254780655

254780655

transketolase

GeneID in NCBI database:8209658Locus tag:CLIBASIA_02710
Protein GI in NCBI database:254780655Protein Accession:YP_003065068.1
Gene range:+(615511, 617532)Protein Length:673aa
Gene description:transketolase
COG prediction:[G] Transketolase
KEGG prediction:tkt; transketolase (EC:2.2.1.1); K00615 transketolase [EC:2.2.1.1]
SEED prediction:Transketolase (EC 2.2.1.1)
Pathway involved in KEGG:Pentose phosphate pathway [PATH:las00030]
Biosynthesis of ansamycins
Subsystem involved in SEED:Pentose phosphate pathway
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670---
MGHPVGGRNVVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV
ccccccccccHHccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccccccccEEEEEcccHHHHHHHHHHHcccccccHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccEEEEEEEcccccccHHHHHHHHHHHHccccEEEEEEcccccccccccccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHcccEEEEEEEcccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHEEccccccccccccccccHHHHHHHccccEEEccccHHHHHHHHHHHHHHcccEEEEEEHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccHHHHHHHcccccEEEEcccHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccccccEEEEEccccEEEEEEccHHHHHHHHHHHHHHHccccEEEEEcccccHHccccHHHHHHHcccccEEEEEEccccHHHHHHHHccccEEEEccccccccHHHHHHHHcccHHHHHHHHHHHHcc
ccccccccccEEcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccccccccEEEEccHHHHHHHHHHHHHHccccccHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcEccccccEEEEEcHHHHHcHHHHHHHHHHHHcccccEEEEEEEccEEccEEHHHcccccHHHHHHHHccEEEEEccccHHHHHHHHHHHccccccEEEEEEcccccccccccccHHHccccccHHHHHHHHHHHccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccHHHHHHHHccccccccccEcHHHHHHHHHHHHHHHcccEEEEEcccHHHHcccccccHHHccccccccEEEccccHHHHHHHHHHHHHHcccEEEEEEEHHHHHccHHHHHHHHHcccccEEEEEcccHHHcccccccccccHHHHHHcccccEEEccccHHHHHHHHHHHHHcccccEEEEccccEEccccccHHHHHHHHHccEEEEcccccEEEEEEccHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHcccHHHHHHHHHHHHcc
mghpvggrnvVLMKYDDDYKKMADAIRFLSMDAienvnsghpglpmgMADVVTALFTQcmvfdpqcpywpnrdrfvlsAGHGSMLYYALLYLLGYQDVTIEDIKNFrtigsktaghpeygscagieattgplgqGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLwdnngisidgpisladstDQYARFRASgwntlsvnghdhHAITSTLRkaqlsdkptmIACETVigfgspnragtnkvhgsalgQEEIKATRKALnwdldpffipddIMKKWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRfsdalpdcfdNAFINLKKkfehskpmiatrkSSELVLEVVNDClpeliggsadltgsngtktsqMKAIsksdfsgrylhygVREHAMAAAMNGIALhkglapysgtfmvfsdysrpaIRLASLMGIRVIHVLthdsiglgedgpthqpvEHLAALRaipdllvlrpadsieTLECWQVALkeknrpsvlslsrqnlpflrtqyesnnlcalgaydyistpnaqVTIFSSGSELKIAVEACEILssrnistrvvsvpCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQgwdafigsdgsfigmqgfgasgscdllyqhfgINAIAIVDMVERKLSV
MGHPVGGRNVVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLPELiggsadltgsngtktsqMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVAlkeknrpsvlsLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQVTIFSSGSELKIAVEACEIlssrnistrvVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV
MGHPVGGRNVVLmkydddykkmadaIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHGSMlyyallyllgyQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV
*********************MADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGSPNRA**NKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSK***ATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPF*********LCALGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV
MGHPVGGRNVVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLPELIGGSADLTGS*********AISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV
*****GGRNVVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGHPVGGRNVVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV
MGHPVGGRNVVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV
MGHPVGGRNVVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target673 transketolase [Candidatus Liberibacter asiaticus str. p
315122159660 transketolase [Candidatus Liberibacter solanacearum CLs 1 0.0
17986594707 transketolase [Brucella melitensis bv. 1 str. 16M] Leng 1 0.0
297248996707 transketolase [Brucella abortus bv. 5 str. B3196] Lengt 1 0.0
148559589738 transketolase [Brucella ovis ATCC 25840] Length = 738 1 0.0
294850976684 transketolase [Brucella sp. NVSL 07-0026] Length = 684 1 0.0
254719727663 transketolase [Brucella sp. 83/13] Length = 663 1 0.0
161619653663 transketolase [Brucella canis ATCC 23365] Length = 663 1 0.0
225853181663 transketolase [Brucella melitensis ATCC 23457] Length = 1 0.0
23502584663 transketolase [Brucella suis 1330] Length = 663 1 0.0
163758822663 transketolase [Hoeflea phototrophica DFL-43] Length = 6 1 0.0
>gi|315122159|ref|YP_004062648.1| transketolase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 660 Back     alignment and organism information
 Score = 1155 bits (2988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/655 (84%), Positives = 608/655 (92%)

