254780658

254780658

5-formyltetrahydrofolate cyclo-ligase

GeneID in NCBI database:8209661Locus tag:CLIBASIA_02725
Protein GI in NCBI database:254780658Protein Accession:YP_003065071.1
Gene range:-(614381, 614722)Protein Length:113aa
Gene description:5-formyltetrahydrofolate cyclo-ligase
COG prediction:[H] 5-formyltetrahydrofolate cyclo-ligase
KEGG prediction:5-formyltetrahydrofolate cyclo-ligase; K01934 5-formyltetrahydrofolate cyclo-ligase [EC:6.3.3.2]
SEED prediction:5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2)
Pathway involved in KEGG:One carbon pool by folate [PATH:las00670]
Subsystem involved in SEED:One-carbon metabolism by tetrahydropterines
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
MIFRQYENPTDLVKSAVGTLSPPSYAKEMSPDLILMPLIAFDLKGNRIGYGRGYYDRAIADIRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTESRFSQFSTEHIEKV
cEEEEEcccccEEEccccccccccccccccccEEEEcEEEEcccccEEcccccHHHHHHHHHHccccccEEEEEEcccEEEcccccccccccccEEEccccEEEEccccEEcc
ccEEEcccccccccccccccccccccccccccEEEEEEEEEcccccccccccccHHHHHHHHHHcccccEEEEEEEEcccccccccccccccccEEEccccEEEEcccccccc
mifrqyenptdlvksavgtlsppsyakemspdlilmpliafdlkgnrigygrgyydrAIADIRlegknpylLGIAFDMQETSCIQAEATDIRLHAILtesrfsqfstEHIEKV
mifrqyenptdlvksavgTLSPPSYAKEMSPDLILMPLIAFDLKGNRIGYGRGYYDRAIADIRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILtesrfsqfstehiekv
MIFRQYENPTDLVKSAVGTLSPPSYAKEMSPDLILMPLIAFDLKGNRIGYGRGYYDRAIADIRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTESRFSQFSTEHIEKV
MIFRQYENPTDLVKSAVGTLSPPSYAKEMSPDLILMPLIAFDLKGNRIGYGRGYYDRAIADIRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTESRFSQFSTEHI***
********PTDLVKSAVGTLSPPSYAKEMSPDLILMPLIAFDLKGNRIGYGRGYYDRAIADIRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTESRFS**********
MIFRQYENPTDLVKSAVGTLSPPSYAKEMSPDLILMPLIAFDLKGNRIGYGRGYYDRAIADIRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTESRFSQFSTE*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFRQYENPTDLVKSAVGTLSPPSYAKEMSPDLILMPLIAFDLKGNRIGYGRGYYDRAIADIRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTESRFSQFSTEHIEKV
MIFRQYENPTDLVKSAVGTLSPPSYAKEMSPDLILMPLIAFDLKGNRIGYGRGYYDRAIADIRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTESRFSQFSTEHIEKV
MIFRQYENPTDLVKSAVGTLSPPSYAKEMSPDLILMPLIAFDLKGNRIGYGRGYYDRAIADIRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTESRFSQFSTEHIEKV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target113 5-formyltetrahydrofolate cyclo-ligase [Candidatus Liber
315122158148 5-formyltetrahydrofolate cyclo-ligase [Candidatus Liber 1 1e-40
15891217195 5-formyltetrahydrofolate cyclo-ligase [Agrobacterium tu 1 2e-23
150397844193 5-formyltetrahydrofolate cyclo-ligase [Sinorhizobium me 1 7e-22
222149681192 5,10-methenyltetrahydrofolate synthetase [Agrobacterium 1 8e-22
227823328193 5-formyltetrahydrofolate cyclo-ligase family protein [S 1 1e-21
15966511193 hypothetical protein SMc03974 [Sinorhizobium meliloti 1 1 1e-21
307300452193 5-formyltetrahydrofolate cyclo-ligase [Sinorhizobium me 1 1e-21
332716461193 5-formyltetrahydrofolate cyclo-ligase [Agrobacterium sp 1 1e-21
241206194195 5-formyltetrahydrofolate cyclo-ligase [Rhizobium legumi 1 6e-21
86359062214 5-formyltetrahydrofolate cyclo-ligase protein [Rhizobiu 1 8e-21
>gi|315122158|ref|YP_004062647.1| 5-formyltetrahydrofolate cyclo-ligase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 148 Back     alignment and organism information
 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 78/106 (73%), Positives = 92/106 (86%)

