT~aai~~~g~~~~~~hvSTgGGA~L~~L~G~~LPgi~aL~~k  394 (394)
T 1php_A          320 GVFEMDAFAHGTKAIAEALAEA---LDTYSVIGGGDSAAAVEKFGLADKMDHISTGGGASLEFMEGKQLPGVVALEDK  394 (394)
T ss_dssp             SCTTSGGGCHHHHHHHHHHHHC---TTCEEEECSHHHHHHHHHTTCGGGSSEECSCTHHHHHHHTTCCCHHHHTSCBC
T ss_pred             CCCCCCCHHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCCCCCCEEEECCHHHHHHHHCCCCCCHHHHHCCC
T ss_conf             5544661538999999999965---89859994738999999739867860896585999999879996368885069



>1v6s_A Phosphoglycerate kinase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 1.50A {Thermus thermophilus} SCOP: c.86.1.1 PDB: 2ie8_A Back     alignment and structure
>1vpe_A Phosphoglycerate kinase; transferase, hyperthermostability, crystal, AMP-PNP, 3-PGA; HET: ANP 3PG; 2.00A {Thermotoga maritima} SCOP: c.86.1.1 Back     alignment and structure
>16pk_A PGK, 3-phosphoglycerate kinase; ternary complex, glycolysis, transferase, bisubstrate, analog; HET: BIS EPE; 1.60A {Trypanosoma brucei} SCOP: c.86.1.1 PDB: 13pk_A* Back     alignment and structure
>1ltk_A Phosphoglycerate kinase; PGK, glycolysis, glycerol, open conformation, ADP complex, selenomethionine, transferase; HET: AMP; 3.00A {Plasmodium falciparum} SCOP: c.86.1.1 Back     alignment and structure
>2wzb_A Phosphoglycerate kinase 1; hereditary hemolytic anemia, transferase, phosphoprotein, glycolysis, nucleotide-binding; HET: ADP 3PG; 1.47A {Homo sapiens} PDB: 2wzc_A* 3c3b_A* 2zgv_A* 3c3a_A* 3c39_A* 3c3c_A* 2wzd_A* 1vjd_A* 1vjc_A* 1kf0_A* 1hdi_A* 2p9t_A* 2p9q_A* 2paa_A* Back     alignment and structure
>1qpg_A PGK, 3-phosphoglycerate kinase; phosphotransferase (carboxyl acceptor), acetylation, glycolysis; HET: MAP 3PG; 2.40A {Saccharomyces cerevisiae} SCOP: c.86.1.1 PDB: 3pgk_A* Back     alignment and structure
>2cun_A Phosphoglycerate kinase; structural genomics, tanpaku 3000, riken structural genomics/proteomics initiative, RSGI, NPPSFA; HET: 3PG; 2.10A {Pyrococcus horikoshii OT3} Back     alignment and structure
>1zmr_A Phosphoglycerate kinase; transferase, glycolysis; 2.40A {Escherichia coli} Back     alignment and structure
>1fw8_A PGK P72, phosphoglycerate kinase; phosphotransferase, glycolysis, mutant, permutation, permuted sequence, protein folding; 2.30A {Saccharomyces cerevisiae} SCOP: c.86.1.1 Back     alignment and structure
>1fw8_A PGK P72, phosphoglycerate kinase; phosphotransferase, glycolysis, mutant, permutation, permuted sequence, protein folding; 2.30A {Saccharomyces cerevisiae} SCOP: c.86.1.1 Back     alignment and structure
>1e0t_A Pyruvate kinase, PK; phosphotransferase, glycolysis, allostery; 1.8A {Escherichia coli} SCOP: b.58.1.1 c.1.12.1 c.49.1.1 PDB: 1pky_A 1e0u_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 400 phosphoglycerate kinase [Candidatus Liberibacter asiati
d1phpa_394 c.86.1.1 (A:) Phosphoglycerate kinase {Bacillus stearot 1e-102
d1vpea_398 c.86.1.1 (A:) Phosphoglycerate kinase {Thermotoga marit 9e-93
d1qpga_415 c.86.1.1 (A:) Phosphoglycerate kinase {Baker's yeast (S 3e-92
d1ltka_417 c.86.1.1 (A:) Phosphoglycerate kinase {Malaria parasite 1e-89
d1hdia_413 c.86.1.1 (A:) Phosphoglycerate kinase {Pig (Sus scrofa) 1e-88
d1v6sa_390 c.86.1.1 (A:) Phosphoglycerate kinase {Thermus thermoph 7e-86
d16pka_415 c.86.1.1 (A:) Phosphoglycerate kinase {Trypanosoma bruc 2e-81
>d1phpa_ c.86.1.1 (A:) Phosphoglycerate kinase {Bacillus stearothermophilus [TaxId: 1422]} Length = 394 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Phosphoglycerate kinase
superfamily: Phosphoglycerate kinase
family: Phosphoglycerate kinase
domain: Phosphoglycerate kinase
species: Bacillus stearothermophilus [TaxId: 1422]
 Score =  366 bits (941), Expect = e-102
 Identities = 160/393 (40%), Positives = 238/393 (60%), Gaps = 4/393 (1%)