Query: 17  DDYKKMADAIRFLSMDAIENVNSGHPGLPMGMADVVTALFTQCMVFDPQCPYWPNRDRFV 76
           D YKKMA+AIRFLSMDAIENVNSGHPGLPMGMADV+T LF+Q M FDP+CP WPNRDRFV
Sbjct: 4   DGYKKMANAIRFLSMDAIENVNSGHPGLPMGMADVITVLFSQFMAFDPKCPSWPNRDRFV 63

Query: 77  LSAGHGSMLYYALLYLLGYQDVTIEDIKNFRTIGSKTAGHPEYGSCAGIEATTGPLGQGI 136
           LSAGHGSMLYY+LLYLLGYQD+TI+DIK FRTIGSKTAGHPEYG  +GIEATTGPLGQGI
Sbjct: 64  LSAGHGSMLYYSLLYLLGYQDITIDDIKKFRTIGSKTAGHPEYGFLSGIEATTGPLGQGI 123

Query: 137 ANAVGMAIAERKLREEFGDVLIDHYTYVLVGDGCLMEGISQEAISFAGHLGLSKLIVLWD 196
           ANAVGMAIAERKLR+EF D LI+HYTYVLVGDGCLMEGISQEAIS AGHLGL+KLIVLWD
Sbjct: 124 ANAVGMAIAERKLRDEFSDALINHYTYVLVGDGCLMEGISQEAISLAGHLGLNKLIVLWD 183

Query: 197 NNGISIDGPISLADSTDQYARFRASGWNTLSVNGHDHHAITSTLRKAQLSDKPTMIACET 256
           NNGISIDG ISLADSTDQ+ARFRASGWNTLSVNGHD++AI S LR+AQ S+KPTMIACET
Sbjct: 184 NNGISIDGSISLADSTDQHARFRASGWNTLSVNGHDYNAIASILREAQESNKPTMIACET 243

Query: 257 VIGFGSPNRAGTNKVHGSALGQEEIKATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTR 316
           VIGFGSPN+AGTNKVHGSALG+EEIKATRKALNW+LDPF IPD+IMK+WR  GLRSSQ R
Sbjct: 244 VIGFGSPNKAGTNKVHGSALGKEEIKATRKALNWNLDPFLIPDEIMKEWRSVGLRSSQIR 303

Query: 317 ADWQERLSSMKSSIRKEFERRFSDALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEV 376
           ADWQ  LSS++S ++KEF RRFSD LPDCFDN  + LKKK   SKP +ATRKSSE+VLEV
Sbjct: 304 ADWQSHLSSIESDVQKEFNRRFSDELPDCFDNTIMQLKKKIGESKPEVATRKSSEMVLEV 363

Query: 377 VNDCLPELIGGSADLTGSNGTKTSQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKG 436
           +NDCLPE+IGGSADLTGSNGTKTSQMK+IS+SDFSGRYLHYGVREHAMAA MNGIALHKG
Sbjct: 364 INDCLPEIIGGSADLTGSNGTKTSQMKSISRSDFSGRYLHYGVREHAMAAVMNGIALHKG 423

Query: 437 LAPYSGTFMVFSDYSRPAIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIP 496
           L PYSGTFMVFSDYSRP+IRLASLMGIRV+HVLTHDSIG+GEDGPTHQPVEH+AALRAIP
Sbjct: 424 LVPYSGTFMVFSDYSRPSIRLASLMGIRVVHVLTHDSIGVGEDGPTHQPVEHMAALRAIP 483

