254780659

254780659

hypothetical protein CLIBASIA_02730

GeneID in NCBI database:8209662Locus tag:CLIBASIA_02730
Protein GI in NCBI database:254780659Protein Accession:YP_003065072.1
Gene range:-(613560, 614384)Protein Length:274aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein; K09769 hypothetical protein
SEED prediction:FIG006542: Phosphoesterase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270----
MRLLFLGDIVGKTGRSIVYEMLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGIDVITTGNHVWDKREALVFSQRHCKFLRPANYPPNTPGNGSGLYCAKNGSNVLVANIMGRVFMNPLLDDPFRTADKILATCPLKEQADVIVFDFHAETTSEKQCFAHFVDSRASLVVGTHTHIPTADAQILDGGTGYITDLGMCGDYNSSIGLDKEEPINRFITQIPRNRFVIANGPATLCGICAEISDVTGLAEKIAPIRIGPRLSETRPDFWT
cEEEEEEEcccHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHccccEEEcccccccHHHHHHHHHHccccccccccccccccccEEEEEcccccEEEEEEEccHHccccccccHHHHHHHHHHHccccccccEEEEEEEccccHHHHHHHHHccccEEEEEEccccccccHHHccccccEEEEcccccccccccccccHHHHHHHHHHccccccEEEccccEEEEEEEEEEccccccEEEEEEEEEccccccccccccc
cEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHccccEEEcccccccHHHHHHHHHHccccEcccccccccccccEEEEEEccccEEEEEEEccccccccccccHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHccccEEEEEEcccccccccHHccccccEEEEccccccccccEEccccHHHHHHHHcccccccEEcccccEEEEEEEcccccccccEEEEEEEEEccccccccccccc
mrllflgdivgkTGRSIVYEMLPRLIRDFQLDFVIangensaggfgiTEKIFCEMMETGIDVITTGNHVWDKREALVFSQRHckflrpanyppntpgngsglycakngsnVLVANIMGRvfmnpllddpfrtadkilatcplkeqadVIVFDFhaettsekqcfahfvdsraslvvgththiptadaqildggtgyitdlgmcgdynssigldkeepinrfitqiprnrfviangpatlCGICAEisdvtglaekiapirigprlsetrpdfwt
mrllflgdivgktgRSIVYEMLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGIDVITTGNHVWDKREALVFSQRHCKFLRPANYPPNTPGNGSGLYCAKNGSNVLVANIMGRVFMNPLLDDPFRTADKILATCPLKEQADVIVFDFHAETTSEKQCFAHFVDSRASLVVGTHThiptadaqildGGTGYITDLGMCGDYNSSIGLDKEEPINRFITQIPRNRFVIANGPATLCGICAEISDVTGLAekiapirigprlsetrpdfwt
MRLLFLGDIVGKTGRSIVYEMLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGIDVITTGNHVWDKREALVFSQRHCKFLRPANYPPNTPGNGSGLYCAKNGSNVLVANIMGRVFMNPLLDDPFRTADKILATCPLKEQADVIVFDFHAETTSEKQCFAHFVDSRASLVVGTHTHIPTADAQILDGGTGYITDLGMCGDYNSSIGLDKEEPINRFITQIPRNRFVIANGPATLCGICAEISDVTGLAEKIAPIRIGPRLSETRPDFWT
MRLLFLGDIVGKTGRSIVYEMLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGIDVITTGNHVWDKREALVFSQRHCKFLRPANYPPNTPGNGSGLYCAKNGSNVLVANIMGRVFMNPLLDDPFRTADKILATCPLKEQADVIVFDFHAETTSEKQCFAHFVDSRASLVVGTHTHIPTADAQILDGGTGYITDLGMCGDYNSSIGLDKEEPINRFITQIPRNRFVIANGPATLCGICAEISDVTGLAEKIAPIRIGPRLSE***DFWT
MRLLFLGDIVGKTGRSIVYEMLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGIDVITTGNHVWDKREALVFSQRHCKFLRPANYPPNTPGNGSGLYCAKNGSNVLVANIMGRVFMNPLLDDPFRTADKILATCPLKEQADVIVFDFHAETTSEKQCFAHFVDSRASLVVGTHTHIPTADAQILDGGTGYITDLGMCGDYNSSIGLDKEEPINRFITQIPRNRFVIANGPATLCGICAEISDVTGLAEKIAPIRIGPRLSETRPDFWT
MRLLFLGDIVGKTGRSIVYEMLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGIDVITTGNHVWDKREALVFSQRHCKFLRPANYPPNTPGNGSGLYCAKNGSNVLVANIMGRVFMNPLLDDPFRTADKILATCPLKEQADVIVFDFHAETTSEKQCFAHFVDSRASLVVGTHTHIPTADAQILDGGTGYITDLGMCGDYNSSIGLDKEEPINRFITQIPRNRFVIANGPATLCGICAEISDVTGLAEKIAPIRIGPRLSETRPDFWT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLLFLGDIVGKTGRSIVYEMLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGIDVITTGNHVWDKREALVFSQRHCKFLRPANYPPNTPGNGSGLYCAKNGSNVLVANIMGRVFMNPLLDDPFRTADKILATCPLKEQADVIVFDFHAETTSEKQCFAHFVDSRASLVVGTHTHIPTADAQILDGGTGYITDLGMCGDYNSSIGLDKEEPINRFITQIPRNRFVIANGPATLCGICAEISDVTGLAEKIAPIRIGPRLSETRPDFWT
MRLLFLGDIVGKTGRSIVYEMLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGIDVITTGNHVWDKREALVFSQRHCKFLRPANYPPNTPGNGSGLYCAKNGSNVLVANIMGRVFMNPLLDDPFRTADKILATCPLKEQADVIVFDFHAETTSEKQCFAHFVDSRASLVVGTHTHIPTADAQILDGGTGYITDLGMCGDYNSSIGLDKEEPINRFITQIPRNRFVIANGPATLCGICAEISDVTGLAEKIAPIRIGPRLSETRPDFWT
MRLLFLGDIVGKTGRSIVYEMLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGIDVITTGNHVWDKREALVFSQRHCKFLRPANYPPNTPGNGSGLYCAKNGSNVLVANIMGRVFMNPLLDDPFRTADKILATCPLKEQADVIVFDFHAETTSEKQCFAHFVDSRASLVVGTHTHIPTADAQILDGGTGYITDLGMCGDYNSSIGLDKEEPINRFITQIPRNRFVIANGPATLCGICAEISDVTGLAEKIAPIRIGPRLSETRPDFWT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target274 hypothetical protein CLIBASIA_02730 [Candidatus Liberib
315122157274 hypothetical protein CKC_02035 [Candidatus Liberibacter 1 1e-144
222149682274 hypothetical protein Avi_3650 [Agrobacterium vitis S4] 1 1e-120
241206195274 metallophosphoesterase [Rhizobium leguminosarum bv. tri 1 1e-119
15891218274 hypothetical protein Atu3730 [Agrobacterium tumefaciens 1 1e-119
332716460274 hypothetical protein AGROH133_12043 [Agrobacterium sp. 1 1e-119
190893285274 phosphatase [Rhizobium etli CIAT 652] Length = 274 1 1e-119
116253719274 phosphatase [Rhizobium leguminosarum bv. viciae 3841] L 1 1e-118
150397843274 metallophosphoesterase [Sinorhizobium medicae WSM419] L 1 1e-118
222086994274 hypothetical protein Arad_3706 [Agrobacterium radiobact 1 1e-118
327194137274 metallophosphoesterase [Rhizobium etli CNPAF512] Length 1 1e-118
>gi|315122157|ref|YP_004062646.1| hypothetical protein CKC_02035 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 274 Back     alignment and organism information
 Score =  514 bits (1323), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 243/274 (88%), Positives = 259/274 (94%)