Query: 1   MIFRQYENPTDLVKSAVGTLSPPSYAKEMSPDLILMPLIAFDLKGNRIGYGRGYYDRAIA 60
           MIFRQY++P  LVK   G LSPP +A+E++PDLILMPL+AFD  GNRIGYG+GYYD AIA
Sbjct: 43  MIFRQYDDPKYLVKEKFGILSPPRHAQEINPDLILMPLVAFDSHGNRIGYGKGYYDHAIA 102

Query: 61  DIRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTESRFSQFS 106
           + RLEGKNPYL+GIAFD+QETS I+ E+TDIRLHAILTESRF QF+
Sbjct: 103 NARLEGKNPYLVGIAFDVQETSYIKVESTDIRLHAILTESRFDQFN 148


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15891217|ref|NP_356889.1| 5-formyltetrahydrofolate cyclo-ligase [Agrobacterium tumefaciens str. C58] Length = 195 Back     alignment and organism information
>gi|150397844|ref|YP_001328311.1| 5-formyltetrahydrofolate cyclo-ligase [Sinorhizobium medicae WSM419] Length = 193 Back     alignment and organism information
>gi|222149681|ref|YP_002550638.1| 5,10-methenyltetrahydrofolate synthetase [Agrobacterium vitis S4] Length = 192 Back     alignment and organism information
>gi|227823328|ref|YP_002827300.1| 5-formyltetrahydrofolate cyclo-ligase family protein [Sinorhizobium fredii NGR234] Length = 193 Back     alignment and organism information
>gi|15966511|ref|NP_386864.1| hypothetical protein SMc03974 [Sinorhizobium meliloti 1021] Length = 193 Back     alignment and organism information
>gi|307300452|ref|ZP_07580232.1| 5-formyltetrahydrofolate cyclo-ligase [Sinorhizobium meliloti BL225C] Length = 193 Back     alignment and organism information
>gi|332716461|ref|YP_004443927.1| 5-formyltetrahydrofolate cyclo-ligase [Agrobacterium sp. H13-3] Length = 193 Back     alignment and organism information
>gi|241206194|ref|YP_002977290.1| 5-formyltetrahydrofolate cyclo-ligase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 195 Back     alignment and organism information
>gi|86359062|ref|YP_470954.1| 5-formyltetrahydrofolate cyclo-ligase protein [Rhizobium etli CFN 42] Length = 214 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target113 5-formyltetrahydrofolate cyclo-ligase [Candidatus Liber
TIGR02727181 TIGR02727, MTHFS_bact, 5,10-methenyltetrahydrofolate sy 4e-20
pfam01812182 pfam01812, 5-FTHF_cyc-lig, 5-formyltetrahydrofolate cyc 8e-19
PRK10333182 PRK10333, PRK10333, 5-formyltetrahydrofolate cyclo-liga 2e-09
PLN02812211 PLN02812, PLN02812, 5-formyltetrahydrofolate cyclo-liga 3e-09
COG0212191 COG0212, COG0212, 5-formyltetrahydrofolate cyclo-ligase 2e-19
KOG3093200 KOG3093, KOG3093, KOG3093, 5-formyltetrahydrofolate cyc 6e-13
>gnl|CDD|162988 TIGR02727, MTHFS_bact, 5,10-methenyltetrahydrofolate synthetase Back     alignment and domain information
>gnl|CDD|110784 pfam01812, 5-FTHF_cyc-lig, 5-formyltetrahydrofolate cyclo-ligase family Back     alignment and domain information
>gnl|CDD|182385 PRK10333, PRK10333, 5-formyltetrahydrofolate cyclo-ligase family protein; Provisional Back     alignment and domain information
>gnl|CDD|178408 PLN02812, PLN02812, 5-formyltetrahydrofolate cyclo-ligase Back     alignment and domain information
>gnl|CDD|30561 COG0212, COG0212, 5-formyltetrahydrofolate cyclo-ligase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|38303 KOG3093, KOG3093, KOG3093, 5-formyltetrahydrofolate cyclo-ligase [Coenzyme transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 113 5-formyltetrahydrofolate cyclo-ligase [Candidatus Liber
PRK10333198 putative ligase; Provisional 100.0
TIGR02727183 MTHFS_bact 5,10-methenyltetrahydrofolate synthetase; In 100.0
pfam01812182 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase fa 100.0
COG0212191 5-formyltetrahydrofolate cyclo-ligase [Coenzyme metabol 100.0
KOG3093200 consensus 99.94
KOG4410 396 consensus 99.44
>PRK10333 putative ligase; Provisional Back     alignment and domain information
>TIGR02727 MTHFS_bact 5,10-methenyltetrahydrofolate synthetase; InterPro: IPR002698 5-formyltetrahydrofolate cyclo-ligase or methenyl-THF synthetase 6 Back     alignment and domain information
>pfam01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family Back     alignment and domain information
>COG0212 5-formyltetrahydrofolate cyclo-ligase [Coenzyme metabolism] Back     alignment and domain information
>KOG3093 consensus Back     alignment and domain information
>KOG4410 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target113 5-formyltetrahydrofolate cyclo-ligase [Candidatus Liber
1sou_A194 Nmr Structure Of Aquifex Aeolicus 5,10- Methenyltet 2e-16
1ydm_A187 X-Ray Structure Of Northeast Structural Genomics Ta 5e-15
1wkc_A184 Crystal Structure Of A 5-Formyltetrahydrofolate Cyc 3e-14
3hxt_A203 Structure Of Human Mthfs Length = 203 6e-11
2jcb_A200 The Crystal Structure Of 5-Formyl-Tetrahydrofolate 1e-10
1sbq_A189 Crystal Structure Of Methenyltetrahydrofolate Synth 1e-06
>gi|50513600|pdb|1SOU|A Chain A, Nmr Structure Of Aquifex Aeolicus 5,10- Methenyltetrahydrofolate Synthetase: Northeast Structural Genomics Consortium Target Qr46 Length = 194 Back     alignment and structure
 Score = 89.1 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 51/103 (49%), Gaps = 7/103 (6%)