Query: 497 DLLVLRPADSIETLECWQVALKEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYIST 556
           +LLV RPADSIETLECWQVALK+K+ PSVLSLSRQNLPFLRTQYE  NLC+LGAYDYI+ 
Sbjct: 484 NLLVFRPADSIETLECWQVALKKKSCPSVLSLSRQNLPFLRTQYEEKNLCSLGAYDYIAC 543

Query: 557 PNAQVTIFSSGSELKIAVEACEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIK 616
           PNAQV IF+SGSELKIAVEA  +LS+RNIS RV+SVPCFELFFEQSD+YRAQIIG+SP+K
Sbjct: 544 PNAQVAIFASGSELKIAVEARNLLSARNISARVISVPCFELFFEQSDAYRAQIIGTSPVK 603

Query: 617 IAIEAGLRQGWDAFIGSDGSFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKL 671
           IA+EAGLRQGWD+ IGSDG F+GM+GFG+SGSCDLLYQHFGI A AIV +VERKL
Sbjct: 604 IAVEAGLRQGWDSLIGSDGDFVGMKGFGSSGSCDLLYQHFGITATAIVALVERKL 658


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|17986594|ref|NP_539228.1| transketolase [Brucella melitensis bv. 1 str. 16M] Length = 707 Back     alignment and organism information
>gi|297248996|ref|ZP_06932704.1| transketolase [Brucella abortus bv. 5 str. B3196] Length = 707 Back     alignment and organism information
>gi|148559589|ref|YP_001259578.1| transketolase [Brucella ovis ATCC 25840] Length = 738 Back     alignment and organism information
>gi|294850976|ref|ZP_06791652.1| transketolase [Brucella sp. NVSL 07-0026] Length = 684 Back     alignment and organism information
>gi|254719727|ref|ZP_05181538.1| transketolase [Brucella sp. 83/13] Length = 663 Back     alignment and organism information
>gi|161619653|ref|YP_001593540.1| transketolase [Brucella canis ATCC 23365] Length = 663 Back     alignment and organism information
>gi|225853181|ref|YP_002733414.1| transketolase [Brucella melitensis ATCC 23457] Length = 663 Back     alignment and organism information
>gi|23502584|ref|NP_698711.1| transketolase [Brucella suis 1330] Length = 663 Back     alignment and organism information
>gi|163758822|ref|ZP_02165909.1| transketolase [Hoeflea phototrophica DFL-43] Length = 663 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target673 transketolase [Candidatus Liberibacter asiaticus str. p
PRK05899624 PRK05899, PRK05899, transketolase; Reviewed 0.0
TIGR00232653 TIGR00232, tktlase_bact, transketolase, bacterial and y 0.0
PRK12753663 PRK12753, PRK12753, transketolase; Reviewed 0.0
PLN02790654 PLN02790, PLN02790, transketolase 0.0
PTZ00089661 PTZ00089, PTZ00089, transketolase; Provisional 0.0
PRK12754663 PRK12754, PRK12754, transketolase; Reviewed 1e-177
KOG0523632 KOG0523, KOG0523, KOG0523, Transketolase [Carbohydrate 1e-143
COG0021663 COG0021, TktA, Transketolase [Carbohydrate transport an 0.0
pfam00456333 pfam00456, Transketolase_N, Transketolase, thiamine dip 1e-120
cd02012255 cd02012, TPP_TK, Thiamine pyrophosphate (TPP) family, T 8e-95
COG3959243 COG3959, COG3959, Transketolase, N-terminal subunit [Ca 2e-50
cd02007195 cd02007, TPP_DXS, Thiamine pyrophosphate (TPP) family, 7e-11
PRK12571641 PRK12571, PRK12571, 1-deoxy-D-xylulose-5-phosphate synt 4e-10
COG1154627 COG1154, Dxs, Deoxyxylulose-5-phosphate synthase [Coenz 1e-09
TIGR00204617 TIGR00204, dxs, 1-deoxy-D-xylulose-5-phosphate synthase 2e-05
PLN02582677 PLN02582, PLN02582, 1-deoxy-D-xylulose-5-phosphate synt 7e-05
PLN02234641 PLN02234, PLN02234, 1-deoxy-D-xylulose-5-phosphate synt 0.001
cd07033156 cd07033, TPP_PYR_DXS_TK_like, Pyrimidine (PYR) binding 2e-47
pfam02779174 pfam02779, Transket_pyr, Transketolase, pyrimidine bind 1e-46
smart00861168 smart00861, Transket_pyr, Transketolase, pyrimidine bin 4e-41
COG3958312 COG3958, COG3958, Transketolase, C-terminal subunit [Ca 7e-25
cd02000293 cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate ( 6e-10
PRK05444580 PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synt 7e-08
COG1071358 COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase co 7e-07
PRK12315581 PRK12315, PRK12315, 1-deoxy-D-xylulose-5-phosphate synt 5e-06
cd02017386 cd02017, TPP_E1_EcPDC_like, Thiamine pyrophosphate (TPP 6e-10
cd00568168 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) enzy 1e-08
COG1154627 COG1154, Dxs, Deoxyxylulose-5-phosphate synthase [Coenz 1e-08
TIGR00204617 TIGR00204, dxs, 1-deoxy-D-xylulose-5-phosphate synthase 1e-05
PRK05444580 PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synt 4e-05
PRK12571641 PRK12571, PRK12571, 1-deoxy-D-xylulose-5-phosphate synt 1e-04
PLN02234641 PLN02234, PLN02234, 1-deoxy-D-xylulose-5-phosphate synt 0.002
