254780654

254780654

Glyceraldehyde 3-Phosphate Dehydrogenase

GeneID in NCBI database:8209657Locus tag:CLIBASIA_02705
Protein GI in NCBI database:254780654Protein Accession:YP_003065067.1
Gene range:+(617585, 618586)Protein Length:333aa
Gene description:Glyceraldehyde 3-Phosphate Dehydrogenase
COG prediction:[G] Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase
KEGG prediction:glyceraldehyde 3-phosphate dehydrogenase; K00134 glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
SEED prediction:NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)
Pathway involved in KEGG:Glycolysis / Gluconeogenesis [PATH:las00010]
Subsystem involved in SEED:Glutaredoxins;
Pyridoxin (Vitamin B6) Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330---
MVCKVAINGFGRIGRCILRAAVESRRDDVRIVAINDLNSIETMAHLLRYDSVHGRFPGEVKIIGDTIDVGLGPIQVTSIRDPQDLPWGDVDVAMECTGFFVTQEKASLHLSNGSQRVLVSAPCKGVKKTIVYGVNHQSLNKEDKVVSNASCTTNCLVPVVHVLDKMFGIEKGYMTTVHSYTGDQHVLDAGHSDLYRSRAAAISMVPTSTGAAKAVELVLPNLKGKLDGSSIRVPTPNVSMVDLKCVTSRDVNIDEINATMKYFAEGDLKNILGYVTLPLVSVDFNHTSYSSIFAADQTKVVSQNLLRVLVWYDNEWGFSNRMLDTASAMANLS
ccEEEEEEcccHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHccccccccccEEEEEccEEEEccEEEEEEEcccHHHccccccEEEEEcccccccHHHHHHHHHccccEEEEEcccccccEEEEEcccHHHccccccEEEccccHHHHHHHHHHHHHHcccEEEEEEEEEEccccccEEEccccHHHHcccEEEEEccccccHHHHHHHHHcccccccEEEEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHHHccccccEEccccccEEEEccccccccEEEEccccEEEcccEEEEEEEEcccHHHHHHHHHHHHHHHccc
cccEEEEEcccHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHcccccccccccEEEcccEEEEccEEEEEEccccHHHccHHHccEEEEccccccEHHHHcHHHHccccEEEEccccEcccEEccccccHHHccccccEEEcccHHHHHHHHHHHHHHHHHcEEEEEEEEEEEcccccEcccccccccccccEcccccEEEcccHHHHHHHHcHHHcccEEEEEEEEcccccEEEEEEEEEcccccHHHHHHHHHHHHHccccccEEEEcccccHHHcccccccEEEEccccEEEcccEEEEEEEEcccHHHHHHHHHHHHHHcccc
MVCKVAINGFGRIGRCILRAAVESRRDDVRIVAINDLNSIETMAHLLRYdsvhgrfpgevkiigdtidvglgpiqvtsirdpqdlpwgdvdvAMECTGFFVTQEKaslhlsngsqrvlvsapckgvkkTIVYGVNhqslnkedkvvsnascttnclvPVVHVLDKMFGIEKGYMTTvhsytgdqhvldaghsDLYRSRAAAISMVPTSTGAAKAVELVLpnlkgkldgssirvptpnvsmvdlkcvtsrdvniDEINATMKYFAEGDLKnilgyvtlplvsvdfnhtsyssifaadqtKVVSQNLLRVLVWYDNEWGFSNRMLDTASAMANLS
mvckvaingfgrigrcilraavesrrddvRIVAINDLNSIETMAHLLRYDSVHGRFPGEVKIIGDTIDVGLGPIQVTSIRDPQDLPWGDVDVAMECTGFFVTQEKASLHLSNGSQRVLVSAPCKGVKKTIVYGVNHQSLNKEDKVVSNASCTTNCLVPVVHVLDKMFGIEKGYMTTVHSYTGDQHVLDAGHSDLYRSRAAAISMVPTSTGAAKAVELVLPNLkgkldgssirvptpnvsmvdlkcvtsrdvniDEINATMKYFAEGDLKNILGYVTLPLVSVDFNHTSYSSIFAADQTKVVSQNLLRVLVWYDNEWGFSNRMLDTASAMANLS
MVCKVAINGFGRIGRCILRAAVESRRDDVRIVAINDLNSIETMAHLLRYDSVHGRFPGEVKIIGDTIDVGLGPIQVTSIRDPQDLPWGDVDVAMECTGFFVTQEKASLHLSNGSQRVLVSAPCKGVKKTIVYGVNHQSLNKEDKVVSNASCTTNCLVPVVHVLDKMFGIEKGYMTTVHSYTGDQHVLDAGHSDLYRSRAAAISMVPTSTGAAKAVELVLPNLKGKLDGSSIRVPTPNVSMVDLKCVTSRDVNIDEINATMKYFAEGDLKNILGYVTLPLVSVDFNHTSYSSIFAADQTKVVSQNLLRVLVWYDNEWGFSNRMLDTASAMANLS
MVCKVAINGFGRIGRCILRAAVESRRDDVRIVAINDLNSIETMAHLLRYDSVHGRFPGEVKIIGDTIDVGLGPIQVTSIRDPQDLPWGDVDVAMECTGFFVTQEKASLHLSNGSQRVLVSAPCKGVKKTIVYGVNHQSLNKEDKVVSNASCTTNCLVPVVHVLDKMFGIEKGYMTTVHSYTGDQHVLDAGHSDLYRSRAAAISMVPTSTGAAKAVELVLPNLKGKLDGSSIRVPTPNVSMVDLKCVTSRDVNIDEINATMKYFAEGDLKNILGYVTLPLVSVDFNHTSYSSIFAADQTKVVSQNLLRVLVWYDNEWGFSNRMLDTASAMANLS