Query: 4   RQYENPTDLVKSAVGTLSPPSYAKEM--SPDLILMPLIAFDLKGNRIGYGRGYYDRAIAD 61
            +  +P  L   A G + P    +      D I +P +AFDL+G R+G+G+GYYDR +  
Sbjct: 83  YRVHSPACLGVGAFGIMEPVEGERVNPEDVDFIAVPGVAFDLEGYRLGFGKGYYDRLLKR 142

Query: 62  IRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTESRFSQ 104
           ++        +G+A+  Q    +  +A DI +  ++TE    +
Sbjct: 143 VKG-----LKVGVAYSFQVFERLPRDAWDIPVDVLVTEKNVRR 180


>gi|60594282|pdb|1YDM|A Chain A, X-Ray Structure Of Northeast Structural Genomics Target Sr44 Length = 187 Back     alignment and structure
>gi|58177181|pdb|1WKC|A Chain A, Crystal Structure Of A 5-Formyltetrahydrofolate Cycloligase- Related Protein From Thermus Thermophilus Hb8 Length = 184 Back     alignment and structure
gi|254221105|pdb|3HXT|A Chain A, Structure Of Human Mthfs Length = 203 Back     alignment and structure
>gi|134104769|pdb|2JCB|A Chain A, The Crystal Structure Of 5-Formyl-Tetrahydrofolate Cycloligase From Bacillus Anthracis (Ba4489) Length = 200 Back     alignment and structure
>gi|52695451|pdb|1SBQ|A Chain A, Crystal Structure Of Methenyltetrahydrofolate Synthetase From Mycoplasma Pneumoniae At 2.2 Resolution Length = 189 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target113 5-formyltetrahydrofolate cyclo-ligase [Candidatus Liber
3hy3_A203 5-formyltetrahydrofolate cyclo-ligase; antifolate, canc 5e-18
1sou_A194 5,10-methenyltetrahydrofolate synthetase; structural ge 4e-14
2jcb_A200 5-formyltetrahydrofolate cyclo-ligase family protein; 1 4e-13
1ydm_A187 Hypothetical protein YQGN; northeast structural genomic 7e-12
1sbq_A189 H91_ORF164, 5,10-methenyltetrahydrofolate synthetase ho 2e-11
1wkc_A184 HB8 TT1367 protein; structural genomics, riken structur 2e-11
>3hy3_A 5-formyltetrahydrofolate cyclo-ligase; antifolate, cancer, acetylation, ATP-binding, cytoplasm, folate-binding, magnesium, nucleotide-binding; HET: 10F; 1.80A {Homo sapiens} PDB: 3hxt_A* 3hy4_A* 3hy6_A Length = 203 Back     alignment and structure
 Score = 84.8 bits (209), Expect = 5e-18
 Identities = 29/110 (26%), Positives = 47/110 (42%), Gaps = 10/110 (9%)