COG2609 887 COG2609, AceE, Pyruvate dehydrogenase complex, dehydrog 1e-08
COG3957793 COG3957, COG3957, Phosphoketolase [Carbohydrate transpo 2e-07
COG2609887 COG2609, AceE, Pyruvate dehydrogenase complex, dehydrog 2e-06
pfam02780124 pfam02780, Transketolase_C, Transketolase, C-terminal d 1e-04
PRK07064544 PRK07064, PRK07064, hypothetical protein; Provisional 0.001
cd02002178 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) family, 0.004
>gnl|CDD|180309 PRK05899, PRK05899, transketolase; Reviewed Back     alignment and domain information
>gnl|CDD|161779 TIGR00232, tktlase_bact, transketolase, bacterial and yeast Back     alignment and domain information
>gnl|CDD|183723 PRK12753, PRK12753, transketolase; Reviewed Back     alignment and domain information
>gnl|CDD|178387 PLN02790, PLN02790, transketolase Back     alignment and domain information
>gnl|CDD|173383 PTZ00089, PTZ00089, transketolase; Provisional Back     alignment and domain information
>gnl|CDD|183724 PRK12754, PRK12754, transketolase; Reviewed Back     alignment and domain information
>gnl|CDD|35743 KOG0523, KOG0523, KOG0523, Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|30371 COG0021, TktA, Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|144157 pfam00456, Transketolase_N, Transketolase, thiamine diphosphate binding domain Back     alignment and domain information
>gnl|CDD|48175 cd02012, TPP_TK, Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>gnl|CDD|33740 COG3959, COG3959, Transketolase, N-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|73294 cd02007, TPP_DXS, Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>gnl|CDD|183601 PRK12571, PRK12571, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|31348 COG1154, Dxs, Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>gnl|CDD|129308 TIGR00204, dxs, 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>gnl|CDD|178194 PLN02582, PLN02582, 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>gnl|CDD|177878 PLN02234, PLN02234, 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>gnl|CDD|132916 cd07033, TPP_PYR_DXS_TK_like, Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins Back     alignment and domain information
>gnl|CDD|145763 pfam02779, Transket_pyr, Transketolase, pyrimidine binding domain Back     alignment and domain information
>gnl|CDD|129094 smart00861, Transket_pyr, Transketolase, pyrimidine binding domain Back     alignment and domain information
>gnl|CDD|33739 COG3958, COG3958, Transketolase, C-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|48163 cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>gnl|CDD|180086 PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|31269 COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183431 PRK12315, PRK12315, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|48180 cd02017, TPP_E1_EcPDC_like, Thiamine pyrophosphate (TPP) family, E1 of E Back     alignment and domain information
>gnl|CDD|48162 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>gnl|CDD|31348 COG1154, Dxs, Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>gnl|CDD|129308 TIGR00204, dxs, 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>gnl|CDD|180086 PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|183601 PRK12571, PRK12571, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|177878 PLN02234, PLN02234, 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>gnl|CDD|32601 COG2609, AceE, Pyruvate dehydrogenase complex, dehydrogenase (E1) component [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|33738 COG3957, COG3957, Phosphoketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|32601 COG2609, AceE, Pyruvate dehydrogenase complex, dehydrogenase (E1) component [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|145764 pfam02780, Transketolase_C, Transketolase, C-terminal domain Back     alignment and domain information
>gnl|CDD|180820 PRK07064, PRK07064, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|48165 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 673 transketolase [Candidatus Liberibacter asiaticus str. p
TIGR00232675 tktlase_bact transketolase; InterPro: IPR005478 Transke 100.0
COG0021663 TktA Transketolase [Carbohydrate transport and metaboli 100.0
PTZ00089670 transketolase; Provisional 100.0
PRK12753662 transketolase; Reviewed 100.0
PRK12754663 transketolase; Reviewed 100.0
PRK05899661 transketolase; Reviewed 100.0