Query: 5   RTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGR 64
           +T+ D+ D+RG R   RVD+NVP   G + D TRI   +PTI  L+E  AKV++ SHLGR
Sbjct: 4   KTIRDV-DVRGKRVFCRVDFNVPMEQGAITDDTRIRAALPTIRYLIEHGAKVILASHLGR 62

Query: 65  PQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSE 124
           P+ K  ++  L  V      +L + +   N+ +G  +  ++  L+EG ++L ENVRFY  
Sbjct: 63  PKGKVVEELRLDAVAKRLGELLERPVAKTNEAVGDEVKAAVDRLNEGDVLLLENVRFYPG 122

Query: 125 EERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSHLLPSYIGRAMQKELSMLESCF 184
           EE+NDP+  +  +   D Y+NDAF  +HRAHAS  G++H LP+  G  M+KEL +L    
Sbjct: 123 EEKNDPELAKAFAELADLYVNDAFGAAHRAHASTEGIAHYLPAVAGFLMEKELEVLGKAL 182

Query: 185 SESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDF 244
           S   +P  AI+GG+KV  KI ++ NL++KVD L+IGGG+A +F+ A G  VG+SL + D 
Sbjct: 183 SNPDRPFTAIIGGAKVKDKIGVIDNLLEKVDNLIIGGGLAYTFVKALGHDVGKSLLEEDK 242

Query: 245 SDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEY 304
            +       +AK       +P DVVVA        T+VV   ++P D   LD+G KT E 
Sbjct: 243 IELAKSFMEKAKEKGVRFYMPVDVVVADRFANDANTKVVPIDAIPADWSALDIGPKTREL 302

Query: 305 IKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAH 364
            + VI +++ V+WNGP+GVFE++ F   T  +A  +A+        S+ GGGD+  A+  
Sbjct: 303 YRDVIRESKLVVWNGPMGVFEMDAFAHGTKAIAEALAEALD---TYSVIGGGDSAAAVEK 359

Query: 365 AGISNEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
            G++++  ++ST GGA LE++EGK LPG+VAL 
Sbjct: 360 FGLADKMDHISTGGGASLEFMEGKQLPGVVALE 392


>d1vpea_ c.86.1.1 (A:) Phosphoglycerate kinase {Thermotoga maritima [TaxId: 2336]} Length = 398 Back     information, alignment and structure
>d1qpga_ c.86.1.1 (A:) Phosphoglycerate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 415 Back     information, alignment and structure
>d1ltka_ c.86.1.1 (A:) Phosphoglycerate kinase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 417 Back     information, alignment and structure
>d1hdia_ c.86.1.1 (A:) Phosphoglycerate kinase {Pig (Sus scrofa) [TaxId: 9823]} Length = 413 Back     information, alignment and structure
>d1v6sa_ c.86.1.1 (A:) Phosphoglycerate kinase {Thermus thermophilus [TaxId: 274]} Length = 390 Back     information, alignment and structure
>d16pka_ c.86.1.1 (A:) Phosphoglycerate kinase {Trypanosoma brucei [TaxId: 5691]} Length = 415 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target400 phosphoglycerate kinase [Candidatus Liberibacter asiati
d1phpa_394 Phosphoglycerate kinase {Bacillus stearothermophilus [T 100.0
d1v6sa_390 Phosphoglycerate kinase {Thermus thermophilus [TaxId: 2 100.0
d1vpea_398 Phosphoglycerate kinase {Thermotoga maritima [TaxId: 23 100.0
d16pka_415 Phosphoglycerate kinase {Trypanosoma brucei [TaxId: 569 100.0
d1ltka_417 Phosphoglycerate kinase {Malaria parasite (Plasmodium f 100.0
d1qpga_415 Phosphoglycerate kinase {Baker's yeast (Saccharomyces c 100.0
d1hdia_413 Phosphoglycerate kinase {Pig (Sus scrofa) [TaxId: 9823] 100.0
>d1phpa_ c.86.1.1 (A:) Phosphoglycerate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphoglycerate kinase
superfamily: Phosphoglycerate kinase
family: Phosphoglycerate kinase
domain: Phosphoglycerate kinase
species: Bacillus stearothermophilus [TaxId: 1422]
Probab=100.00  E-value=0  Score=1033.75  Aligned_cols=394  Identities=41%  Similarity=0.697  Sum_probs=385.6