Query: 1   MIFRQYENPTDLVKSAVGTLSPPSYAKEM---------SPDLILMPLIAFDLKGNRIGYG 51
           M   + E+P ++      + + P   +             DLI MP + FD  GNR+G G
Sbjct: 90  MDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRG 149

Query: 52  RGYYDRAIADIR-LEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTES 100
           +GYYD  +      +   PY L +AF  Q    +     D+++  +L E 
Sbjct: 150 KGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYED 199


>1sou_A 5,10-methenyltetrahydrofolate synthetase; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium; NMR {Aquifex aeolicus} SCOP: c.124.1.6 Length = 194 Back     alignment and structure
>2jcb_A 5-formyltetrahydrofolate cyclo-ligase family protein; 10- methenyltetrahydrofolate synthetase, MTHFS, folate metabolism, structural genomics; HET: ADP; 1.6A {Bacillus anthracis} Length = 200 Back     alignment and structure
>1ydm_A Hypothetical protein YQGN; northeast structural genomics, SR44, X-RAY, PSI, protein structure initiative; 2.50A {Bacillus subtilis} Length = 187 Back     alignment and structure
>1sbq_A H91_ORF164, 5,10-methenyltetrahydrofolate synthetase homolog; MTHFS, 5- formyltetrahydrofolate cyclo-ligase, structural genomics; 2.20A {Mycoplasma pneumoniae} SCOP: c.124.1.6 PDB: 1u3f_A* 1u3g_A* Length = 189 Back     alignment and structure
>1wkc_A HB8 TT1367 protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus HB8} SCOP: c.124.1.6 Length = 184 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target113 5-formyltetrahydrofolate cyclo-ligase [Candidatus Liber
1sou_A194 5,10-methenyltetrahydrofolate synthetase; structural ge 100.0
2jcb_A200 5-formyltetrahydrofolate cyclo-ligase family protein; 1 100.0
1ydm_A187 Hypothetical protein YQGN; northeast structural genomic 100.0
3hy3_A203 5-formyltetrahydrofolate cyclo-ligase; antifolate, canc 100.0
1wkc_A184 HB8 TT1367 protein; structural genomics, riken structur 100.0
1sbq_A189 H91_ORF164, 5,10-methenyltetrahydrofolate synthetase ho 99.97
>1sou_A 5,10-methenyltetrahydrofolate synthetase; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium; NMR {Aquifex aeolicus} SCOP: c.124.1.6 Back     alignment and structure
Probab=100.00  E-value=2.1e-40  Score=234.52  Aligned_cols=103  Identities=28%  Similarity=0.542  Sum_probs=92.9