KOG0523632 consensus 100.0
PRK05444576 1-deoxy-D-xylulose-5-phosphate synthase; Provisional 100.0
PRK12315581 1-deoxy-D-xylulose-5-phosphate synthase; Provisional 100.0
PRK12571642 1-deoxy-D-xylulose-5-phosphate synthase; Provisional 100.0
COG1154627 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabo 100.0
PRK09405886 aceE pyruvate dehydrogenase subunit E1; Reviewed 100.0
COG2609887 AceE Pyruvate dehydrogenase complex, dehydrogenase (E1) 100.0
TIGR00759905 aceE 2-oxo-acid dehydrogenase E1 component, homodimeric 100.0
PRK13012898 2-oxoacid dehydrogenase subunit E1; Provisional 100.0
TIGR00204627 dxs 1-deoxy-D-xylulose-5-phosphate synthase; InterPro: 100.0
TIGR03186889 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. Severa 100.0
PRK05261786 putative phosphoketolase; Provisional 100.0
COG3957793 Phosphoketolase [Carbohydrate transport and metabolism] 100.0
pfam00456333 Transketolase_N Transketolase, thiamine diphosphate bin 100.0
cd02012255 TPP_TK Thiamine pyrophosphate (TPP) family, Transketola 100.0
cd02017386 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) family, 100.0
cd02007195 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfam 100.0
pfam09364379 XFP_N XFP N-terminal domain. Bacterial enzyme splits fr 99.63
COG3959243 Transketolase, N-terminal subunit [Carbohydrate transpo 100.0
COG3958312 Transketolase, C-terminal subunit [Carbohydrate transpo 100.0
PRK09212327 pyruvate dehydrogenase subunit beta; Validated 100.0
CHL00144326 odpB pyruvate dehydrogenase E1 component beta subunit; 100.0
PTZ00182355 3-methyl-2-oxobutanate dehydrogenase; Provisional 100.0
PRK11892464 pyruvate dehydrogenase subunit beta; Provisional 99.97
COG0022324 AcoB Pyruvate/2-oxoglutarate dehydrogenase complex, deh 99.96
KOG0524359 consensus 99.91
cd07033156 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 100.0
pfam02779174 Transket_pyr Transketolase, pyrimidine binding domain. 100.0
smart00861168 Transket_pyr Transketolase, pyrimidine binding domain. 99.97
cd07036167 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding doma 99.89
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase. Mem 99.12
PRK08527560 acetolactate synthase 3 catalytic subunit; Validated 99.06
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 99.04
PRK08611576 pyruvate oxidase; Provisional 99.04
PRK07418615 acetolactate synthase 3 catalytic subunit; Reviewed 99.03
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [acetolac 98.9
PRK08273597 pyruvate decarboxylase; Provisional 98.89
PRK11269591 glyoxylate carboligase; Provisional 98.87
pfam03894179 XFP D-xylulose 5-phosphate/D-fructose 6-phosphate phosp 97.33
TIGR03181341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alph 99.89
cd02000293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) famil 99.87
KOG1182432 consensus 99.69
cd02011227 TPP_PK Thiamine pyrophosphate (TPP) family, Phosphoketo 99.57
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, 99.47
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC 99.27
CHL00149343 odpA pyruvate dehydrogenase E1 component alpha subunit; 99.89
pfam00676303 E1_dh Dehydrogenase E1 component. This family uses thia 99.87
TIGR03182315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alph 99.87
COG1071358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, deh 99.84
KOG0225394 consensus 99.49
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolacta 99.17
pfam02775150 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal 99.09
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydr 99.09
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate o 99.09
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, 99.07
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, Co 99.07
cd02003205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subf 99.03
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subf 99.02
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_I 98.99
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-l 98.96
PRK06163202 hypothetical protein; Provisional 98.95
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfam 98.87
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, 98.83
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subf 98.78
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR- 98.54
cd03375193 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglu 98.04