Q ss_pred             CCCCCCHHHHCCCCCEEEEEEECCCCCCCCEECCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCHHHHHHH
Q ss_conf             88877101001599689998201671318577725899998898999998898099991377888984733224788887
Q gi|254780653|r    2 SRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPTILELVEKKAKVVIFSHLGRPQSKSDKDCSLFKVVSI   81 (400)
Q Consensus         2 ~~~~ti~d~~d~~gk~VlvRvD~NvPi~~g~I~d~~RI~~~~pTI~~l~~~~akvii~SH~GRPkg~~~~~~Sl~~v~~~   81 (400)
                      |++|||+|+ |++||+||||+|||||+++|+|+|++||++++|||++|+++||||||+||||||+|+.++++||+||+++
T Consensus         1 M~~ktl~d~-d~~~K~VlvR~D~NvPi~~g~I~d~~RI~~~~pTI~~ll~~~akvvl~SH~GRPkgk~~~~~Sl~~~~~~   79 (394)
T d1phpa_           1 MNKKTIRDV-DVRGKRVFCRVDFNVPMEQGAITDDTRIRAALPTIRYLIEHGAKVILASHLGRPKGKVVEELRLDAVAKR   79 (394)
T ss_dssp             CCBCBGGGS-CCTTCEEEEECCCCCCEETTEESCCHHHHHHHHHHHHHHHTTCEEEEECCCSCCCSSCCGGGCSHHHHHH
T ss_pred             CCCCCCCCC-CCCCCEEEEEEECCCCCCCCEECCHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCHHHHHHH
T ss_conf             997851113-7679999999405877609938975899999999999997899899985888999988865556999999


Q ss_pred             HHHHCCCCCCCCCCCCHHHHHHHHHHCCCCCEEECCHHHHCCCCCCCHHHHHHHHCCCCCEEEECCHHHHCCCCCCEEEC
Q ss_conf             64310133545666310255665531364648982424303432100024665312436424754404401137633302
Q gi|254780653|r   82 AESILHKNILFVNDCIGSTLSQSIASLSEGGIILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGL  161 (400)
Q Consensus        82 l~~~l~~~V~fi~d~~g~~~~~~i~~l~~g~ilLLEN~Rf~~~E~~n~~~f~k~La~laDiyVnDAF~~aHR~haS~~gi  161 (400)
                      |+++|+++|.|++|++++.++++++++++|+|+||||+|||+||++||++|+|+||++||+|||||||||||+|||++||
T Consensus        80 L~~~l~~~v~f~~~~~~~~~~~~i~~l~~g~i~lLEN~Rf~~~E~~nd~~fak~La~l~DiyVNDAF~~aHR~haS~~gi  159 (394)
T d1phpa_          80 LGELLERPVAKTNEAVGDEVKAAVDRLNEGDVLLLENVRFYPGEEKNDPELAKAFAELADLYVNDAFGAAHRAHASTEGI  159 (394)
T ss_dssp             HHHHHTSCCEECSCSSSHHHHHHHHTCCTTCEEECCCGGGSHHHHHTCHHHHHHHHTTCSEEEECCGGGTTSCCTTTTGG
T ss_pred             HHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEHHHHHCCCCCCCCHHHHHHHCCCCCEEEECCHHHHHCCCCCCCCH
T ss_conf             98740624111344356789999960578978863544535443215388997425448899966513655147751100