Q ss_pred             CEEEEECCCCCCEECCCCCCCCCCCCC--CCCCCEEEEHHHHHCCCHHHHCCCCEEHHHHHHHHHHCCCCEEEEEEECHH
Q ss_conf             934653488852464888708899986--114667740142211100111248603789998887449983799983223
Q gi|254780658|r    1 MIFRQYENPTDLVKSAVGTLSPPSYAK--EMSPDLILMPLIAFDLKGNRIGYGRGYYDRAIADIRLEGKNPYLLGIAFDM   78 (113)
Q Consensus         1 l~F~~~~~~~~l~~~~~gI~EP~~~~~--~~~~DlilVP~lafD~~G~RLG~GgGyYDR~l~~~~~~~~~~~~igla~~~   78 (113)
                      |.|+.|.+.++|++|+|||+||.....  ...+|++||||||||++|+|||||||||||+|+++     ++.+|||||++
T Consensus        80 ~~~~~~~~~~~l~~~~~gI~EP~~~~~~~~~~iDlilVP~lafD~~G~RLG~GgGyYDR~L~~~-----~~~~igl~~~~  154 (194)
T 1sou_A           80 ISLYRVHSPACLGVGAFGIMEPVEGERVNPEDVDFIAVPGVAFDLEGYRLGFGKGYYDRLLKRV-----KGLKVGVAYSF  154 (194)
T ss_dssp             EEEEEESSSCCCEECSSSCEECCSSEEECGGGCSEEEECCSCBCSSSCBCCSCCSSHHHHHHHC-----CSEEEEECCGG
T ss_pred             CEEEEECCCCCCCCCCEEEECCCCCCCCCCCCCCEEECCEEEEECCCEEECCCCCCHHHHHHHC-----CCCEEEEEEHH
T ss_conf             2689944774223587566658987657875477874052356318918518786088997357-----99889997256


Q ss_pred             HEECCCCCCCCCCCCCEEECCCCEEEECHH
Q ss_conf             242478998447511589989855970033
Q gi|254780658|r   79 QETSCIQAEATDIRLHAILTESRFSQFSTE  108 (113)
Q Consensus        79 q~~~~ip~e~hD~~ld~iiTe~~~~~f~~~  108 (113)
                      |+++++|.|+||++||+||||+++++|++.
T Consensus       155 Q~~~~ip~e~hD~~ld~iiTe~~i~~~~~~  184 (194)
T 1sou_A          155 QVFERLPRDAWDIPVDVLVTEKNVRRLRDG  184 (194)
T ss_dssp             GBCSCCCCCSCCCCCSEEECSSCEEESCCC
T ss_pred             HCCCCCCCCCCCCCCCEEEECCCEEEECCC
T ss_conf             141888997213288999927204991799



>2jcb_A 5-formyltetrahydrofolate cyclo-ligase family protein; 10- methenyltetrahydrofolate synthetase, MTHFS, folate metabolism, structural genomics; HET: ADP; 1.6A {Bacillus anthracis} Back     alignment and structure
>1ydm_A Hypothetical protein YQGN; northeast structural genomics, SR44, X-RAY, PSI, protein structure initiative; 2.50A {Bacillus subtilis} Back     alignment and structure
>3hy3_A 5-formyltetrahydrofolate cyclo-ligase; antifolate, cancer, acetylation, ATP-binding, cytoplasm, folate-binding, magnesium, nucleotide-binding; HET: 10F; 1.80A {Homo sapiens} PDB: 3hxt_A* 3hy4_A* 3hy6_A Back     alignment and structure
>1wkc_A HB8 TT1367 protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus HB8} SCOP: c.124.1.6 Back     alignment and structure
>1sbq_A H91_ORF164, 5,10-methenyltetrahydrofolate synthetase homolog; MTHFS, 5- formyltetrahydrofolate cyclo-ligase, structural genomics; 2.20A {Mycoplasma pneumoniae} SCOP: c.124.1.6 PDB: 1u3f_A* 1u3g_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 113 5-formyltetrahydrofolate cyclo-ligase [Candidatus Liber
d1soua_194 c.124.1.6 (A:) Hypothetical protein aq_1731 {Aquifex ae 2e-14
d1wkca_175 c.124.1.6 (A:) Hypothetical protein TTHA1611 {Thermus t 7e-14
d1sbqa_164 c.124.1.6 (A:) 5,10-methenyltetrahydrofolate synthetase 6e-13
>d1soua_ c.124.1.6 (A:) Hypothetical protein aq_1731 {Aquifex aeolicus [TaxId: 63363]} Length = 194 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NagB/RpiA/CoA transferase-like
superfamily: NagB/RpiA/CoA transferase-like
family: Methenyltetrahydrofolate synthetase
domain: Hypothetical protein aq 1731
species: Aquifex aeolicus [TaxId: 63363]
 Score = 71.4 bits (174), Expect = 2e-14
 Identities = 29/107 (27%), Positives = 50/107 (46%), Gaps = 7/107 (6%)