Query: 1   MRLLFLGDIVGKTGRSIVYEMLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGI 60
           MRLLFLGDIVGK GRSIVY+ LPRLIRDF+LDFV+ANGENSAGGFGITEKIF EM+E GI
Sbjct: 1   MRLLFLGDIVGKAGRSIVYDTLPRLIRDFKLDFVVANGENSAGGFGITEKIFLEMIEIGI 60

Query: 61  DVITTGNHVWDKREALVFSQRHCKFLRPANYPPNTPGNGSGLYCAKNGSNVLVANIMGRV 120
           DVITTGNH WDKREAL+FSQRH  FLRPANYP +TPGNGSGLY AKNG+NVLV+NIMGR+
Sbjct: 61  DVITTGNHSWDKREALIFSQRHHHFLRPANYPLDTPGNGSGLYKAKNGANVLVSNIMGRI 120

Query: 121 FMNPLLDDPFRTADKILATCPLKEQADVIVFDFHAETTSEKQCFAHFVDSRASLVVGTHT 180
           FMNP+LDDPFRT+DKIL TCPLKEQADVIVFDFHAETTSEKQCFAHFVDSRASLVVGTHT
Sbjct: 121 FMNPILDDPFRTSDKILETCPLKEQADVIVFDFHAETTSEKQCFAHFVDSRASLVVGTHT 180

Query: 181 HIPTADAQILDGGTGYITDLGMCGDYNSSIGLDKEEPINRFITQIPRNRFVIANGPATLC 240
           HIPTADAQILDGGTGYI+DLGMCGDYNSSIGLDKEEPINRFI+QIP NRFV+ANGPATLC
Sbjct: 181 HIPTADAQILDGGTGYISDLGMCGDYNSSIGLDKEEPINRFISQIPHNRFVVANGPATLC 240

Query: 241 GICAEISDVTGLAEKIAPIRIGPRLSETRPDFWT 274
           GICA+ISDVTGL EKIAPIRIG RL +T PDFWT
Sbjct: 241 GICADISDVTGLTEKIAPIRIGARLQQTSPDFWT 274


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222149682|ref|YP_002550639.1| hypothetical protein Avi_3650 [Agrobacterium vitis S4] Length = 274 Back     alignment and organism information
>gi|241206195|ref|YP_002977291.1| metallophosphoesterase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 274 Back     alignment and organism information
>gi|15891218|ref|NP_356890.1| hypothetical protein Atu3730 [Agrobacterium tumefaciens str. C58] Length = 274 Back     alignment and organism information
>gi|332716460|ref|YP_004443926.1| hypothetical protein AGROH133_12043 [Agrobacterium sp. H13-3] Length = 274 Back     alignment and organism information
>gi|190893285|ref|YP_001979827.1| phosphatase [Rhizobium etli CIAT 652] Length = 274 Back     alignment and organism information
>gi|116253719|ref|YP_769557.1| phosphatase [Rhizobium leguminosarum bv. viciae 3841] Length = 274 Back     alignment and organism information
>gi|150397843|ref|YP_001328310.1| metallophosphoesterase [Sinorhizobium medicae WSM419] Length = 274 Back     alignment and organism information
>gi|222086994|ref|YP_002545528.1| hypothetical protein Arad_3706 [Agrobacterium radiobacter K84] Length = 274 Back     alignment and organism information
>gi|327194137|gb|EGE61007.1| metallophosphoesterase [Rhizobium etli CNPAF512] Length = 274 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target274 hypothetical protein CLIBASIA_02730 [Candidatus Liberib
COG1692266 COG1692, COG1692, Uncharacterized protein conserved in 1e-106
TIGR00282266 TIGR00282, TIGR00282, metallophosphoesterase, MG_246/BB 1e-70
cd07382255 cd07382, MPP_DR1281, Deinococcus radiodurans DR1281 and 1e-112
pfam00149186 pfam00149, Metallophos, Calcineurin-like phosphoesteras 5e-07
pfam09587237 pfam09587, PGA_cap, Bacterial capsule synthesis protein 2e-05
smart00854239 smart00854, PGA_cap, Bacterial capsule synthesis protei 2e-05
cd07381239 cd07381, MPP_CapA, CapA and related proteins, metalloph 2e-04
>gnl|CDD|31878 COG1692, COG1692, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|161802 TIGR00282, TIGR00282, metallophosphoesterase, MG_246/BB_0505 family Back     alignment and domain information
>gnl|CDD|163625 cd07382, MPP_DR1281, Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|143917 pfam00149, Metallophos, Calcineurin-like phosphoesterase Back     alignment and domain information
>gnl|CDD|150300 pfam09587, PGA_cap, Bacterial capsule synthesis protein PGA_cap Back     alignment and domain information
>gnl|CDD|129087 smart00854, PGA_cap, Bacterial capsule synthesis protein PGA_cap Back     alignment and domain information
>gnl|CDD|163624 cd07381, MPP_CapA, CapA and related proteins, metallophosphatase domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 274 hypothetical protein CLIBASIA_02730 [Candidatus Liberib
COG1692266 Calcineurin-like phosphoesterase [General function pred 100.0
TIGR00282272 TIGR00282 conserved hypothetical protein TIGR00282; Int 100.0
PRK09558 551 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase p 99.11
pfam09587237 PGA_cap Bacterial capsule synthesis protein PGA_cap. Th 99.09
smart00854239 PGA_cap Bacterial capsule synthesis protein PGA_cap. Th 99.09
PRK09419 1260 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiestera 98.66
pfam00149186 Metallophos Calcineurin-like phosphoesterase. This fami 98.24
PRK09419 1260 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiestera 97.54
TIGR01530 550 nadN NAD nucleotidase; InterPro: IPR006420 This family 96.47
PRK11340270 phosphodiesterase YaeI; Provisional 90.02
COG0737 517 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and 98.7
PRK09418 780 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiestera 97.18
KOG4419 602 consensus 97.01
PRK09420 578 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 97.51
PRK11907 810 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiestera 95.66
PRK02083253 imidazole glycerol phosphate synthase subunit HisF; Pro 93.2
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. This c 91.01
PRK02621254 consensus 90.87
PRK05581220 ribulose-phosphate 3-epimerase; Validated 92.67
PRK08091235 ribulose-phosphate 3-epimerase; Validated 92.0
PRK08005210 ribulose-phosphate 3-epimerase; Validated 90.58
PRK09722227 allulose-6-phosphate 3-epimerase; Provisional 90.01
>COG1692 Calcineurin-like phosphoesterase [General function prediction only] Back     alignment and domain information
>TIGR00282 TIGR00282 conserved hypothetical protein TIGR00282; InterPro: IPR005235 This family of conserved hypothetical proteins has no known function Back     alignment and domain information
>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed Back     alignment and domain information
>pfam09587 PGA_cap Bacterial capsule synthesis protein PGA_cap Back     alignment and domain information
>smart00854 PGA_cap Bacterial capsule synthesis protein PGA_cap Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>pfam00149 Metallophos Calcineurin-like phosphoesterase Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>TIGR01530 nadN NAD nucleotidase; InterPro: IPR006420 This family describes NadN of Haemophilus influenzae and a small number of close homologs in pathogenic, Gram-negative bacteria Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09418 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>KOG4419 consensus Back     alignment and domain information
>PRK09420 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed Back     alignment and domain information
>PRK11907 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PRK02621 consensus Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK08005 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target274 hypothetical protein CLIBASIA_02730 [Candidatus Liberib
1t70_A255 Crystal Structure Of A Novel Phosphatase From Deino 1e-69
2z06_A252 Crystal Structure Of Uncharacterized Conserved Prot 2e-69
1t71_A281 Crystal Structure Of A Novel Phosphatase Mycoplasma 7e-64
2cv9_A252 Crystal Structure Of A Hypothetical Protein From Th 1e-63
gi|58176742|pdb|1T70|A Chain A, Crystal Structure Of A Novel Phosphatase From Deinococcus Radiodurans Length = 255 Back     alignment and structure
 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 106/263 (40%), Positives = 142/263 (53%), Gaps = 13/263 (4%)