MVCKVAINGFGRIGRCILRAAVESRRDDVRIVAINDLNSIETMAHLLRYDSVHGRFPGEVKIIGDTIDVGLGPIQVTSIRDPQDLPWGDVDVAMECTGFFVTQEKASLHLSNGSQRVLVSAPCKGVKKTIVYGVNHQSLNKEDKVVSNASCTTNCLVPVVHVLDKMFGIEKGYMTTVHSYTGDQHVLDAGHSDLYRSRAAAISMVPTSTGAAKAVELVLPNLKGKLDGSSIRVPTPNVSMVDLKCVTSRDVNIDEINATMKYFAEGDLKNILGYVTLPLVSVDFNHTSYSSIFAADQTKVVSQNLLRVLVWYDNEWGFSNRMLDTASAMANLS
MVCKVAINGFGRIGRCILRAAVESRRDDVRIVAINDLNSIETMAHLLRYDSVHGRFPGEVKIIGDTIDVGLGPIQVTSIRDPQDLPWGDVDVAMECTGFFVTQEKASLHLSNGSQRVLVSAPCKGVKKTIVYGVNHQSLNKEDKVVSNASCTTNCLVPVVHVLDKMFGIEKGYMTTVHSYTGDQHVLDAGHSDLYRSRAAAISMVPTSTGAAKAVELVLPNLKGKLDGSSIRVPTPNVSMVDLKCVTSRDVNIDEINATMKYFAEGDLKNILGYVTLPLVSVDFNHTSYSSIFAADQTKVVSQNLLRVLVWYDNEWGFSNRMLDTASAMANLS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVCKVAINGFGRIGRCILRAAVESRRDDVRIVAINDLNSIETMAHLLRYDSVHGRFPGEVKIIGDTIDVGLGPIQVTSIRDPQDLPWGDVDVAMECTGFFVTQEKASLHLSNGSQRVLVSAPCKGVKKTIVYGVNHQSLNKEDKVVSNASCTTNCLVPVVHVLDKMFGIEKGYMTTVHSYTGDQHVLDAGHSDLYRSRAAAISMVPTSTGAAKAVELVLPNLKGKLDGSSIRVPTPNVSMVDLKCVTSRDVNIDEINATMKYFAEGDLKNILGYVTLPLVSVDFNHTSYSSIFAADQTKVVSQNLLRVLVWYDNEWGFSNRMLDTASAMANLS
MVCKVAINGFGRIGRCILRAAVESRRDDVRIVAINDLNSIETMAHLLRYDSVHGRFPGEVKIIGDTIDVGLGPIQVTSIRDPQDLPWGDVDVAMECTGFFVTQEKASLHLSNGSQRVLVSAPCKGVKKTIVYGVNHQSLNKEDKVVSNASCTTNCLVPVVHVLDKMFGIEKGYMTTVHSYTGDQHVLDAGHSDLYRSRAAAISMVPTSTGAAKAVELVLPNLKGKLDGSSIRVPTPNVSMVDLKCVTSRDVNIDEINATMKYFAEGDLKNILGYVTLPLVSVDFNHTSYSSIFAADQTKVVSQNLLRVLVWYDNEWGFSNRMLDTASAMANLS
MVCKVAINGFGRIGRCILRAAVESRRDDVRIVAINDLNSIETMAHLLRYDSVHGRFPGEVKIIGDTIDVGLGPIQVTSIRDPQDLPWGDVDVAMECTGFFVTQEKASLHLSNGSQRVLVSAPCKGVKKTIVYGVNHQSLNKEDKVVSNASCTTNCLVPVVHVLDKMFGIEKGYMTTVHSYTGDQHVLDAGHSDLYRSRAAAISMVPTSTGAAKAVELVLPNLKGKLDGSSIRVPTPNVSMVDLKCVTSRDVNIDEINATMKYFAEGDLKNILGYVTLPLVSVDFNHTSYSSIFAADQTKVVSQNLLRVLVWYDNEWGFSNRMLDTASAMANLS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target333 Glyceraldehyde 3-Phosphate Dehydrogenase [Candidatus Li
315122160333 Glyceraldehyde 3-Phosphate Dehydrogenase [Candidatus Li 1 1e-169
254473118335 glyceraldehyde-3-phosphate dehydrogenase, type I [Pseud 1 1e-133
222149675335 Glyceraldehyde 3-Phosphate Dehydrogenase [Agrobacterium 1 1e-132
307944526336 glyceraldehyde-3-phosphate dehydrogenase, type I [Rosei 1 1e-132
118588344336 glyceraldehyde-3-phosphate dehydrogenase [Stappia aggre 1 1e-130
114763384333 glyceraldehyde-3-phosphate dehydrogenase [Pelagibaca be 1 1e-129
119387170333 glyceraldehyde-3-phosphate dehydrogenase, type I [Parac 1 1e-129
310816555333 glyceraldehyde-3-phosphate dehydrogenase, type I [Ketog 1 1e-129
146277430333 glyceraldehyde-3-phosphate dehydrogenase, type I [Rhodo 1 1e-129
146280019333 hypothetical protein Rsph17025_4018 [Rhodobacter sphaer 1 1e-128
>gi|315122160|ref|YP_004062649.1| Glyceraldehyde 3-Phosphate Dehydrogenase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 333 Back     alignment and organism information
 Score =  599 bits (1545), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 279/332 (84%), Positives = 309/332 (93%)