COG3962617 Acetolactate synthase [Amino acid transport and metabol 97.96
cd03376235 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), 97.75
cd02018237 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate 97.47
PRK11864300 2-ketoisovalerate ferredoxin oxidoreductase subunit bet 97.43
PRK11865298 pyruvate ferredoxin oxidoreductase subunit beta; Provis 97.27
cd02016265 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E 96.88
PRK09628281 oorB 2-oxoglutarate-acceptor oxidoreductase subunit Oor 96.8
PRK11867280 2-oxoglutarate ferredoxin oxidoreductase subunit beta; 96.73
COG1013294 PorB Pyruvate:ferredoxin oxidoreductase and related 2-o 96.71
PRK11866286 2-oxoacid ferredoxin oxidoreductase subunit beta; Provi 96.57
PRK05778306 2-oxoglutarate ferredoxin oxidoreductase subunit beta; 96.47
PRK11869284 2-oxoacid ferredoxin oxidoreductase subunit beta; Provi 96.4
pfam02780124 Transketolase_C Transketolase, C-terminal domain. The C 99.65
PRK08659377 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; 99.38
pfam09363203 XFP_C XFP C-terminal domain. Bacterial enzyme splits fr 96.98
KOG0525362 consensus 99.48
PRK09627375 oorA 2-oxoglutarate-acceptor oxidoreductase subunit Oor 99.29
PRK07119350 2-ketoisovalerate ferredoxin reductase; Validated 99.28
PRK06457549 pyruvate dehydrogenase; Provisional 99.18
PRK06965587 acetolactate synthase 3 catalytic subunit; Validated 99.09
PRK06546578 pyruvate dehydrogenase; Provisional 99.08
PRK07789612 acetolactate synthase 1 catalytic subunit; Validated 99.06
PRK08155564 acetolactate synthase catalytic subunit; Validated 99.06
PRK09124574 pyruvate dehydrogenase; Provisional 99.06
PRK06725570 acetolactate synthase 3 catalytic subunit; Validated 99.06
PRK06276586 acetolactate synthase catalytic subunit; Reviewed 99.05
PRK06466574 acetolactate synthase 3 catalytic subunit; Validated 99.04
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 99.04
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. This fam 99.04
PRK06048562 acetolactate synthase 3 catalytic subunit; Reviewed 99.01
TIGR03393539 indolpyr_decarb indolepyruvate decarboxylase, Erwinia f 99.01
PRK08979572 acetolactate synthase 3 catalytic subunit; Validated 98.97
PRK09259572 putative oxalyl-CoA decarboxylase; Validated 98.93
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number of ba 98.9
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alp 98.2
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha and bet 98.03
cd06586154 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiam 97.6
PRK07092521 benzoylformate decarboxylase; Reviewed 97.05
PRK08199553 acetolactate synthase 2 catalytic subunit; Validated 96.85
pfam02776172 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal 96.41
cd07034160 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding do 96.12
pfam01855230 POR_N domain. This family includes the N terminal struc 96.07
PRK07524534 hypothetical protein; Provisional 95.58
cd07037162 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2-succi 95.2
cd07035155 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX 95.16
PRK06154556 hypothetical protein; Provisional 94.73
cd07039164 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX. Thi 94.31
cd07038162 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain o 93.75
PRK09107594 acetolactate synthase 3 catalytic subunit; Validated 99.1
PRK08266531 hypothetical protein; Provisional 99.06
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewed 99.05
PRK05858543 hypothetical protein; Provisional 99.05
PRK07064544 hypothetical protein; Provisional 99.05
CHL00099588 ilvB acetohydroxyacid synthase large subunit 99.04
PRK08322547 acetolactate synthase; Reviewed 99.03
PRK08617552 acetolactate synthase; Reviewed 99.01
PRK07282566 acetolactate synthase catalytic subunit; Reviewed 99.01
PRK06112581 acetolactate synthase catalytic subunit; Validated 99.01
PRK07979574 acetolactate synthase 3 catalytic subunit; Validated 98.99
PRK07525589 sulfoacetaldehyde acetyltransferase; Validated 98.97
PRK07449548 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic ac 98.87
PRK08327568 acetolactate synthase catalytic subunit; Validated 96.17
PRK12474518 hypothetical protein; Provisional 95.73
PRK07586514 hypothetical protein; Validated 95.49
PRK07092521 benzoylformate decarboxylase; Reviewed 99.06
KOG4166675 consensus 90.17