Query: 1   MRLLFLGDIVGKTGRSIVYEMLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGI 60
           MR+LF+GD+ G+ GR ++   LP +   F  DFVI N ENSAGGFG+        +E G 
Sbjct: 1   MRVLFIGDVFGQPGRRVLQNHLPTIRPQF--DFVIVNMENSAGGFGMHRDAARGALEAGA 58

Query: 61  DVITTGNHVWDKREALVFSQRHCK-FLRPANYP-PNTPGNGSGLYCAKNGSNVLVANIMG 118
             +T GNH W  ++            +RP NY  P TPG G   +   NG  + V N++G
Sbjct: 59  GCLTLGNHAWHHKDIYPMLSEDTYPIVRPLNYADPGTPGVGWRTFD-VNGEKLTVVNLLG 117

Query: 119 RVFMNPLLDDPFRTADKILATCPLKEQADVIVFDFHAETTSEKQCFAHFVDSRASLVVGT 178
           RVFM   +D+PFRT D +L    L      +  DFHAE TSEK+     +  R + V+GT
Sbjct: 118 RVFME-AVDNPFRTMDALLERDDLGT----VFVDFHAEATSEKEAMGWHLAGRVAAVIGT 172

Query: 179 HTHIPTADAQILDGGTGYITDLGMCGDYNSSIGLDKEEPINRFITQIPRNRFVIANGPAT 238
           HTH+PTAD +IL GGT Y TD G  G ++S IG   E P+ RF+T+ P +R+ +A G A 
Sbjct: 173 HTHVPTADTRILKGGTAYQTDAGFTGPHDSIIGSAIEGPLQRFLTERP-HRYGVAEGRAE 231

Query: 239 LCGICAEISDVTGLAEKIAPIRI 261
           L G+        G A      R 
Sbjct: 232 LNGVALHF--EGGKATAAERYRF 252


gi|160286297|pdb|2Z06|A Chain A, Crystal Structure Of Uncharacterized Conserved Protein From Thermus Thermophilus Length = 252 Back     alignment and structure
gi|58176750|pdb|1T71|A Chain A, Crystal Structure Of A Novel Phosphatase Mycoplasma Pneumoniaefrom Length = 281 Back     alignment and structure
>gi|83754884|pdb|2CV9|A Chain A, Crystal Structure Of A Hypothetical Protein From Thermus Thermophilus Hb8 Length = 252 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target274 hypothetical protein CLIBASIA_02730 [Candidatus Liberib
1t71_A281 Phosphatase, conserved; crystal, X-RAY crystallography, 1e-80
2z06_A252 Putative uncharacterized protein TTHA0625; metal bindin 7e-78
1t70_A255 Phosphatase; crystal, X-RAY crystallography, structural 2e-77
>1t71_A Phosphatase, conserved; crystal, X-RAY crystallography, structural genomics, berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 Length = 281 Back     alignment and structure
 Score =  294 bits (754), Expect = 1e-80
 Identities = 87/266 (32%), Positives = 132/266 (49%), Gaps = 10/266 (3%)

Query: 1   MRLLFLGDIVGKTGRSIVYEMLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGI 60
           ++ +FLGD+ GK GR+I+   L +L   +Q D VI N EN+  G G++ K +  + E G+
Sbjct: 5   IKFIFLGDVYGKAGRNIIKNNLAQLKSKYQADLVIVNAENTTHGKGLSLKHYEFLKEAGV 64