Query: 1   MVCKVAINGFGRIGRCILRAAVESRRDDVRIVAINDLNSIETMAHLLRYDSVHGRFPGEV 60
           MV KV+INGFGRIGRC+LR+AVES RDD+RIVAINDLNSIET+AHL RYDSVHGRFPGEV
Sbjct: 1   MVSKVSINGFGRIGRCVLRSAVESGRDDIRIVAINDLNSIETIAHLFRYDSVHGRFPGEV 60

Query: 61  KIIGDTIDVGLGPIQVTSIRDPQDLPWGDVDVAMECTGFFVTQEKASLHLSNGSQRVLVS 120
           KI GDTIDVG G I+VTSIRDPQ+LPW DVD+AMECTGFF T+EKASLHLSNGS+RVLVS
Sbjct: 61  KISGDTIDVGFGAIKVTSIRDPQNLPWNDVDIAMECTGFFTTKEKASLHLSNGSKRVLVS 120

Query: 121 APCKGVKKTIVYGVNHQSLNKEDKVVSNASCTTNCLVPVVHVLDKMFGIEKGYMTTVHSY 180
           APCKG  KTIVYG+NH SLN+ D ++SNASCTTNCLVP+V+VLDKMFGIEKGYMTTVHSY
Sbjct: 121 APCKGADKTIVYGINHTSLNERDVIISNASCTTNCLVPIVYVLDKMFGIEKGYMTTVHSY 180

Query: 181 TGDQHVLDAGHSDLYRSRAAAISMVPTSTGAAKAVELVLPNLKGKLDGSSIRVPTPNVSM 240
           TGDQH+LDAGH D YRSRAAAISM+PTSTGAAK+VELVLP+LKGKLDGSS+RVPTPNVSM
Sbjct: 181 TGDQHILDAGHDDPYRSRAAAISMIPTSTGAAKSVELVLPHLKGKLDGSSVRVPTPNVSM 240

Query: 241 VDLKCVTSRDVNIDEINATMKYFAEGDLKNILGYVTLPLVSVDFNHTSYSSIFAADQTKV 300
           VDLKCVTSR+VN+DEINA M+ FAEGD+KNIL YV LPLVS+DFNH +YSSIFAADQTKV
Sbjct: 241 VDLKCVTSRNVNVDEINAAMRDFAEGDMKNILDYVALPLVSIDFNHNAYSSIFAADQTKV 300

Query: 301 VSQNLLRVLVWYDNEWGFSNRMLDTASAMANL 332
           V+ NL+RVL WYDNEWGFSNRMLDTASA+A L
Sbjct: 301 VANNLVRVLAWYDNEWGFSNRMLDTASAIAKL 332