PRK07524534 hypothetical protein; Provisional 99.04
PRK08327568 acetolactate synthase catalytic subunit; Validated 98.94
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alp 97.46
PRK07789612 acetolactate synthase 1 catalytic subunit; Validated 96.89
PRK07282566 acetolactate synthase catalytic subunit; Reviewed 96.87
TIGR02418553 acolac_catab acetolactate synthase, catabolic; InterPro 96.86
PRK08527560 acetolactate synthase 3 catalytic subunit; Validated 96.76
PRK07064544 hypothetical protein; Provisional 96.74
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number of ba 96.72
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 96.68
PRK07418615 acetolactate synthase 3 catalytic subunit; Reviewed 96.55
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewed 96.51
PRK08155564 acetolactate synthase catalytic subunit; Validated 96.42
PRK06276586 acetolactate synthase catalytic subunit; Reviewed 96.34
PRK08979572 acetolactate synthase 3 catalytic subunit; Validated 96.34
CHL00099588 ilvB acetohydroxyacid synthase large subunit 96.25
PRK06466574 acetolactate synthase 3 catalytic subunit; Validated 96.23
PRK06725570 acetolactate synthase 3 catalytic subunit; Validated 96.17
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 96.0
PRK09107594 acetolactate synthase 3 catalytic subunit; Validated 95.69
PRK07449548 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic ac 95.22
PRK09124574 pyruvate dehydrogenase; Provisional 93.73
TIGR02176 1194 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoredu 93.0
TIGR01504593 glyox_carbo_lig glyoxylate carboligase; InterPro: IPR00 91.11
PRK12474518 hypothetical protein; Provisional 99.04
PRK08199553 acetolactate synthase 2 catalytic subunit; Validated 99.03
PRK07586514 hypothetical protein; Validated 98.99
PRK06154556 hypothetical protein; Provisional 98.95
COG3961557 Pyruvate decarboxylase and related thiamine pyrophospha 98.15
KOG1184561 consensus 97.81
PRK08322547 acetolactate synthase; Reviewed 97.54
PRK07525589 sulfoacetaldehyde acetyltransferase; Validated 97.24
PRK07979574 acetolactate synthase 3 catalytic subunit; Validated 97.03
PRK06882574 acetolactate synthase 3 catalytic subunit; Validated 96.69
PRK06112581 acetolactate synthase catalytic subunit; Validated 96.67
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase. Mem 96.54
PRK05858543 hypothetical protein; Provisional 96.51
PRK06965587 acetolactate synthase 3 catalytic subunit; Validated 96.45
PRK09259572 putative oxalyl-CoA decarboxylase; Validated 96.35
PRK06048562 acetolactate synthase 3 catalytic subunit; Reviewed 96.12
PRK11269591 glyoxylate carboligase; Provisional 95.97
PRK08273597 pyruvate decarboxylase; Provisional 95.9
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [acetolac 95.53
PRK08266531 hypothetical protein; Provisional 95.17
PRK08611576 pyruvate oxidase; Provisional 94.29
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxy 94.24
PRK06457549 pyruvate dehydrogenase; Provisional 93.51
PRK06546578 pyruvate dehydrogenase; Provisional 92.96
PRK06882574 acetolactate synthase 3 catalytic subunit; Validated 99.02
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxy 98.89
PRK08367395 porA pyruvate ferredoxin oxidoreductase subunit alpha; 98.84
PRK08366394 vorA 2-ketoisovalerate ferredoxin oxidoreductase subuni 98.75
COG0674365 PorA Pyruvate:ferredoxin oxidoreductase and related 2-o 98.13
TIGR02176 1194 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoredu 96.97
PRK09622407 porA pyruvate flavodoxin oxidoreductase subunit alpha; 98.75
PRK09404931 kgd alpha-ketoglutarate decarboxylase; Reviewed 98.59
PRK122701234 kgd alpha-ketoglutarate decarboxylase; Reviewed 98.09
COG0567906 SucA 2-oxoglutarate dehydrogenase complex, dehydrogenas 94.56
TIGR00118593 acolac_lg acetolactate synthase, large subunit, biosynt 98.26
KOG1185571 consensus 98.05
KOG0451913 consensus 97.84
TIGR02720577 pyruv_oxi_spxB pyruvate oxidase; InterPro: IPR014092 Me 97.62
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha and bet 97.6
COG1165566 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 94.76
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 92.15
>TIGR00232 tktlase_bact transketolase; InterPro: IPR005478 Transketolase (EC 2 Back     alignment and domain information
>COG0021 TktA Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>KOG0523 consensus Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed Back     alignment and domain information