Query: 61  DVITTGNHVWDKREALVFSQRHCKFLRPANYPPN----TPGNGSGLYCAKNGSNVLVANI 116
           + IT GNH W ++  L         +RP N   +      G GS ++        +   +
Sbjct: 65  NYITMGNHTWFQKLDLAVVINKKDLVRPLNLDTSFAFHNLGQGSLVFEFNKAKIRITNLL 124

Query: 117 MGRVFMNPLLDDPFRTADKILATCPLKEQADVIVFDFHAETTSEKQCFAHFVDSRASLVV 176
              V +     +PF+   +++     K   D+ + DFHAETTSEK  F    D   + + 
Sbjct: 125 GTSVPLPFKTTNPFKVLKELIL----KRDCDLHIVDFHAETTSEKNAFCMAFDGYVTTIF 180

Query: 177 GTHTHIPTADAQILDGGTGYITDLGMCGD-YNSSIGLDKEEPINRFITQIPRNRFVIANG 235
           GTHTH+P+AD +I   G+ YITD+GMCG  + S IG + E+ I  F        F ++  
Sbjct: 181 GTHTHVPSADLRITPKGSAYITDVGMCGPGFGSVIGANPEQSIRLFCAGSRE-HFEVSKC 239

Query: 236 PATLCGICAEISDVTGLAEKIAPIRI 261
            A L G+  E+   T    K   IRI
Sbjct: 240 GAQLNGVFFEVDVNTKKVIKTEAIRI 265


>2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus HB8} SCOP: d.159.1.10 PDB: 2cv9_A Length = 252 Back     alignment and structure
>1t70_A Phosphatase; crystal, X-RAY crystallography, structural genomics, berkeley structural genomics center, BSGC, PSI; 2.30A {Deinococcus radiodurans R1} SCOP: d.159.1.9 Length = 255 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target274 hypothetical protein CLIBASIA_02730 [Candidatus Liberib
1t71_A281 Phosphatase, conserved; crystal, X-RAY crystallography, 100.0
1t70_A255 Phosphatase; crystal, X-RAY crystallography, structural 100.0
2z06_A252 Putative uncharacterized protein TTHA0625; metal bindin 100.0
3ive_A 509 Nucleotidase; structural genomics, PSI-2, protein struc 98.91
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding, hyd 98.9
3gve_A341 YFKN protein; alpha-beta-BETA-alpha sandwich, structura 98.86
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, metallo 98.85
3c9f_A 557 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protei 98.8
3jyf_A339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleo 98.65
2wdc_A 562 SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydr 98.61
1uf3_A228 Hypothetical protein TT1561; metallo-dependent phosphat 96.62
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nucleas 96.49
1ute_A313 Protein (II purple acid phosphatase); tartrate resistan 95.72
2q8u_A336 Exonuclease, putative; structural genomics, joint cente 94.78
1xzw_A426 Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2 94.52
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metallohydr 90.61
2kkn_A178 Uncharacterized protein; protein phosphatase 2A homolog 90.24
1ii7_A333 MRE11 nuclease; RAD50, DNA double-strand break repair, 94.63
1su1_A208 Hypothetical protein YFCE; structural genomics, phospho 94.31
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, unkn 93.35
2qjc_A262 Diadenosine tetraphosphatase, putative; putative diaden 92.99
2nxf_A322 Putative dimetal phosphatase; dinuclear metal center ph 92.19
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D 92.34
2iw0_A254 Chitin deacetylase; hydrolase, chitin DE-N-acetylase, f 90.22
>1t71_A Phosphatase, conserved; crystal, X-RAY crystallography, structural genomics, berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 Back     alignment and structure
Probab=100.00  E-value=0  Score=809.52  Aligned_cols=264  Identities=34%  Similarity=0.598  Sum_probs=253.9

Q ss_pred             CEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCEEEECCEECCCCCCCCHHHHHHHHHCCCCEEEECHHHHCCCCHHHHHH
Q ss_conf             92699972027688999999808988860998999917004788678999999998379989993426530222047542
Q gi|254780659|r    1 MRLLFLGDIVGKTGRSIVYEMLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGIDVITTGNHVWDKREALVFSQ   80 (274)
Q Consensus         1 MkiLfiGDIvG~~Gr~~v~~~Lp~l~~~~~~DfvIaNgENaa~G~Git~~~~~~l~~~GvDviT~GNH~wd~kei~~~i~   80 (274)
                      |||||||||||+|||++|+++||+||++|++|||||||||||+|+|||+++|++|+++||||||+|||+|||||++++|+
T Consensus         5 MkiLfiGDIvG~~Gr~~v~~~Lp~l~~~~~iDfvIaNgENaa~G~Git~~~~~~l~~~GvDviT~GNH~wd~kei~~~i~   84 (281)
T 1t71_A            5 IKFIFLGDVYGKAGRNIIKNNLAQLKSKYQADLVIVNAENTTHGKGLSLKHYEFLKEAGVNYITMGNHTWFQKLDLAVVI   84 (281)
T ss_dssp             CEEEEECEEBHHHHHHHHHTTHHHHHHHHTCSEEEEECTBTTTTSSCCHHHHHHHHHHTCCEEECCTTTTCCGGGHHHHT
T ss_pred             CEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCHHHHHHHHHHCCCEEECCCCCCCCHHHHHHHH
T ss_conf             36999980688889999999809999982899999898536789698999999999719989924721025635799885


Q ss_pred             HCCCEEEECCCCC----CCCCCCEEEEECCCCCEEEEEEEEHHHCCCC-CCCCHHHHHHHHHHHCCCCCCCCEEEEECCC
Q ss_conf             1893897500798----8875407999848992899999600005883-3259899999998634136899889996257
Q gi|254780659|r   81 RHCKFLRPANYPP----NTPGNGSGLYCAKNGSNVLVANIMGRVFMNP-LLDDPFRTADKILATCPLKEQADVIVFDFHA  155 (274)
Q Consensus        81 ~~~~ilRP~N~p~----~~PG~G~~i~~~~~g~ki~Vinl~Gr~fM~~-~~d~PF~~~d~~l~~~~~~~~~~~i~VDfHa  155 (274)
                      +++|||||+|||+    ++||+||.+++.. +.+++|+|||||+||.| .++|||+.++.++.+    .++++|||||||
T Consensus        85 ~~~~ilRP~N~p~~~p~~~pG~G~~i~~~~-~~~i~Vinl~Gr~fm~~~~~~~pf~~~~~~~~~----~~~~~iiVDfHA  159 (281)
T 1t71_A           85 NKKDLVRPLNLDTSFAFHNLGQGSLVFEFN-KAKIRITNLLGTSVPLPFKTTNPFKVLKELILK----RDCDLHIVDFHA  159 (281)
T ss_dssp             TCTTEECBSCBCTTSTTTTSSBSEEEEECS-SCEEEEEEEECTTSCCSSCBCCHHHHHHHHHTT----CCCSEEEEEEEC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEEEECC-CCCEEEEEHHCCCCCCCCCCCCHHHHHHHHHHC----CCCCEEEEECCC
T ss_conf             266431045455446788888757999516-742542101174356875456356777788753----479879997355