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254473118|ref|ZP_05086516.1| glyceraldehyde-3-phosphate dehydrogenase, type I [Pseudovibrio sp. JE062] Length = 335 Back     alignment and organism information
>gi|222149675|ref|YP_002550632.1| Glyceraldehyde 3-Phosphate Dehydrogenase [Agrobacterium vitis S4] Length = 335 Back     alignment and organism information
>gi|307944526|ref|ZP_07659866.1| glyceraldehyde-3-phosphate dehydrogenase, type I [Roseibium sp. TrichSKD4] Length = 336 Back     alignment and organism information
>gi|118588344|ref|ZP_01545753.1| glyceraldehyde-3-phosphate dehydrogenase [Stappia aggregata IAM 12614] Length = 336 Back     alignment and organism information
>gi|114763384|ref|ZP_01442791.1| glyceraldehyde-3-phosphate dehydrogenase [Pelagibaca bermudensis HTCC2601] Length = 333 Back     alignment and organism information
>gi|119387170|ref|YP_918225.1| glyceraldehyde-3-phosphate dehydrogenase, type I [Paracoccus denitrificans PD1222] Length = 333 Back     alignment and organism information
>gi|310816555|ref|YP_003964519.1| glyceraldehyde-3-phosphate dehydrogenase, type I [Ketogulonicigenium vulgare Y25] Length = 333 Back     alignment and organism information
>gi|146277430|ref|YP_001167589.1| glyceraldehyde-3-phosphate dehydrogenase, type I [Rhodobacter sphaeroides ATCC 17025] Length = 333 Back     alignment and organism information
>gi|146280019|ref|YP_001170176.1| hypothetical protein Rsph17025_4018 [Rhodobacter sphaeroides ATCC 17025] Length = 333 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target333 Glyceraldehyde 3-Phosphate Dehydrogenase [Candidatus Li
TIGR01534327 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate dehydrog 1e-129
PRK07729343 PRK07729, PRK07729, glyceraldehyde-3-phosphate dehydrog 1e-109
PRK13535336 PRK13535, PRK13535, erythrose 4-phosphate dehydrogenase 1e-106
PLN03096395 PLN03096, PLN03096, glyceraldehyde-3-phosphate dehydrog 1e-100
TIGR01532325 TIGR01532, E4PD_g-proteo, D-erythrose-4-phosphate dehyd 1e-99
PRK07403337 PRK07403, PRK07403, glyceraldehyde-3-phosphate dehydrog 2e-95
PLN02237442 PLN02237, PLN02237, glyceraldehyde-3-phosphate dehydrog 4e-94
PTZ00023337 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate dehydrog 2e-93
PLN02272421 PLN02272, PLN02272, glyceraldehyde-3-phosphate dehydrog 1e-87
PRK08955334 PRK08955, PRK08955, glyceraldehyde-3-phosphate dehydrog 6e-85
PTZ00434361 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-phosphat 1e-77
PRK15425331 PRK15425, gapA, glyceraldehyde-3-phosphate dehydrogenas 5e-76
PRK08289477 PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrog 3e-72
PLN02358338 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrog 4e-72
KOG0657285 KOG0657, KOG0657, KOG0657, Glyceraldehyde 3-phosphate d 2e-60
PTZ00353342 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-phospha 2e-29
COG0057335 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase 1e-124
smart00846149 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate dehydro 6e-61
pfam00044150 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrog 6e-57
pfam02800158 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate dehydrog 1e-60
TIGR00978341 TIGR00978, asd_EA, aspartate-semialdehyde dehydrogenase 4e-05
>gnl|CDD|162405 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>gnl|CDD|181094 PRK07729, PRK07729, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|184122 PRK13535, PRK13535, erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|178644 PLN03096, PLN03096, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|130595 TIGR01532, E4PD_g-proteo, D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|180962 PRK07403, PRK07403, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|177881 PLN02237, PLN02237, glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>gnl|CDD|173322 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|177912 PLN02272, PLN02272, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|169599 PRK08955, PRK08955, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|185614 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|185323 PRK15425, gapA, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|181355 PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|165999 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|35876 KOG0657, KOG0657, KOG0657, Glyceraldehyde 3-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|173546 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|30406 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|129079 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|109113 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|145777 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|162144 TIGR00978, asd_EA, aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 333 Glyceraldehyde 3-Phosphate Dehydrogenase [Candidatus Li
TIGR01534366 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type 100.0
PRK07729343 glyceraldehyde-3-phosphate dehydrogenase; Validated 100.0
PTZ00023337 glyceraldehyde-3-phosphate dehydrogenase; Provisional 100.0
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 100.0
PRK07403337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
PRK08955333 glyceraldehyde-3-phosphate dehydrogenase; Validated 100.0
PRK08289479 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
COG0057335 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose 100.0
TIGR01532334 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase; In 100.0
KOG0657285 consensus 100.0
PRK08040337 putative semialdehyde dehydrogenase; Provisional 99.75
PRK06598348 aspartate-semialdehyde dehydrogenase; Reviewed 99.75
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 99.74
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 99.73
PRK06901323 aspartate-semialdehyde dehydrogenase; Provisional 99.7
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino acid tr 99.69
PRK08664350 aspartate-semialdehyde dehydrogenase; Reviewed 99.39
PRK00436345 argC N-acetyl-gamma-glutamyl-phosphate reductase; Valid 99.3
PRK11863314 N-acetyl-gamma-glutamyl-phosphate reductase; Provisiona 98.35
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino 98.21
pfam02800158 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-ter 100.0
pfam00044150 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD b 100.0
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD b 100.0
PRK08374316 homoserine dehydrogenase; Provisional 97.52
pfam01118121 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 96.42
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 95.04
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 94.61
CHL00194319 ycf39 Ycf39; Provisional 93.96
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 93.05
COG2344211 AT-rich DNA-binding protein [General function predictio 90.67
PRK04207338 glyceraldehyde-3-phosphate dehydrogenase; Provisional 100.0
TIGR01296350 asd_B aspartate-semialdehyde dehydrogenase; InterPro: I 99.5
TIGR01546335 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenas 98.45
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating). 97.3
PRK08300298 acetaldehyde dehydrogenase; Validated 97.06
KOG4777361 consensus 96.23
TIGR01850361 argC N-acetyl-gamma-glutamyl-phosphate reductase; Inter 95.49
KOG2741351 consensus 92.96
TIGR00978358 asd_EA aspartate-semialdehyde dehydrogenase; InterPro: 99.04
TIGR01921326 DAP-DH diaminopimelate dehydrogenase; InterPro: IPR0101 97.77
PRK00048265 dihydrodipicolinate reductase; Provisional 98.04
PRK13301267 putative L-aspartate dehydrogenase; Provisional 97.93
PRK13303265 L-aspartate dehydrogenase; Provisional 97.92
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.78
PRK06270342 homoserine dehydrogenase; Provisional 97.52
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid transpor 97.41
COG1712255 Predicted dinucleotide-utilizing enzyme [General functi 97.02
PRK06392326 homoserine dehydrogenase; Provisional 96.47
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.97
pfam01113122 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihyd 97.31
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transport and 97.29
pfam03447116 NAD_binding_3 Homoserine dehydrogenase, NAD binding dom 97.08
PRK10206345 putative dehydrogenase; Provisional 96.74
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 96.44
PRK06349 432 homoserine dehydrogenase; Provisional 96.36
PRK11579346 putative oxidoreductase; Provisional 95.99
PTZ00079469 NADP-specific glutamate dehydrogenase; Provisional 95.84
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate de 95.6
COG4091438 Predicted homoserine dehydrogenase [Amino acid transpor 95.56
COG0673342 MviM Predicted dehydrogenases and related proteins [Gen 94.86
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of gluta 93.82
pfam03435384 Saccharop_dh Saccharopine dehydrogenase. This family co 93.23
cd01483143 E1_enzyme_family Superfamily of activating enzymes (E1) 91.53