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEEECCHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             33210003325565777653310166787189996078025578899877306888862057899999830143433331
Q gi|254780653|r  162 SHLLPSYIGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQ  241 (400)
Q Consensus       162 ~~~lps~aG~l~ekEi~~L~~~l~~~~~P~v~IiGGaKisdKi~~i~~L~~k~D~iiigG~lantfL~A~G~~IG~Sl~e  241 (400)
                      |+++|||||+|||+|+++|++++++|+||+++||||||++|||++|++|++++|+|++||+||||||+|+|++||+|++|
T Consensus       160 ~~~lps~aG~l~ekEi~~L~~~l~~p~rP~~aIiGGaKisdKi~~i~~l~~k~D~i~igG~mantfl~a~G~~iG~sl~e  239 (394)
T d1phpa_         160 AHYLPAVAGFLMEKELEVLGKALSNPDRPFTAIIGGAKVKDKIGVIDNLLEKVDNLIIGGGLAYTFVKALGHDVGKSLLE  239 (394)
T ss_dssp             GGTSCEEECHHHHHHHHHHHHHHHSCCSSEEEEECSSCHHHHHHHHHHHTTTCSEEEECTTHHHHHHHHTTCCCTTSCCC
T ss_pred             HCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHCCEEEECCHHHHHHHHHCCCCCCCCCCC
T ss_conf             00266200110899999999997389997699970676332799998787535727874228799999859966732433


Q ss_pred             CCCCHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCCCCEECCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             00001356889987530245543035411343232333310253212013345765200356777640577679997662
Q gi|254780653|r  242 RDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPL  321 (400)
Q Consensus       242 ~~~~~~ak~i~~~a~~~~~~I~lP~D~~v~~~~~~~~~~~~~~~~~i~~~~~i~DIGp~Ti~~~~~~I~~AktI~WNGP~  321 (400)
                      +++.+.++++++.+++++++|++|+|++|+.++....++++++++++|.+|+++||||+|++.|+++|++|+||||||||
T Consensus       240 ~~~~~~a~~i~~~~~~~~~~i~lP~D~v~~~~~~~~~~~~~~~~~~i~~~~~ilDIG~~Ti~~~~~~I~~aktI~WNGPm  319 (394)
T d1phpa_         240 EDKIELAKSFMEKAKEKGVRFYMPVDVVVADRFANDANTKVVPIDAIPADWSALDIGPKTRELYRDVIRESKLVVWNGPM  319 (394)
T ss_dssp             GGGHHHHHHHHHHHHHHTCEEECCSEEEEESSSSTTSCEEEEEGGGCCTTCEEEEECHHHHHHHHHHHHTCSEEEEESCS
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCCCCCCHHHCCCCCCCCCEEEEHHHCCCCCCCCCCCCHHHHHHHHHHHHHCEEEEECCE
T ss_conf             11477899999877642986558863043212345566247770121478600356724899999998653058995552


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHCCCCCCCCEEECCHHHHHHHHCCCCCHHHHHHCCC
Q ss_conf             532274365889999999986111488589974804699899848876864687507998998748998689884079
Q gi|254780653|r  322 GVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH  399 (400)
Q Consensus       322 GvfE~~~F~~GT~~l~~~ia~~~~~~~~~sivGGGdT~aai~~~g~~~~~~hvSTgGGA~L~~L~G~~LPgi~aL~~~  399 (400)
                      |+||+++|+.||.+|++++++.   +++|||||||||++|++++|+.++|+||||||||||+||+|++||||+||++.
T Consensus       320 G~fE~~~F~~GT~~l~~~ia~~---~~a~sivGGGdT~aai~~~g~~~~~shvSTGGGA~Le~L~G~~LPgi~aL~~k  394 (394)
T d1phpa_         320 GVFEMDAFAHGTKAIAEALAEA---LDTYSVIGGGDSAAAVEKFGLADKMDHISTGGGASLEFMEGKQLPGVVALEDK  394 (394)
T ss_dssp             SCTTSGGGCHHHHHHHHHHHHC---TTCEEEECSHHHHHHHHHTTCGGGSSEECSCTHHHHHHHTTCCCHHHHTSCBC
T ss_pred             EEEECCCHHHHHHHHHHHHHHC---CCCEEEEECHHHHHHHHHCCCCCCCCEEECCHHHHHHHHCCCCCCHHHHHHCC
T ss_conf             3563462418999999999965---89869995779999999749867885796678999999879997358785169