Q ss_pred             CCHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHCCCCEEEEECCCCCCC-HHHCCCCCHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             62289999997608957799806976246545640367289840560137-12103547467898885168865411157
Q gi|254780659|r  156 ETTSEKQCFAHFVDSRASLVVGTHTHIPTADAQILDGGTGYITDLGMCGD-YNSSIGLDKEEPINRFITQIPRNRFVIAN  234 (274)
Q Consensus       156 EaTSEK~A~g~~lDGrVsaVvGTHTHV~TaD~rILp~GTayiTDvGMtG~-~~SVIG~~~~~~i~rf~t~~p~~r~~~a~  234 (274)
                      ||||||+|||||||||||||+||||||||||+||||+|||||||+||||| |||||||+++++|+||++++|. ||++|+
T Consensus       160 EATSEK~Amg~~lDGrVsaVvGTHTHV~TaD~rILp~GTAyiTDvGMtG~~~dSVIG~~~e~~i~rf~t~~p~-rf~~a~  238 (281)
T 1t71_A          160 ETTSEKNAFCMAFDGYVTTIFGTHTHVPSADLRITPKGSAYITDVGMCGPGFGSVIGANPEQSIRLFCAGSRE-HFEVSK  238 (281)
T ss_dssp             SCHHHHHHHHHHHTTTSSEEEEESSSSCCTTCEECTTSCEEESCCCEEBCCTTSBTTBCHHHHHHHHTTCCCC-CCCBCC
T ss_pred             CHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCEECCCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCC-CCCCCC
T ss_conf             1178999999873698789985675622676647589819981486655886753254717899999718998-866689


Q ss_pred             CCEEEEEEEEEEECCCCCEEEEEEEEECCCCCCCCCCCCC
Q ss_conf             8719999999984799867467899876831657875349
Q gi|254780659|r  235 GPATLCGICAEISDVTGLAEKIAPIRIGPRLSETRPDFWT  274 (274)
Q Consensus       235 g~~~l~gv~ieid~~tG~a~~I~ri~igg~L~e~~p~~~~  274 (274)
                      ++++|||++||+|++||||.+|+||||    .|..|.+|+
T Consensus       239 g~~~l~gv~i~id~~tgka~~Ieri~i----~ed~p~~~~  274 (281)
T 1t71_A          239 CGAQLNGVFFEVDVNTKKVIKTEAIRI----VEDDPRYLK  274 (281)
T ss_dssp             SCEEEEEEEEECCTTTCCCCEEEEEEE----EECCGGGTT
T ss_pred             CCCEEEEEEEEEECCCCCEEEEEEEEE----CCCCHHHHH
T ss_conf             986899999998889897678999996----167704888



>1t70_A Phosphatase; crystal, X-RAY crystallography, structural genomics, berkeley structural genomics center, BSGC, PSI; 2.30A {Deinococcus radiodurans R1} SCOP: d.159.1.9 Back     alignment and structure
>2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus HB8} SCOP: d.159.1.10 PDB: 2cv9_A Back     alignment and structure
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Back     alignment and structure
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus HB8} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Back     alignment and structure
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein structure initiative, PSI-2; 1.90A {Candida albicans SC5314} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC structure funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase, metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national project on protein structural and functional analyses; 1.60A {Aquifex aeolicus VF5} SCOP: d.159.1.6 Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>2iw0_A Chitin deacetylase; hydrolase, chitin DE-N-acetylase, family 4 carbohydrate esterase; 1.81A {Colletotrichum lindemuthianum} SCOP: c.6.2.3 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 274 hypothetical protein CLIBASIA_02730 [Candidatus Liberib
d1t71a_281 d.159.1.9 (A:) Hypothetical protein MPN349 {Mycoplasma 1e-81
d2z06a1252 d.159.1.10 (A:1-252) Hypothetical protein TTHA0625 {The 6e-79
d1t70a_255 d.159.1.9 (A:) Putative phosphatase DR1281 {Deinococcus 3e-78
>d1t71a_ d.159.1.9 (A:) Hypothetical protein MPN349 {Mycoplasma pneumoniae [TaxId: 2104]} Length = 281 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: DR1281-like
domain: Hypothetical protein MPN349
species: Mycoplasma pneumoniae [TaxId: 2104]
 Score =  296 bits (759), Expect = 1e-81
 Identities = 89/277 (32%), Positives = 135/277 (48%), Gaps = 14/277 (5%)

Query: 1   MRLLFLGDIVGKTGRSIVYEMLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGI 60
           ++ +FLGD+ GK GR+I+   L +L   +Q D VI N EN+  G G++ K +  + E G+
Sbjct: 5   IKFIFLGDVYGKAGRNIIKNNLAQLKSKYQADLVIVNAENTTHGKGLSLKHYEFLKEAGV 64

Query: 61  DVITTGNHVWDKREALVFSQRHCKFLRPANYPPN----TPGNGSGLYCAKNGSNVLVANI 116
           + IT GNH W ++  L         +RP N   +      G GS ++        +   +
Sbjct: 65  NYITMGNHTWFQKLDLAVVINKKDLVRPLNLDTSFAFHNLGQGSLVFEFNKAKIRITNLL 124

Query: 117 MGRVFMNPLLDDPFRTADKILATCPLKEQADVIVFDFHAETTSEKQCFAHFVDSRASLVV 176
              V +     +PF+   +++     K   D+ + DFHAETTSEK  F    D   + + 
Sbjct: 125 GTSVPLPFKTTNPFKVLKELIL----KRDCDLHIVDFHAETTSEKNAFCMAFDGYVTTIF 180

Query: 177 GTHTHIPTADAQILDGGTGYITDLGMCGD-YNSSIGLDKEEPINRFITQIPRNRFVIANG 235
           GTHTH+P+AD +I   G+ YITD+GMCG  + S IG + E+ I  F        F ++  
Sbjct: 181 GTHTHVPSADLRITPKGSAYITDVGMCGPGFGSVIGANPEQSIRLFCAGSRE-HFEVSKC 239