Query: 1   MIFRQYENPTDLVKSAVGTLSPPSYAKE--MSPDLILMPLIAFDLKGNRIGYGRGYYDRA 58
           +   +  +P  L   A G + P    +      D I +P +AFDL+G R+G+G+GYYDR 
Sbjct: 80  ISLYRVHSPACLGVGAFGIMEPVEGERVNPEDVDFIAVPGVAFDLEGYRLGFGKGYYDRL 139

Query: 59  IADIRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTESRFSQF 105
           +            +G+A+  Q    +  +A DI +  ++TE    + 
Sbjct: 140 LKR-----VKGLKVGVAYSFQVFERLPRDAWDIPVDVLVTEKNVRRL 181


>d1wkca_ c.124.1.6 (A:) Hypothetical protein TTHA1611 {Thermus thermophilus [TaxId: 274]} Length = 175 Back     information, alignment and structure
>d1sbqa_ c.124.1.6 (A:) 5,10-methenyltetrahydrofolate synthetase homolog MPN348 {Mycoplasma pneumoniae [TaxId: 2104]} Length = 164 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target113 5-formyltetrahydrofolate cyclo-ligase [Candidatus Liber
d1soua_194 Hypothetical protein aq_1731 {Aquifex aeolicus [TaxId: 100.0
d1wkca_175 Hypothetical protein TTHA1611 {Thermus thermophilus [Ta 100.0
d1sbqa_164 5,10-methenyltetrahydrofolate synthetase homolog MPN348 99.97
>d1soua_ c.124.1.6 (A:) Hypothetical protein aq_1731 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NagB/RpiA/CoA transferase-like
superfamily: NagB/RpiA/CoA transferase-like
family: Methenyltetrahydrofolate synthetase
domain: Hypothetical protein aq 1731
species: Aquifex aeolicus [TaxId: 63363]
Probab=100.00  E-value=1.2e-40  Score=234.46  Aligned_cols=103  Identities=28%  Similarity=0.542  Sum_probs=92.6

Q ss_pred             CEEEEECCCCCCEECCCCCCCCCCCCC--CCCCCEEEEHHHHHCCCHHHHCCCCEEHHHHHHHHHHCCCCEEEEEEECHH
Q ss_conf             934653488852464888708899986--114667740142211100111248603789998887449983799983223
Q gi|254780658|r    1 MIFRQYENPTDLVKSAVGTLSPPSYAK--EMSPDLILMPLIAFDLKGNRIGYGRGYYDRAIADIRLEGKNPYLLGIAFDM   78 (113)
Q Consensus         1 l~F~~~~~~~~l~~~~~gI~EP~~~~~--~~~~DlilVP~lafD~~G~RLG~GgGyYDR~l~~~~~~~~~~~~igla~~~   78 (113)
                      |.|+.|.+.+.|.+|+|||+||.....  ...+|++||||||||++|+|||||||||||+|+++     ++.+||+||++
T Consensus        80 m~~~~~~~~~~l~~~~~gI~EP~~~~~~~~~~iDlilVP~lafD~~G~RlG~G~GyYDR~L~~~-----~~~~igl~~~~  154 (194)
T d1soua_          80 ISLYRVHSPACLGVGAFGIMEPVEGERVNPEDVDFIAVPGVAFDLEGYRLGFGKGYYDRLLKRV-----KGLKVGVAYSF  154 (194)
T ss_dssp             EEEEEESSSCCCEECSSSCEECCSSEEECGGGCSEEEECCSCBCSSSCBCCSCCSSHHHHHHHC-----CSEEEEECCGG
T ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEHHHHHHHHHCCCCCCCCCEEHHHHHHCC-----CCCEEEEEECC
T ss_conf             2331047874200001124688745424555445510537888655871246777588765116-----89889998202


Q ss_pred             HEECCCCCCCCCCCCCEEECCCCEEEECHH
Q ss_conf             242478998447511589989855970033
Q gi|254780658|r   79 QETSCIQAEATDIRLHAILTESRFSQFSTE  108 (113)
Q Consensus        79 q~~~~ip~e~hD~~ld~iiTe~~~~~f~~~  108 (113)
                      |+++++|.|+||++||+||||+++++|.+.
T Consensus       155 Q~~~~ip~e~hD~~ld~iiTe~~i~~~~~~  184 (194)
T d1soua_         155 QVFERLPRDAWDIPVDVLVTEKNVRRLRDG  184 (194)
T ss_dssp             GBCSCCCCCSCCCCCSEEECSSCEEESCCC
T ss_pred             EECCCCCCCCCCEECCEEEECCCEEEECCC
T ss_conf             030788998708078999976124995699