>d1v6sa_ c.86.1.1 (A:) Phosphoglycerate kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vpea_ c.86.1.1 (A:) Phosphoglycerate kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d16pka_ c.86.1.1 (A:) Phosphoglycerate kinase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ltka_ c.86.1.1 (A:) Phosphoglycerate kinase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1qpga_ c.86.1.1 (A:) Phosphoglycerate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hdia_ c.86.1.1 (A:) Phosphoglycerate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 400 phosphoglycerate kinase [Candidatus Liberibacter a
16pk_A_204-415212 (A:204-415) PGK, 3-phosphoglycerate kinase; ternar 1e-64
1vpe_A_183-398216 (A:183-398) Phosphoglycerate kinase; transferase, 6e-62
1php_A_186-394209 (A:186-394) 3-phosphoglycerate kinase; HET: ADP; 1 7e-62
1fw8_A_132-346215 (A:132-346) PGK P72, phosphoglycerate kinase; phos 4e-60
1qpg_A_202-415214 (A:202-415) PGK, 3-phosphoglycerate kinase; phosph 7e-60
1hdi_A_201-413213 (A:201-413) PGK, phosphoglycerate kinase; phosphot 5e-59
1v6s_A_181-380200 (A:181-380) Phosphoglycerate kinase; riken structu 1e-58
1ltk_A_212-425214 (A:212-425) Phosphoglycerate kinase; PGK, glycolys 3e-58
1zmr_A_182-373192 (A:182-373) Phosphoglycerate kinase; transferase, 5e-57
2cun_A_189-390202 (A:189-390) Phosphoglycerate kinase; structural ge 8e-55
1php_A_1-185185 (A:1-185) 3-phosphoglycerate kinase; HET: ADP; 1.6 1e-52
1vpe_A_1-182182 (A:1-182) Phosphoglycerate kinase; transferase, hy 8e-51
1v6s_A_1-180_381-390190 (A:1-180,A:381-390) Phosphoglycerate kinase; riken 4e-50
2cun_A_1-188_391-410208 (A:1-188,A:391-410) Phosphoglycerate kinase; struc 1e-49
1ltk_A_1-211211 (A:1-211) Phosphoglycerate kinase; PGK, glycolysis 2e-48
1zmr_A_1-181_374-387195 (A:1-181,A:374-387) Phosphoglycerate kinase; trans 2e-48
16pk_A_1-203203 (A:1-203) PGK, 3-phosphoglycerate kinase; ternary 2e-46
1qpg_A_1-201201 (A:1-201) PGK, 3-phosphoglycerate kinase; phosphot 7e-46
1hdi_A_1-200200 (A:1-200) PGK, phosphoglycerate kinase; phosphotra 2e-44
1fw8_A_1-131_347-416200 (A:1-131,A:347-416) PGK P72, phosphoglycerate kina 1e-27
1fw8_A_1-131_347-416200 (A:1-131,A:347-416) PGK P72, phosphoglycerate kina 1e-18
>16pk_A (A:204-415) PGK, 3-phosphoglycerate kinase; ternary complex, glycolysis, transferase, bisubstrate, analog; HET: BIS EPE; 1.60A {Trypanosoma brucei}Length = 212 Back     alignment and structure
 Score =  241 bits (617), Expect = 1e-64
 Identities = 85/209 (40%), Positives = 130/209 (62%)

Query: 189 KPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNV 248
           +PLVAIVGG+KVS KI LL N+++++D L+IGG MA +FL AQG  +G+S C+    +  
Sbjct: 2   RPLVAIVGGAKVSDKIQLLDNMLQRIDYLLIGGAMAYTFLKAQGYSIGKSKCEESKLEFA 61

Query: 249 HQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQV 308
             +  +A+    ++I+P D V   E K      +   Q++P   + LD+G KT+E   Q 
Sbjct: 62  RSLLKKAEDRKVQVILPIDHVCHTEFKAVDSPLITEDQNIPEGHMALDIGPKTIEKYVQT 121

Query: 309 IAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKERRIISIAGGGDTITALAHAGIS 368
           I + ++ +WNGP+GVFE+ P+ + T  +A  + + T E  ++SI GGGD+ +A   +G +
Sbjct: 122 IGKCKSAIWNGPMGVFEMVPYSKGTFAIAKAMGRGTHEHGLMSIIGGGDSASAAELSGEA 181

Query: 369 NEFTYVSTAGGAFLEWLEGKDLPGIVALS 397
              ++VST GGA LE LEGK LPG+  L 
Sbjct: 182 KRMSHVSTGGGASLELLEGKTLPGVTVLD 210