Query: 236 PATLCGICAEISDVTGLAEKIAPIRIGPRLSETRPDF 272
            A L G+  E+   T    K   IRI     E  P +
Sbjct: 240 GAQLNGVFFEVDVNTKKVIKTEAIRI----VEDDPRY 272


>d2z06a1 d.159.1.10 (A:1-252) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]} Length = 252 Back     information, alignment and structure
>d1t70a_ d.159.1.9 (A:) Putative phosphatase DR1281 {Deinococcus radiodurans [TaxId: 1299]} Length = 255 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target274 hypothetical protein CLIBASIA_02730 [Candidatus Liberib
d1t71a_281 Hypothetical protein MPN349 {Mycoplasma pneumoniae [Tax 100.0
d2z06a1252 Hypothetical protein TTHA0625 {Thermus thermophilus [Ta 100.0
d1t70a_255 Putative phosphatase DR1281 {Deinococcus radiodurans [T 100.0
d1usha2337 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal 98.96
d2z1aa2302 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal 98.88
d3c9fa2322 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal 98.77
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus jannas 97.02
d2qfra2312 Plant purple acid phosphatase, catalytic domain {Kidney 96.76
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus [TaxI 95.55
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycobacteri 94.84
d3d03a1271 Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [ 94.3
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} 95.24
d1ii7a_333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 93.34
>d1t71a_ d.159.1.9 (A:) Hypothetical protein MPN349 {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: DR1281-like
domain: Hypothetical protein MPN349
species: Mycoplasma pneumoniae [TaxId: 2104]
Probab=100.00  E-value=0  Score=808.25  Aligned_cols=263  Identities=35%  Similarity=0.604  Sum_probs=250.9

Q ss_pred             CEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCEEEECCEECCCCCCCCHHHHHHHHHCCCCEEEECHHHHCCCCHHHHHH
Q ss_conf             92699972027688999999808988860998999917004788678999999998379989993426530222047542
Q gi|254780659|r    1 MRLLFLGDIVGKTGRSIVYEMLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGIDVITTGNHVWDKREALVFSQ   80 (274)
Q Consensus         1 MkiLfiGDIvG~~Gr~~v~~~Lp~l~~~~~~DfvIaNgENaa~G~Git~~~~~~l~~~GvDviT~GNH~wd~kei~~~i~   80 (274)
                      |||||||||||+|||++|+++||+||++|++|||||||||||+|+|||+++|++|+++||||||+|||+|||||+++||+
T Consensus         5 MkILfiGDIvG~~GR~~v~~~Lp~Lr~~~~iDfVIaNgENaa~G~Git~k~~~eL~~~GvDvIT~GNH~wd~kei~~~i~   84 (281)
T d1t71a_           5 IKFIFLGDVYGKAGRNIIKNNLAQLKSKYQADLVIVNAENTTHGKGLSLKHYEFLKEAGVNYITMGNHTWFQKLDLAVVI   84 (281)
T ss_dssp             CEEEEECEEBHHHHHHHHHTTHHHHHHHHTCSEEEEECTBTTTTSSCCHHHHHHHHHHTCCEEECCTTTTCCGGGHHHHT
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCHHHHHHHHHHCCCEEECCCHHHHCHHHHHHHH
T ss_conf             46999971688889999999839999971999999887657899398999999999707867975724553314278776


Q ss_pred             HCCCEEEECCCCC----CCCCCCEEEEECCCCCEEEEEEEEHHHCCCC-CCCCHHHHHHHHHHHCCCCCCCCEEEEECCC
Q ss_conf             1893897500798----8875407999848992899999600005883-3259899999998634136899889996257
Q gi|254780659|r   81 RHCKFLRPANYPP----NTPGNGSGLYCAKNGSNVLVANIMGRVFMNP-LLDDPFRTADKILATCPLKEQADVIVFDFHA  155 (274)
Q Consensus        81 ~~~~ilRP~N~p~----~~PG~G~~i~~~~~g~ki~Vinl~Gr~fM~~-~~d~PF~~~d~~l~~~~~~~~~~~i~VDfHa  155 (274)
                      +++|||||+|||+    ++||+||.+++. ++.|++|+|||||+||.| .++|||..+++++.+    .++|+|||||||
T Consensus        85 ~~~~llRP~N~p~~~p~~~pG~G~~i~~~-~~~~i~Vinl~G~~fm~~~~~~~pf~~~~~~~~~----~~~d~i~VDfHa  159 (281)
T d1t71a_          85 NKKDLVRPLNLDTSFAFHNLGQGSLVFEF-NKAKIRITNLLGTSVPLPFKTTNPFKVLKELILK----RDCDLHIVDFHA  159 (281)
T ss_dssp             TCTTEECBSCBCTTSTTTTSSBSEEEEEC-SSCEEEEEEEECTTSCCSSCBCCHHHHHHHHHTT----CCCSEEEEEEEC
T ss_pred             HCCCCCCCCCCCCCCCCCCCCCEEEEEEC-CCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHCC----CCCCEEEEEECC
T ss_conf             13433115544333567999742899971-6543320122164224444563788777776404----678769998035


Q ss_pred             CCHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHCCCCEEEEECCCCCCC-HHHCCCCCHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             62289999997608957799806976246545640367289840560137-12103547467898885168865411157
Q gi|254780659|r  156 ETTSEKQCFAHFVDSRASLVVGTHTHIPTADAQILDGGTGYITDLGMCGD-YNSSIGLDKEEPINRFITQIPRNRFVIAN  234 (274)
Q Consensus       156 EaTSEK~A~g~~lDGrVsaVvGTHTHV~TaD~rILp~GTayiTDvGMtG~-~~SVIG~~~~~~i~rf~t~~p~~r~~~a~  234 (274)
                      ||||||+|||||||||||||+||||||||||+||||+|||||||+||||| |||||||++|.+|+||++++|. ||++|+
T Consensus       160 EATSEK~A~g~~lDGrvsaVvGTHTHV~TaD~rILp~GTAyiTDvGMtG~~ydSVIG~~~e~~i~rf~t~~p~-rf~~a~  238 (281)
T d1t71a_         160 ETTSEKNAFCMAFDGYVTTIFGTHTHVPSADLRITPKGSAYITDVGMCGPGFGSVIGANPEQSIRLFCAGSRE-HFEVSK  238 (281)
T ss_dssp             SCHHHHHHHHHHHTTTSSEEEEESSSSCCTTCEECTTSCEEESCCCEEBCCTTSBTTBCHHHHHHHHTTCCCC-CCCBCC
T ss_pred             CHHHHHHHHEEEECCCEEEEEECCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCC-CCCCCC
T ss_conf             1066552330440796899982575441576401267728983575544766742044707899999718997-766789