TIGR00036281 dapB dihydrodipicolinate reductase; InterPro: IPR011770 95.99
PRK09414446 glutamate dehydrogenase; Provisional 95.51
PRK06813341 homoserine dehydrogenase; Validated 95.09
PRK13243333 glyoxylate reductase; Reviewed 94.91
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 94.23
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 93.9
PRK12480330 D-lactate dehydrogenase; Provisional 93.64
PRK13581524 D-3-phosphoglycerate dehydrogenase; Provisional 93.61
PRK06436303 glycerate dehydrogenase; Provisional 93.5
COG3804350 Uncharacterized conserved protein related to dihydrodip 93.34
PRK02472 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.09
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.81
COG1052324 LdhA Lactate dehydrogenase and related dehydrogenases [ 92.75
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 92.63
COG0111324 SerA Phosphoglycerate dehydrogenase and related dehydro 92.24
PRK08605332 D-lactate dehydrogenase; Validated 92.02
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.83
PRK09496 455 trkA potassium transporter peripheral membrane componen 90.78
PRK08507275 prephenate dehydrogenase; Validated 90.69
PRK01368 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.45
PRK03815401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.37
PRK03369 487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.12
pfam02774167 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerizatio 94.59
PRK07574385 formate dehydrogenase; Provisional 94.48
PRK06487317 glycerate dehydrogenase; Provisional 93.47
PRK06932314 glycerate dehydrogenase; Provisional 92.54
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 91.34
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I; InterPro: IPR006424 This group of sequences represent glyceraldehyde-3-phosphate dehydrogenase (GAPDH), the enzyme responsible for the interconversion of 1,3-diphosphoglycerate and glyceraldehyde-3-phosphate, a central step in glycolysis and gluconeogenesis Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase; InterPro: IPR006422 This group of sequences represent the small clade of dehydrogenases in gamma-proteobacteria which utilise NAD+ to oxidize erythrose-4-phosphate (E4P) to 4-phospho-erythronate, a precursor for the de novo synthesis of pyridoxine via 4-hydroxythreonine and D-1-deoxyxylulose Back     alignment and domain information
>KOG0657 consensus Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain Back     alignment and domain information
>pfam00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>pfam01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase; InterPro: IPR005986 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II; InterPro: IPR006436 This family describes the type II glyceraldehyde-3-phosphate dehydrogenases which are limited to archaea Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>KOG4777 consensus Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase; InterPro: IPR000706 N -Acetylglutamate (NAG) fulfils distinct biological roles in lower and higher organisms Back     alignment and domain information
>KOG2741 consensus Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase; InterPro: IPR005676 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase; InterPro: IPR010190 This entry represents the diaminopimelate dehydrogenase enzyme which provides an alternate (shortcut) route of lysine biosynthesis in Corynebacterium, Bacterioides, Porphyromonas and other species Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>pfam01113 DapB_N Dihydrodipicolinate reductase, N-terminus Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK10206 putative dehydrogenase; Provisional Back     alignment and domain information
>pfam01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>pfam03435 Saccharop_dh Saccharopine dehydrogenase Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase; InterPro: IPR011770 Dihydrodipicolinate reductase is an enzyme found in bacteria and higher plants which is involved in the biosynthesis of diaminopimelic acid, a component of bacterial cell walls, and the essential amino acid L-lysine Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>pfam02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>pfam02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerization domain Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target333 Glyceraldehyde 3-Phosphate Dehydrogenase [Candidatus Li
3doc_A335 Crystal Structure Of Trka Glyceraldehyde-3-Phosphat 6e-88
1gd1_O334 Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydr 9e-87
1npt_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 1e-86
1nq5_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 1e-86
3l0d_A356 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 2e-86
3dbv_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 1e-85
1dbv_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 2e-85
1hdg_O332 The Crystal Structure Of Holo-Glyceraldehyde-3-Phos 4e-85
1s7c_A331 Crystal Structure Of Mes Buffer Bound Form Of Glyce 1e-84
2vyn_A331 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 2e-84
1gad_O330 Comparison Of The Structures Of Wild Type And A N31 1e-83
1u8f_O335 Crystal Structure Of Human Placental Glyceraldehyde 1e-83
1znq_O338 Crsytal Structure Of Human Liver Gapdh Length = 338 2e-83
1j0x_O332 Crystal Structure Of The Rabbit Muscle Glyceraldehy 7e-83
3gnq_A344 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 3e-82
1ywg_O337 The Structure Of Glyceraldehyde-3-Phosphate Dehydro 3e-82
2b4r_O345 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 4e-82
1gae_O330 Comparison Of The Structures Of Wild Type And A N31 4e-82
2vyn_D334 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 4e-80
3gpd_R334 Twinning In Crystals Of Human Skeletal Muscle D- Gl 7e-80
3e6a_O336 Crystal Structure And Functional Analysis Of Glycer 1e-79
3e5r_O337 Crystal Structure And Functional Analysis Of Glycer 2e-79
3chz_B359 Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate 3e-79
2ep7_A342 Structural Study Of Project Id Aq_1065 From Aquifex 3e-79
1szj_G333 Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydr 5e-79
1dss_G333 Structure Of Active-Site Carboxymethylated D-Glycer 7e-79
3h9e_B346 Crystal Structure Of Human Sperm-Specific Glycerald 9e-79
1obf_O335 The Crystal Structure Of Glyceraldehyde 3-Phosphate 3e-78
3cif_A359 Crystal Structure Of C153s Mutant Glyceraldehyde 3- 3e-78
1ihx_A333 Crystal Structure Of Two D-Glyceraldehyde-3-Phospha 4e-78
4gpd_1333 The Structure Of Lobster Apo-D-Glyceraldehyde-3-Pho 4e-78
3cps_A354 Crystal Structure Of Cryptosporidium Parvum Glycera 5e-78
2d2i_A380 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 8e-78
2i5p_O342 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 9e-78
1dc4_A330 Structural Analysis Of Glyceraldehyde 3-Phosphate D 1e-77
3hja_A356 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 5e-76
2x5j_O339 Crystal Structure Of The Apoform Of The D-Erythrose 7e-75
1vc2_A331 Crystal Structure Of Glyceraldehyde 3-Phosphate Deh 4e-74
2x5k_O339 Structure Of An Active Site Mutant Of The D-Erythro 4e-74
1cer_O331 Determinants Of Enzyme Thermostability Observed In 2e-73
2g82_O331 High Resolution Structures Of Thermus Aquaticus Gly 4e-73
2pkr_O365 Crystal Structure Of (A+cte)4 Chimeric Form Of Phot 2e-72
1rm5_O337 Crystal Structure Of Mutant S188a Of Photosynthetic 9e-72
1nbo_O337 The Dual Coenzyme Specificity Of Photosynthetic Gly 9e-72
1jn0_O335 Crystal Structure Of The Non-Regulatory A4 Isoform 1e-71
1rm3_O337 Crystal Structure Of Mutant T33a Of Photosynthetic 1e-71
3k2b_A337 Crystal Structure Of Photosynthetic A4 Isoform Glyc 3e-71
3lvf_P338 Crystal Structure Of Holo Glyceraldehyde-3-Phosphat 1e-69
3lc7_O339 Crystal Structure Of Apo Glyceraldehyde-3-Phosphate 1e-69
3k73_Q336 Crystal Structure Of Phosphate Bound Holo Glycerald 1e-69
3k9q_Q336 Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 2e-69
3hq4_R336 Crystal Structure Of C151s Mutant Of Glyceraldehyde 2e-69
1k3t_A359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 3e-69
3dmt_C359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 4e-69
3lc1_P336 Crystal Structure Of H178n Mutant Of Glyceraldehyde 1e-68
2x0n_A359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 2e-68
3ksd_Q336 Crystal Structure Of C151s+h178n Mutant Of Glyceral 3e-68
2pkq_O368 Crystal Structure Of The Photosynthetic A2b2-Glycer 4e-68
1gga_P358 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 2e-67
1gyp_A358 Crystal Structure Of Glycosomal Glyceraldehyde-3-Ph 2e-65
1a7k_A360 Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase 3e-65
gi|194709261|pdb|3DOC|A Chain A, Crystal Structure Of Trka Glyceraldehyde-3-Phosphate Dehydrogenase From Brucella Melitensis Length = 335 Back     alignment and structure
 Score =  328 bits (841), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 209/334 (62%), Positives = 259/334 (77%), Gaps = 2/334 (0%)