>COG2609 AceE Pyruvate dehydrogenase complex, dehydrogenase (E1) component [Energy production and conversion] Back     alignment and domain information
>TIGR00759 aceE 2-oxo-acid dehydrogenase E1 component, homodimeric type; InterPro: IPR004660 Most members of this family are pyruvate dehydrogenase complex, E1 component Back     alignment and domain information
>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase; InterPro: IPR005477 DXP synthase is a thiamine diphosphate-dependent enzyme related to transketolase and the pyruvate dehydrogenase E1-beta subunit Back     alignment and domain information
>TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase Back     alignment and domain information
>PRK05261 putative phosphoketolase; Provisional Back     alignment and domain information
>COG3957 Phosphoketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>pfam00456 Transketolase_N Transketolase, thiamine diphosphate binding domain Back     alignment and domain information
>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>cd02017 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) family, E1 of E Back     alignment and domain information
>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>pfam09364 XFP_N XFP N-terminal domain Back     alignment and domain information
>COG3959 Transketolase, N-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3958 Transketolase, C-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09212 pyruvate dehydrogenase subunit beta; Validated Back     alignment and domain information
>CHL00144 odpB pyruvate dehydrogenase E1 component beta subunit; Validated Back     alignment and domain information
>PTZ00182 3-methyl-2-oxobutanate dehydrogenase; Provisional Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>COG0022 AcoB Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion] Back     alignment and domain information
>KOG0524 consensus Back     alignment and domain information
>cd07033 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins Back     alignment and domain information
>pfam02779 Transket_pyr Transketolase, pyrimidine binding domain Back     alignment and domain information
>smart00861 Transket_pyr Transketolase, pyrimidine binding domain Back     alignment and domain information
>cd07036 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK08273 pyruvate decarboxylase; Provisional Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>pfam03894 XFP D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>KOG1182 consensus Back     alignment and domain information
>cd02011 TPP_PK Thiamine pyrophosphate (TPP) family, Phosphoketolase (PK) subfamily, TPP-binding module; PK catalyzes the conversion of D-xylulose 5-phosphate and phosphate to acetyl phosphate, D-glyceraldehyde-3-phosphate and H2O Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>pfam00676 E1_dh Dehydrogenase E1 component Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>KOG0225 consensus Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>pfam02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>COG3962 Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria Back     alignment and domain information
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways Back     alignment and domain information
>PRK11864 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>cd02016 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed Back     alignment and domain information
>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed Back     alignment and domain information
>COG1013 PorB Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated Back     alignment and domain information
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>pfam02780 Transketolase_C Transketolase, C-terminal domain Back     alignment and domain information
>PRK08659 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; Validated Back     alignment and domain information
>pfam09363 XFP_C XFP C-terminal domain Back     alignment and domain information
>KOG0525 consensus Back     alignment and domain information
>PRK09627 oorA 2-oxoglutarate-acceptor oxidoreductase subunit OorA; Reviewed Back     alignment and domain information
>PRK07119 2-ketoisovalerate ferredoxin reductase; Validated Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back