Q ss_pred             CCEEEEEEEEEEECCCCCEEEEEEEEECCCCCCCCCCCC
Q ss_conf             871999999998479986746789987683165787534
Q gi|254780659|r  235 GPATLCGICAEISDVTGLAEKIAPIRIGPRLSETRPDFW  273 (274)
Q Consensus       235 g~~~l~gv~ieid~~tG~a~~I~ri~igg~L~e~~p~~~  273 (274)
                      ++++|||+++|+|++||+|++|+||||    .|..|.|.
T Consensus       239 g~~~l~gv~i~id~~tg~a~~I~ri~i----~ed~p~~l  273 (281)
T d1t71a_         239 CGAQLNGVFFEVDVNTKKVIKTEAIRI----VEDDPRYL  273 (281)
T ss_dssp             SCEEEEEEEEECCTTTCCCCEEEEEEE----EECCGGGT
T ss_pred             CCCEEEEEEEEEECCCCCEEEEEEEEE----ECCCHHHH
T ss_conf             987999999998889897368999997----05773478



>d2z06a1 d.159.1.10 (A:1-252) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t70a_ d.159.1.9 (A:) Putative phosphatase DR1281 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 274 hypothetical protein CLIBASIA_02730 [Candidatus Li
1t71_A_281 (A:) Phosphatase, conserved; crystal, X-RAY crysta 2e-38
2z06_A_252 (A:) Putative uncharacterized protein TTHA0625; me 9e-38
1t70_A_255 (A:) Phosphatase; crystal, X-RAY crystallography, 1e-36
>1t71_A (A:) Phosphatase, conserved; crystal, X-RAY crystallography, structural genomics, berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129}Length = 281 Back     alignment and structure
 Score =  153 bits (387), Expect = 2e-38
 Identities = 88/278 (31%), Positives = 134/278 (48%), Gaps = 10/278 (3%)

Query: 1   MRLLFLGDIVGKTGRSIVYEMLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGI 60
           ++ +FLGD+ GK GR+I+   L +L   +Q D VI N EN+  G G++ K +  + E G+
Sbjct: 5   IKFIFLGDVYGKAGRNIIKNNLAQLKSKYQADLVIVNAENTTHGKGLSLKHYEFLKEAGV 64

Query: 61  DVITTGNHVWDKREALVFSQRHCKFLRPANYPPNTPGNGSG---LYCAKNGSNVLVANIM 117
           + IT GNH W ++  L         +RP N   +   +  G   L    N + + + N++
Sbjct: 65  NYITMGNHTWFQKLDLAVVINKKDLVRPLNLDTSFAFHNLGQGSLVFEFNKAKIRITNLL 124

Query: 118 GRVFMNPL-LDDPFRTADKILATCPLKEQADVIVFDFHAETTSEKQCFAHFVDSRASLVV 176
           G     P    +PF+   +++         D+ + DFHAETTSEK  F    D   + + 
Sbjct: 125 GTSVPLPFKTTNPFKVLKELILKRD----CDLHIVDFHAETTSEKNAFCMAFDGYVTTIF 180

Query: 177 GTHTHIPTADAQILDGGTGYITDLGMCGDY-NSSIGLDKEEPINRFITQIPRNRFVIANG 235
           GTHTH+P+AD +I   G+ YITD+GMCG    S IG + E+ I  F        F ++  
Sbjct: 181 GTHTHVPSADLRITPKGSAYITDVGMCGPGFGSVIGANPEQSIRLFCAGSRE-HFEVSKC 239

Query: 236 PATLCGICAEISDVTGLAEKIAPIRIGPRLSETRPDFW 273
            A L G+  E+   T    K   IRI           +
Sbjct: 240 GAQLNGVFFEVDVNTKKVIKTEAIRIVEDDPRYLKQDY 277


>2z06_A (A:) Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus HB8}Length = 252 Back     alignment and structure
>1t70_A (A:) Phosphatase; crystal, X-RAY crystallography, structural genomics, berkeley structural genomics center, BSGC, PSI; 2.30A {Deinococcus radiodurans R1}Length = 255 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target274 hypothetical protein CLIBASIA_02730 [Candidatus Liberib
1t70_A_255 Phosphatase; crystal, X-RAY crystallography, struc 99.97
1t71_A_281 Phosphatase, conserved; crystal, X-RAY crystallogr 99.97
2z06_A_252 Putative uncharacterized protein TTHA0625; metal b 99.97
3ib7_A_23-284262 ICC protein; metallophosphoesterase, alpha-beta fo 97.19
1ute_A_313 Protein (II purple acid phosphatase); tartrate res 96.33
1hp1_A_1-327327 5'-nucleotidase; metallophosphatase, dinuclear, me 98.99
3ive_A_1-307307 Nucleotidase; structural genomics, PSI-2, protein 98.99
2z1a_A_1-327327 5'-nucleotidase; metal-binding, nucleotide-binding 98.89
3c9f_A_1-326326 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p 98.81
3jyf_A_339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n 98.78
3gve_A_341 YFKN protein; alpha-beta-BETA-alpha sandwich, stru 98.68
2wdc_A_1-358358 SOXB, sulfur oxidation protein SOXB; sulfur-sulfur 98.35
1ii7_A_333 MRE11 nuclease; RAD50, DNA double-strand break rep 97.84
2q8u_A_1-281281 Exonuclease, putative; TM1635, structural genomics 96.92
1xzw_A_122-426305 Purple acid phosphatase; hydrolase; HET: NAG FUC M 96.58
1uf3_A_228 Hypothetical protein TT1561; metallo-dependent pho 96.3
2qfp_A_115-424310 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 95.73
3d03_A_1-98_224-274149 Phosphohydrolase; glycerophosphodiesterase, metall 94.47
1s3l_A_190 Hypothetical protein MJ0936; phosphodiesterase, nu 91.46
2nxf_A_1-117_290-322150 Putative dimetal phosphatase; dinuclear metal cent 91.12
>1t70_A (A:) Phosphatase; crystal, X-RAY crystallography, structural genomics, berkeley structural genomics center, BSGC, PSI; 2.30A {Deinococcus radiodurans R1} Back     alignment and structure
Probab=99.97  E-value=8.9e-29  Score=206.95  Aligned_cols=250  Identities=40%  Similarity=0.699  Sum_probs=233.0