Query: 1   MVCKVAINGFGRIGRCILRAAVESRRDDVRIVAINDLNSIETMAHLLRYDSVHGRFPGEV 60
           M  +VAINGFGRIGR ILRA VES R D+++VAINDL  +ET AHLLRYDSVHGRFP EV
Sbjct: 1   MAVRVAINGFGRIGRNILRAIVESGRTDIQVVAINDLGPVETNAHLLRYDSVHGRFPKEV 60

Query: 61  KIIGDTIDVGLGPIQVTSIRDPQDLPWGDVD--VAMECTGFFVTQEKASLHLSNGSQRVL 118
           ++ GDTIDVG GPI+V ++R+P +LPW + +  +A+ECTG F +++KA+LHL  G++RV+
Sbjct: 61  EVAGDTIDVGYGPIKVHAVRNPAELPWKEENVDIALECTGIFTSRDKAALHLEAGAKRVI 120

Query: 119 VSAPCKGVKKTIVYGVNHQSLNKEDKVVSNASCTTNCLVPVVHVLDKMFGIEKGYMTTVH 178
           VSAP  G   T+VYGVN+  L K+  V+SNASCTTNCL PV  VL+   GIEKG+MTT+H
Sbjct: 121 VSAPADGADLTVVYGVNNDKLTKDHLVISNASCTTNCLAPVAQVLNDTIGIEKGFMTTIH 180

Query: 179 SYTGDQHVLDAGHSDLYRSRAAAISMVPTSTGAAKAVELVLPNLKGKLDGSSIRVPTPNV 238
           SYTGDQ  LD  H DLYR+RAAA+SM+PTSTGAAKAV LVLP LKGKLDG +IRVPTPNV
Sbjct: 181 SYTGDQPTLDTMHKDLYRARAAALSMIPTSTGAAKAVGLVLPELKGKLDGVAIRVPTPNV 240

Query: 239 SMVDLKCVTSRDVNIDEINATMKYFAEGDLKNILGYVTLPLVSVDFNHTSYSSIFAADQT 298
           S+VDL  +  R+  ++E+N  ++  A G LK ILGY    LVS DFNH S+SS+F  DQT
Sbjct: 241 SVVDLTFIAKRETTVEEVNNAIREAANGRLKGILGYTDEKLVSHDFNHDSHSSVFHTDQT 300

Query: 299 KVVSQNLLRVLVWYDNEWGFSNRMLDTASAMANL 332
           KV+   ++R+L WYDNEWGFS+RM DTA A+  L
Sbjct: 301 KVMDGTMVRILSWYDNEWGFSSRMSDTAVALGKL 334