>d1wkca_ c.124.1.6 (A:) Hypothetical protein TTHA1611 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sbqa_ c.124.1.6 (A:) 5,10-methenyltetrahydrofolate synthetase homolog MPN348 {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 113 5-formyltetrahydrofolate cyclo-ligase [Candidatus
2jcb_A_200 (A:) 5-formyltetrahydrofolate cyclo-ligase family 1e-20
1sou_A_194 (A:) 5,10-methenyltetrahydrofolate synthetase; str 5e-19
1ydm_A_187 (A:) Hypothetical protein YQGN; northeast structur 2e-18
3hy3_A_203 (A:) 5-formyltetrahydrofolate cyclo-ligase; antifo 6e-18
1wkc_A_184 (A:) HB8 TT1367 protein; structural genomics, rike 9e-18
1sbq_A_189 (A:) H91_ORF164, 5,10-methenyltetrahydrofolate syn 1e-15
>2jcb_A (A:) 5-formyltetrahydrofolate cyclo-ligase family protein; 10- methenyltetrahydrofolate synthetase, MTHFS, folate metabolism, structural genomics; HET: ADP; 1.6A {Bacillus anthracis}Length = 200 Back     alignment and structure
 Score = 92.8 bits (230), Expect = 1e-20
 Identities = 32/110 (29%), Positives = 44/110 (40%), Gaps = 9/110 (8%)

Query: 1   MIFRQYENPTDLVKSAVGTLSPPSYAKEM----SPDLILMPLIAFDLKGNRIGYGRGYYD 56
           M FRQ  N   L    +    P     E       DL ++P +A+  +G RIGYG GYYD
Sbjct: 93  MSFRQISNFDQLETVYMNLREPIPALTEEVNADEIDLQIVPGVAYTERGERIGYGGGYYD 152

Query: 57  RAIADIRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTESRFSQFS 106
           R +            L +A+  Q    I  E  D  +  I+TE      +
Sbjct: 153 RYLVH-----YKGKTLSLAYSFQMVEHIPVEPFDKNVEKIITEKGTMVKN 197


>1sou_A (A:) 5,10-methenyltetrahydrofolate synthetase; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium; NMR {Aquifex aeolicus}Length = 194 Back     alignment and structure
>1ydm_A (A:) Hypothetical protein YQGN; northeast structural genomics, SR44, X-RAY, PSI, protein structure initiative; 2.50A {Bacillus subtilis}Length = 187 Back     alignment and structure
>3hy3_A (A:) 5-formyltetrahydrofolate cyclo-ligase; antifolate, cancer, acetylation, ATP-binding, cytoplasm, folate-binding, magnesium, nucleotide-binding; HET: 10F; 1.80A {Homo sapiens} PDB: 3hxt_A* 3hy4_A* 3hy6_ALength = 203 Back     alignment and structure
>1wkc_A (A:) HB8 TT1367 protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus HB8}Length = 184 Back     alignment and structure
>1sbq_A (A:) H91_ORF164, 5,10-methenyltetrahydrofolate synthetase homolog; MTHFS, 5- formyltetrahydrofolate cyclo-ligase, structural genomics; 2.20A {Mycoplasma pneumoniae}Length = 189 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target113 5-formyltetrahydrofolate cyclo-ligase [Candidatus Liber
1sou_A_194 5,10-methenyltetrahydrofolate synthetase; structur 100.0
1wkc_A_184 HB8 TT1367 protein; structural genomics, riken str 100.0
1ydm_A_187 Hypothetical protein YQGN; northeast structural ge 100.0
3hy3_A_203 5-formyltetrahydrofolate cyclo-ligase; antifolate, 100.0
2jcb_A_200 5-formyltetrahydrofolate cyclo-ligase family prote 100.0
1sbq_A_189 H91_ORF164, 5,10-methenyltetrahydrofolate syntheta 99.97
>1sou_A (A:) 5,10-methenyltetrahydrofolate synthetase; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium; NMR {Aquifex aeolicus} Back     alignment and structure
Probab=100.00  E-value=1.4e-37  Score=220.35  Aligned_cols=106  Identities=27%  Similarity=0.509  Sum_probs=96.7