>1vpe_A (A:183-398) Phosphoglycerate kinase; transferase, hyperthermostability, crystal, AMP-PNP, 3-PGA; HET: ANP 3PG; 2.00A {Thermotoga maritima}Length = 216 Back     alignment and structure
>1php_A (A:186-394) 3-phosphoglycerate kinase; HET: ADP; 1.65A {Geobacillus stearothermophilus}Length = 209 Back     alignment and structure
>1qpg_A (A:202-415) PGK, 3-phosphoglycerate kinase; phosphotransferase (carboxyl acceptor), acetylation, glycolysis; HET: MAP 3PG; 2.40A {Saccharomyces cerevisiae}Length = 214 Back     alignment and structure
>1hdi_A (A:201-413) PGK, phosphoglycerate kinase; phosphotransferase, ternary complex, glycolysis; HET: AMP 3PG; 1.8A {Sus scrofa}Length = 213 Back     alignment and structure
>1v6s_A (A:181-380) Phosphoglycerate kinase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 1.50A {Thermus thermophilus}Length = 200 Back     alignment and structure
>1ltk_A (A:212-425) Phosphoglycerate kinase; PGK, glycolysis, glycerol, open conformation, ADP complex, selenomethionine, transferase; HET: AMP; 3.00A {Plasmodium falciparum}Length = 214 Back     alignment and structure
>1zmr_A (A:182-373) Phosphoglycerate kinase; transferase, glycolysis; 2.40A {Escherichia coli}Length = 192 Back     alignment and structure
>2cun_A (A:189-390) Phosphoglycerate kinase; structural genomics, tanpaku 3000, riken structural genomics/proteomics initiative, RSGI, NPPSFA; HET: 3PG; 2.10A {Pyrococcus horikoshii OT3}Length = 202 Back     alignment and structure
>1php_A (A:1-185) 3-phosphoglycerate kinase; HET: ADP; 1.65A {Geobacillus stearothermophilus}Length = 185 Back     alignment and structure
>1vpe_A (A:1-182) Phosphoglycerate kinase; transferase, hyperthermostability, crystal, AMP-PNP, 3-PGA; HET: ANP 3PG; 2.00A {Thermotoga maritima}Length = 182 Back     alignment and structure
>1v6s_A (A:1-180,A:381-390) Phosphoglycerate kinase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 1.50A {Thermus thermophilus}Length = 190 Back     alignment and structure
>2cun_A (A:1-188,A:391-410) Phosphoglycerate kinase; structural genomics, tanpaku 3000, riken structural genomics/proteomics initiative, RSGI, NPPSFA; HET: 3PG; 2.10A {Pyrococcus horikoshii OT3}Length = 208 Back     alignment and structure
>1ltk_A (A:1-211) Phosphoglycerate kinase; PGK, glycolysis, glycerol, open conformation, ADP complex, selenomethionine, transferase; HET: AMP; 3.00A {Plasmodium falciparum}Length = 211 Back     alignment and structure
>1zmr_A (A:1-181,A:374-387) Phosphoglycerate kinase; transferase, glycolysis; 2.40A {Escherichia coli}Length = 195 Back     alignment and structure
>16pk_A (A:1-203) PGK, 3-phosphoglycerate kinase; ternary complex, glycolysis, transferase, bisubstrate, analog; HET: BIS EPE; 1.60A {Trypanosoma brucei}Length = 203 Back     alignment and structure
>1qpg_A (A:1-201) PGK, 3-phosphoglycerate kinase; phosphotransferase (carboxyl acceptor), acetylation, glycolysis; HET: MAP 3PG; 2.40A {Saccharomyces cerevisiae}Length = 201 Back     alignment and structure
>1hdi_A (A:1-200) PGK, phosphoglycerate kinase; phosphotransferase, ternary complex, glycolysis; HET: AMP 3PG; 1.8A {Sus scrofa}Length = 200 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target400 phosphoglycerate kinase [Candidatus Liberibacter asiati
16pk_A_204-415212 PGK, 3-phosphoglycerate kinase; ternary complex, g 100.0
1vpe_A_183-398216 Phosphoglycerate kinase; transferase, hyperthermos 100.0
1ltk_A_212-425214 Phosphoglycerate kinase; PGK, glycolysis, glycerol 100.0
1php_A_186-394209 3-phosphoglycerate kinase; HET: ADP; 1.65A {Geobac 100.0
1qpg_A_202-415214 PGK, 3-phosphoglycerate kinase; phosphotransferase 100.0
1hdi_A_201-413213 PGK, phosphoglycerate kinase; phosphotransferase, 100.0
1fw8_A_132-346215 PGK P72, phosphoglycerate kinase; phosphotransfera 100.0
1v6s_A_181-380200 Phosphoglycerate kinase; riken structural genomics 100.0
1zmr_A_182-373192 Phosphoglycerate kinase; transferase, glycolysis; 100.0
2cun_A_189-390202 Phosphoglycerate kinase; structural genomics, tanp 100.0
1php_A_1-185185 3-phosphoglycerate kinase; HET: ADP; 1.65A {Geobac 100.0
1vpe_A_1-182182 Phosphoglycerate kinase; transferase, hyperthermos 100.0
1v6s_A_1-180_381-390190 Phosphoglycerate kinase; riken structural genomics 100.0
2cun_A_1-188_391-410208 Phosphoglycerate kinase; structural genomics, tanp 100.0
1zmr_A_1-181_374-387195 Phosphoglycerate kinase; transferase, glycolysis; 100.0
1ltk_A_1-211211 Phosphoglycerate kinase; PGK, glycolysis, glycerol 100.0
1qpg_A_1-201201 PGK, 3-phosphoglycerate kinase; phosphotransferase 100.0
16pk_A_1-203203 PGK, 3-phosphoglycerate kinase; ternary complex, g 100.0
1hdi_A_1-200200 PGK, phosphoglycerate kinase; phosphotransferase, 100.0
1fw8_A_1-131_347-416200 PGK P72, phosphoglycerate kinase; phosphotransfera 100.0
1fw8_A_1-131_347-416200 PGK P72, phosphoglycerate kinase; phosphotransfera 99.94
>16pk_A (A:204-415) PGK, 3-phosphoglycerate kinase; ternary complex, glycolysis, transferase, bisubstrate, analog; HET: BIS EPE; 1.60A {Trypanosoma brucei} Back     alignment and structure
Probab=100.00  E-value=0  Score=516.88  Aligned_cols=212  Identities=40%  Similarity=0.683  Sum_probs=208.5