>gi|229937|pdb|1GD1|O Chain O, Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Stearothermophilus At 1.8 Angstroms Resolution Length = 334 Back     alignment and structure
>gi|30749671|pdb|1NPT|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ala Complexed With Nad+ Length = 334 Back     alignment and structure
>gi|30749680|pdb|1NQ5|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>gi|282403752|pdb|3L0D|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Bartonella Henselae With Bound Nad Length = 356 Back     alignment and structure
>gi|2392744|pdb|3DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Leu 33 Replaced By Thr, Thr 34 Replaced By Gly, Asp 36 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>gi|2392251|pdb|1DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Asp 32 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>gi|999601|pdb|1HDG|O Chain O, The Crystal Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydrogenase From The Hyperthermophilic Bacterium Thermotoga Maritima At 2.5 Angstroms Resolution Length = 332 Back     alignment and structure
gi|52695438|pdb|1S7C|A Chain A, Crystal Structure Of Mes Buffer Bound Form Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli Length = 331 Back     alignment and structure
>gi|195927352|pdb|2VYN|A Chain A, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 331 Back     alignment and structure
>gi|1421424|pdb|1GAD|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
gi|75765281|pdb|1U8F|O Chain O, Crystal Structure Of Human Placental Glyceraldehyde-3- Phosphate Dehydrogenase At 1.75 Resolution Length = 335 Back     alignment and structure
>gi|67464043|pdb|1ZNQ|O Chain O, Crsytal Structure Of Human Liver Gapdh Length = 338 Back     alignment and structure
>gi|40889050|pdb|1J0X|O Chain O, Crystal Structure Of The Rabbit Muscle Glyceraldehyde-3- Phosphate Dehydrogenase (Gapdh) Length = 332 Back     alignment and structure
>gi|225734331|pdb|3GNQ|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase, Type I From Burkholderia Pseudomallei Length = 344 Back     alignment and structure
gi|83753748|pdb|1YWG|O Chain O, The Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum Length = 337 Back     alignment and structure
>gi|78101580|pdb|2B4R|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum At 2.25 Angstrom Resolution Reveals Intriguing Extra Electron Density In The Active Site Length = 345 Back     alignment and structure
>gi|1421428|pdb|1GAE|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>gi|195927355|pdb|2VYN|D Chain D, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 334 Back     alignment and structure
>gi|230867|pdb|3GPD|R Chain R, Twinning In Crystals Of Human Skeletal Muscle D- Glyceraldehyde-3-Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>gi|256032543|pdb|3E6A|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 336 Back     alignment and structure
gi|256032539|pdb|3E5R|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 337 Back     alignment and structure
gi|158428609|pdb|2EP7|A Chain A, Structural Study Of Project Id Aq_1065 From Aquifex Aeolicus Vf5 Length = 342 Back     alignment and structure
gi|3660271|pdb|1SZJ|G Chain G, Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydrogenase From Palinurus Versicolor Refined 2.0 Angstrom Resolution Length = 333 Back     alignment and structure
>gi|4139713|pdb|1DSS|G Chain G, Structure Of Active-Site Carboxymethylated D-Glyceraldehyde- 3-Phosphate Dehydrogenase From Palinurus Versicolor Length = 333 Back     alignment and structure
>gi|33357648|pdb|1OBF|O Chain O, The Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Alcaligenes Xylosoxidans At 1.7 Resolution. Length = 335 Back     alignment and structure
>gi|225734025|pdb|3CIF|A Chain A, Crystal Structure Of C153s Mutant Glyceraldehyde 3- Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>gi|22218774|pdb|1IHX|A Chain A, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry Length = 333 Back     alignment and structure
gi|231017|pdb|4GPD|1 Chain 1, The Structure Of Lobster Apo-D-Glyceraldehyde-3-Phosphate Dehydrogenase At 3.0 Angstroms Resolution Length = 333 Back     alignment and structure
>gi|183448392|pdb|3CPS|A Chain A, Crystal Structure Of Cryptosporidium Parvum Glyceraldehyde- 3-Phosphate Dehydrogenase Length = 354 Back     alignment and structure
>gi|112490271|pdb|2D2I|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3- Phosphate Dehydrogenase From Synechococcus Sp. Complexed With Nadp+ Length = 380 Back     alignment and structure
>gi|116668007|pdb|2I5P|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Isoform 1 From K. Marxianus Length = 342 Back     alignment and structure
>gi|10120773|pdb|1DC4|A Chain A, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes Length = 330 Back     alignment and structure
>gi|238828321|pdb|3HJA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Borrelia Burgdorferi Length = 356 Back     alignment and structure
gi|323462760|pdb|2X5J|O Chain O, Crystal Structure Of The Apoform Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure
>gi|47169440|pdb|1VC2|A Chain A, Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Thermus Thermophilus Hb8 Length = 331 Back     alignment and structure
>gi|323462764|pdb|2X5K|O Chain O, Structure Of An Active Site Mutant Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure
gi|1421448|pdb|1CER|O Chain O, Determinants Of Enzyme Thermostability Observed In The Molecular Structure Of Thermus Aquaticus D-Glyceraldehyde- 3-Phosphate Dehydrogenase At 2.5 Angstroms Resolution Length = 331 Back     alignment and structure
>gi|145579325|pdb|2G82|O Chain O, High Resolution Structures Of Thermus Aquaticus Glyceraldehyde-3-Phosphate Dehydrogenase: Role Of 220's Loop Motion In Catalysis Length = 331 Back     alignment and structure
>gi|150261397|pdb|2PKR|O Chain O, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp Length = 365 Back     alignment and structure
>gi|51247300|pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic Glyceraldehyde-3-Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>gi|31615655|pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3-Phosphate Dehydrogenase Interpreted By The Crystal Structure Of A4 Isoform Complexed With Nad Length = 337 Back     alignment and structure
>gi|17942958|pdb|1JN0|O Chain O, Crystal Structure Of The Non-Regulatory A4 Isoform Of Spinach Chloroplast Glyceraldehyde-3-Phosphate Dehydrogenase Complexed With Nadp Length = 335 Back     alignment and structure
>gi|51247294|pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3-Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>gi|297787615|pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyd Phosphate Dehydrogenase Complexed With Nad, From Arabidopsi Length = 337 Back     alignment and structure
>gi|303324960|pdb|3LVF|P Chain P, Crystal Structure Of Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicillin Resistant Staphylococcus Aureus Mrsa252 At 1.7 Angstrom Resolution Length = 338 Back     alignment and structure
>gi|303324950|pdb|3LC7|O Chain O, Crystal Structure Of Apo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicllin Resistant Staphylococcus Aureus (Mrsa252) Length = 339 Back     alignment and structure
gi|303324903|pdb|3K73|Q Chain Q, Crystal Structure Of Phosphate Bound Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 From Mrsa252 At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>gi|303324907|pdb|3K9Q|Q Chain Q, Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 3-Phosphate Dehydrogenase 1 From Methicillin Resistant Staphylococcus Aureus (Mrsa252) At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>gi|299688948|pdb|3HQ4|R Chain R, Crystal Structure Of C151s Mutant Of Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) Complexed With Nad From Staphylococcus Aureus Mrsa252 At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
gi|21730414|pdb|1K3T|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi Complexed With Chalepin, A Coumarin Derivative Inhibitor Length = 359 Back     alignment and structure
>gi|209870465|pdb|3DMT|C Chain C, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi In Complex With The Irreversible Iodoacetate Inhibitor Length = 359 Back     alignment and structure
>gi|303324942|pdb|3LC1|P Chain P, Crystal Structure Of H178n Mutant Of Glyceraldehyde-3-Phosphate- Dehydrogenase 1 (Gapdh 1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.0 Angstrom Resolution. Length = 336 Back     alignment and structure
gi|284449407|pdb|2X0N|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Brucei Determined From Laue Data Length = 359 Back     alignment and structure
>gi|303324920|pdb|3KSD|Q Chain Q, Crystal Structure Of C151s+h178n Mutant Of Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>gi|150261391|pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-Glyceraldehyde- 3-Phosphate Dehydrogenase, Complexed With Nadp Length = 368 Back     alignment and structure
>gi|1311019|pdb|1GYP|A Chain A, Crystal Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Leishmania Mexicana: Implications For Structure-Based Drug Design And A New Position For The Inorganic Phosphate Binding Site Length = 358 Back     alignment and structure
>gi|3318907|pdb|1A7K|A Chain A, Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase In A Monoclinic Crystal Form Length = 360 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target333 Glyceraldehyde 3-Phosphate Dehydrogenase [Candidatus Li
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; micros 1e-127
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; 1e-126
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; ox 1e-124
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pa 1e-122
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol 1e-121
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycos 1e-120
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, struc 1e-120
2i5p_O342 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; ro 1e-119
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycol 1e-117
2d2i_A380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold 1e-114
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 1e-114
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fo 1e-113
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidor 1e-113
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structu 1e-112
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, 1e-111
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreduct 1e-109
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, 1e-104
3h9e_A346 Glyceraldehyde-3-phosphate dehydrogenase, testis- speci 2e-99
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyd 1e-71
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase); arc 6e-66
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, N 6e-65
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase); oxy 9e-60
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural genomic 7e-04
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Length = 334 Back     alignment and structure
 Score =  451 bits (1161), Expect = e-127
 Identities = 171/331 (51%), Positives = 229/331 (69%), Gaps = 5/331 (1%)