Q ss_pred             CEEEEECCCCCCEECCCCCCCCCCCC--CCCCCCEEEEHHHHHCCCHHHHCCCCEEHHHHHHHHHHCCCCEEEEEEECHH
Q ss_conf             93465348885246488870889998--6114667740142211100111248603789998887449983799983223
Q gi|254780658|r    1 MIFRQYENPTDLVKSAVGTLSPPSYA--KEMSPDLILMPLIAFDLKGNRIGYGRGYYDRAIADIRLEGKNPYLLGIAFDM   78 (113)
Q Consensus         1 l~F~~~~~~~~l~~~~~gI~EP~~~~--~~~~~DlilVP~lafD~~G~RLG~GgGyYDR~l~~~~~~~~~~~~igla~~~   78 (113)
                      |.|+.|++.++|.+|+|||+||..+.  ....+|++|||+||||++|+|||||||||||+|+.+     ++..|||||++
T Consensus        80 l~f~~~~~~~~l~~~~~gi~eP~~~~~~~~~~idliivP~lafD~~G~RLG~G~GyYDr~l~~~-----~~~~vgi~~~~  154 (194)
T 1sou_A           80 ISLYRVHSPACLGVGAFGIMEPVEGERVNPEDVDFIAVPGVAFDLEGYRLGFGKGYYDRLLKRV-----KGLKVGVAYSF  154 (194)
T ss_dssp             EEEEEESSSCCCEECSSSCEECCSSEEECGGGCSEEEECCSCBCSSSCBCCSCCSSHHHHHHHC-----CSEEEEECCGG
T ss_pred             EEEEECCCCCCHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHC-----CCCEEEEEEHH
T ss_conf             4565327872012210004688755424555546412658998655873236576476675403-----89889998456


Q ss_pred             HEECCCCCCCCCCCCCEEECCCCEEEECHHHCC
Q ss_conf             242478998447511589989855970033302
Q gi|254780658|r   79 QETSCIQAEATDIRLHAILTESRFSQFSTEHIE  111 (113)
Q Consensus        79 q~~~~ip~e~hD~~ld~iiTe~~~~~f~~~~~~  111 (113)
                      |+++++|.|+||++||+|+||++++++++....
T Consensus       155 q~~~~lp~e~hD~~ld~iiT~~~~~~~~~~~~~  187 (194)
T 1sou_A          155 QVFERLPRDAWDIPVDVLVTEKNVRRLRDGRSL  187 (194)
T ss_dssp             GBCSCCCCCSCCCCCSEEECSSCEEESCCCCCC
T ss_pred             HEECCCCCCCCCCCCCEEEECCEEEEECCCCCC
T ss_conf             350788998708378999967405995899853



>1wkc_A (A:) HB8 TT1367 protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus HB8} Back     alignment and structure
>1ydm_A (A:) Hypothetical protein YQGN; northeast structural genomics, SR44, X-RAY, PSI, protein structure initiative; 2.50A {Bacillus subtilis} Back     alignment and structure
>3hy3_A (A:) 5-formyltetrahydrofolate cyclo-ligase; antifolate, cancer, acetylation, ATP-binding, cytoplasm, folate-binding, magnesium, nucleotide-binding; HET: 10F; 1.80A {Homo sapiens} PDB: 3hxt_A* 3hy4_A* 3hy6_A Back     alignment and structure
>2jcb_A (A:) 5-formyltetrahydrofolate cyclo-ligase family protein; 10- methenyltetrahydrofolate synthetase, MTHFS, folate metabolism, structural genomics; HET: ADP; 1.6A {Bacillus anthracis} Back     alignment and structure
>1sbq_A (A:) H91_ORF164, 5,10-methenyltetrahydrofolate synthetase homolog; MTHFS, 5- formyltetrahydrofolate cyclo-ligase, structural genomics; 2.20A {Mycoplasma pneumoniae} Back     alignment and structure