Q ss_pred             CCCEEEEEEECCHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEE
Q ss_conf             78718999607802557889987730688886205789999983014343333100001356889987530245543035
Q gi|254780653|r  188 KKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGGMANSFLVAQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRD  267 (400)
Q Consensus       188 ~~P~v~IiGGaKisdKi~~i~~L~~k~D~iiigG~lantfL~A~G~~IG~Sl~e~~~~~~ak~i~~~a~~~~~~I~lP~D  267 (400)
                      .||+++||||||+||||++|++|++|||+|++||+||||||+|+|++||+|++|++.++.++++++++++++++|++|+|
T Consensus         1 pRP~vaIlGGaKvsdKi~~l~~ll~k~D~iligG~ma~~Fl~A~G~~iG~s~~e~~~~~~a~~i~~~a~~~~~kI~lPvD   80 (212)
T 16pk_A            1 PRPLVAIVGGAKVSDKIQLLDNMLQRIDYLLIGGAMAYTFLKAQGYSIGKSKCEESKLEFARSLLKKAEDRKVQVILPID   80 (212)
T ss_dssp             CSSEEEEECSSCSGGGHHHHHHHGGGCSEEEECTTHHHHHHHHHTCCCTTCCCCGGGHHHHHHHHHHHHHTTCEEECCSS
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHCCEEEECCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             65517998525434379999988753543653222888999983982544312455443466774320025157752010


Q ss_pred             EECCCCCCCCCCCCCCCCCEECCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCC
Q ss_conf             41134323233331025321201334576520035677764057767999766253227436588999999998611148
Q gi|254780653|r  268 VVVAREMKTGIPTQVVSAQSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYVAKLTKER  347 (400)
Q Consensus       268 ~~v~~~~~~~~~~~~~~~~~i~~~~~i~DIGp~Ti~~~~~~I~~AktI~WNGP~GvfE~~~F~~GT~~l~~~ia~~~~~~  347 (400)
                      |+|+++++...+.++++.+++|++|+++||||+|++.|+++|.+|+|||||||||+||+++|+.||.+++++++++++++
T Consensus        81 ~~v~~~~~~~~~~~~~~~~~i~~~~~~~DIG~~Ti~~~~~~i~~aktI~wNGP~GvfE~~~F~~GT~~l~~aia~~t~~~  160 (212)
T 16pk_A           81 HVCHTEFKAVDSPLITEDQNIPEGHMALDIGPKTIEKYVQTIGKCKSAIWNGPMGVFEMVPYSKGTFAIAKAMGRGTHEH  160 (212)
T ss_dssp             EEEESSSSCCSSCEECSSSCCCTTCEEEEECHHHHHHHHHHHTTCSEEEEESCSSCTTSGGGCHHHHHHHHHHHHHHHHH
T ss_pred             EEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             33031123344430023222346436777777666677776651245889555021115616389999999999841448