Query: 4   KVAINGFGRIGRCILRAAVESRRDDVRIVAINDLNSIETMAHLLRYDSVHGRFPGEVKII 63
           KV INGFGRIGR + RAA++    D+ +VA+NDL    T+AHLL+YDSVHGR   EV + 
Sbjct: 3   KVGINGFGRIGRNVFRAALK--NPDIEVVAVNDLTDANTLAHLLKYDSVHGRLDAEVSVN 60

Query: 64  GDTIDVGLGPIQVTSIRDPQDLPWG--DVDVAMECTGFFVTQEKASLHLSNGSQRVLVSA 121
           G+ + V    I V + RDP++L WG   VD+ +E TG F  +E A+ HL  G+++V++SA
Sbjct: 61  GNNLVVNGKEIIVKAERDPENLAWGEIGVDIVVESTGRFTKREDAAKHLEAGAKKVIISA 120

Query: 122 PCKGVKKTIVYGVNHQSLNK-EDKVVSNASCTTNCLVPVVHVLDKMFGIEKGYMTTVHSY 180
           P K    TIV GVN    +     V+SNASCTTNCL P   VL + FGI +G MTTVHSY
Sbjct: 121 PAKNEDITIVMGVNQDKYDPKAHHVISNASCTTNCLAPFAKVLHEQFGIVRGMMTTVHSY 180

Query: 181 TGDQHVLDAGHSDLYRSRAAAISMVPTSTGAAKAVELVLPNLKGKLDGSSIRVPTPNVSM 240
           T DQ +LD  H DL R+RAAA S++PT+TGAAKAV LVLP LKGKL+G ++RVPTPNVS+
Sbjct: 181 TNDQRILDLPHKDLRRARAAAESIIPTTTGAAKAVALVLPELKGKLNGMAMRVPTPNVSV 240

Query: 241 VDLKCVTSRDVNIDEINATMKYFAEGDLKNILGYVTLPLVSVDFNHTSYSSIFAADQTKV 300
           VDL     ++V ++E+NA +K  AEG+LK IL Y   PLVS D+N ++ SS   A  T V
Sbjct: 241 VDLVAELEKEVTVEEVNAALKAAAEGELKGILAYSEEPLVSRDYNGSTVSSTIDALSTMV 300

Query: 301 VSQNLLRVLVWYDNEWGFSNRMLDTASAMAN 331
           +   +++V+ WYDNE G+S+R++D A+ +A+
Sbjct: 301 IDGKMVKVVSWYDNETGYSHRVVDLAAYIAS 331