Q ss_pred             CCEEEECCCHHHHHHHHCCCCCCCCEEECCHHHHHHHHCCCCCHHHHHHCCC
Q ss_conf             8589974804699899848876864687507998998748998689884079
Q gi|254780653|r  348 RIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH  399 (400)
Q Consensus       348 ~~~sivGGGdT~aai~~~g~~~~~~hvSTgGGA~L~~L~G~~LPgi~aL~~~  399 (400)
                      +++||||||||++|++++|+.++|+||||||||+|+||+|++||||+||+++
T Consensus       161 ~a~sivGGGdt~aa~~~~g~~~~~shvSTgGGA~L~~L~Gk~LPgieaL~~~  212 (212)
T 16pk_A          161 GLMSIIGGGDSASAAELSGEAKRMSHVSTGGGASLELLEGKTLPGVTVLDDK  212 (212)
T ss_dssp             CCEEEECSHHHHHHHHHTTCTTTSSEECSCHHHHHHHHTTCCCHHHHTSCBC
T ss_pred             CCEEEECCHHHHHHHHHCCCCCCCEEEECCHHHHHHHHCCCCCCHHHHHHCC
T ss_conf             9989987789999999719745870797778999999879996257785069



>1vpe_A (A:183-398) Phosphoglycerate kinase; transferase, hyperthermostability, crystal, AMP-PNP, 3-PGA; HET: ANP 3PG; 2.00A {Thermotoga maritima} Back     alignment and structure
>1ltk_A (A:212-425) Phosphoglycerate kinase; PGK, glycolysis, glycerol, open conformation, ADP complex, selenomethionine, transferase; HET: AMP; 3.00A {Plasmodium falciparum} Back     alignment and structure
>1php_A (A:186-394) 3-phosphoglycerate kinase; HET: ADP; 1.65A {Geobacillus stearothermophilus} Back     alignment and structure
>1qpg_A (A:202-415) PGK, 3-phosphoglycerate kinase; phosphotransferase (carboxyl acceptor), acetylation, glycolysis; HET: MAP 3PG; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1hdi_A (A:201-413) PGK, phosphoglycerate kinase; phosphotransferase, ternary complex, glycolysis; HET: AMP 3PG; 1.8A {Sus scrofa} Back     alignment and structure
>1v6s_A (A:181-380) Phosphoglycerate kinase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 1.50A {Thermus thermophilus} Back     alignment and structure
>1zmr_A (A:182-373) Phosphoglycerate kinase; transferase, glycolysis; 2.40A {Escherichia coli} Back     alignment and structure
>2cun_A (A:189-390) Phosphoglycerate kinase; structural genomics, tanpaku 3000, riken structural genomics/proteomics initiative, RSGI, NPPSFA; HET: 3PG; 2.10A {Pyrococcus horikoshii OT3} Back     alignment and structure
>1php_A (A:1-185) 3-phosphoglycerate kinase; HET: ADP; 1.65A {Geobacillus stearothermophilus} Back     alignment and structure
>1vpe_A (A:1-182) Phosphoglycerate kinase; transferase, hyperthermostability, crystal, AMP-PNP, 3-PGA; HET: ANP 3PG; 2.00A {Thermotoga maritima} Back     alignment and structure
>1v6s_A (A:1-180,A:381-390) Phosphoglycerate kinase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 1.50A {Thermus thermophilus} Back     alignment and structure
>2cun_A (A:1-188,A:391-410) Phosphoglycerate kinase; structural genomics, tanpaku 3000, riken structural genomics/proteomics initiative, RSGI, NPPSFA; HET: 3PG; 2.10A {Pyrococcus horikoshii OT3} Back     alignment and structure
>1zmr_A (A:1-181,A:374-387) Phosphoglycerate kinase; transferase, glycolysis; 2.40A {Escherichia coli} Back     alignment and structure
>1ltk_A (A:1-211) Phosphoglycerate kinase; PGK, glycolysis, glycerol, open conformation, ADP complex, selenomethionine, transferase; HET: AMP; 3.00A {Plasmodium falciparum} Back     alignment and structure
>1qpg_A (A:1-201) PGK, 3-phosphoglycerate kinase; phosphotransferase (carboxyl acceptor), acetylation, glycolysis; HET: MAP 3PG; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>16pk_A (A:1-203) PGK, 3-phosphoglycerate kinase; ternary complex, glycolysis, transferase, bisubstrate, analog; HET: BIS EPE; 1.60A {Trypanosoma brucei} Back     alignment and structure