Q ss_pred             CEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCEEEECCEECCCCCCCCHHHHHHHHHCCCCEEEECHHHHCCCCHHHHHH
Q ss_conf             92699972027688999999808988860998999917004788678999999998379989993426530222047542
Q gi|254780659|r    1 MRLLFLGDIVGKTGRSIVYEMLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGIDVITTGNHVWDKREALVFSQ   80 (274)
Q Consensus         1 MkiLfiGDIvG~~Gr~~v~~~Lp~l~~~~~~DfvIaNgENaa~G~Git~~~~~~l~~~GvDviT~GNH~wd~kei~~~i~   80 (274)
                      |+||+++|+.|+.|...+...+.++|++.  |.+++|+|+.-.|.++....++.|.++|.|+.|.|||-||..++..+++
T Consensus         1 l~il~~~Dih~~~g~~~~~~~i~~~~~~~--d~l~v~~GD~~~g~~~~~~~~~~l~~~g~d~~~~GNHe~d~g~l~~~l~   78 (255)
T 1t70_A            1 MRVLFIGDVFGQPGRRVLQNHLPTIRPQF--DFVIVNMENSAGGFGMHRDAARGALEAGAGCLTLGNHAWHHKDIYPMLS   78 (255)
T ss_dssp             CEEEEECCBBHHHHHHHHHHHHHHHGGGC--SEEEEECTBTTTTSSCCHHHHHHHHHHTCSEEECCTTTTSSTTHHHHHH
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHHHC--CEEEECCCCCCCCCCCCHHHHHHHHHCCCCEEECCCHHHHCHHHHHHHH
T ss_conf             92999960789889999998708878609--8999998667888589999999999757867973605542423689986


Q ss_pred             HCCCEEEECCC--CCCCCCCCEEEEECCCCCEEEEEEEEHHHCCCCCCCCHHHHHHHHHHHCCCCCCCCEEEEECCCCCH
Q ss_conf             18938975007--9888754079998489928999996000058833259899999998634136899889996257622
Q gi|254780659|r   81 RHCKFLRPANY--PPNTPGNGSGLYCAKNGSNVLVANIMGRVFMNPLLDDPFRTADKILATCPLKEQADVIVFDFHAETT  158 (274)
Q Consensus        81 ~~~~ilRP~N~--p~~~PG~G~~i~~~~~g~ki~Vinl~Gr~fM~~~~d~PF~~~d~~l~~~~~~~~~~~i~VDfHaEaT  158 (274)
                      +.++-...+|.  ....+...|.+++ .+|.|++++.+.+..+..+ .+.+.+.+++++++    .++|.+++-+|.-..
T Consensus        79 ~~~~~~l~~n~~~~~~~~~~~~~i~~-~~g~ki~~~g~~~~~~~~~-~~~~~~~~~~~~~~----~~~D~vI~l~H~g~~  152 (255)
T 1t70_A           79 EDTYPIVRPLNYADPGTPGVGWRTFD-VNGEKLTVVNLLGRVFMEA-VDNPFRTMDALLER----DDLGTVFVDFHAEAT  152 (255)
T ss_dssp             TTCSCEECCSCCCCTTCSSCSEEEEE-CSSSEEEEEEEECCTTSCC-CSCHHHHHHHHTTC----SSCCEEEEEEECSCH
T ss_pred             HCCCCCCCHHCCCCCCCCCCEEEEEE-ECCCCEEEEEECCEECCCC-CCCHHHHHHHHHHH----CCCCEEEEECCCHHH
T ss_conf             30312363210777789985089995-0656399999705442676-66879999999864----568849999034048


Q ss_pred             HHHHHHHHHHCCCEEEEEECCCCCCCCHHHHCCCCEEEEECCCCCCCHHHCCCCCHHHHHHHHHHCCCCCCCCCCCCCEE
Q ss_conf             89999997608957799806976246545640367289840560137121035474678988851688654111578719
Q gi|254780659|r  159 SEKQCFAHFVDSRASLVVGTHTHIPTADAQILDGGTGYITDLGMCGDYNSSIGLDKEEPINRFITQIPRNRFVIANGPAT  238 (274)
Q Consensus       159 SEK~A~g~~lDGrVsaVvGTHTHV~TaD~rILp~GTayiTDvGMtG~~~SVIG~~~~~~i~rf~t~~p~~r~~~a~g~~~  238 (274)
                      .+..++..+++..|.+|+|.|||+++..+.+.+++..|.+..|..|.+.+.++...+....+++..+.. .|........
T Consensus       153 ~~~~~~~~~~~~gvDlilggH~H~~~~~~~~~~~~~~~~~~~g~~g~~~~~~~i~~~~~~~~~~~~~~~-~~~~~~~~~~  231 (255)
T 1t70_A          153 SEKEAMGWHLAGRVAAVIGTHTHVPTADTRILKGGTAYQTDAGFTGPHDSIIGSAIEGPLQRFLTERPH-RYGVAEGRAE  231 (255)
T ss_dssp             HHHHHHHHHHTTSSSEEEEESSCSCBSCCEEETTTEEEESCCCCBEESSSBTTBCSHHHHHHHHHCSCC-CCCBCCSCEE
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCCCCCCCEECCCCCEEEECCCCCCCHHHHCCCCHHHHHHHHHHCCCC-CCCCCCCCCE
T ss_conf             778888842348679998568553255326737785898248552053551376738899999718998-8756799879


Q ss_pred             EEEEEEEEECCCCCEEEEEEEEE
Q ss_conf             99999998479986746789987
Q gi|254780659|r  239 LCGICAEISDVTGLAEKIAPIRI  261 (274)
Q Consensus       239 l~gv~ieid~~tG~a~~I~ri~i  261 (274)
                      ++++.+++|+.  .+..++++|.
T Consensus       232 ~~~~~i~~d~~--~~~~~~~~~~  252 (255)
T 1t70_A          232 LNGVALHFEGG--KATAAERYRF  252 (255)
T ss_dssp             EEEEEEEEETT--EEEEEEEEEE
T ss_pred             EEEEEEEECCC--CEEEEEEEEE
T ss_conf             99999997799--7898899994



>1t71_A (A:) Phosphatase, conserved; crystal, X-RAY crystallography, structural genomics, berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} Back     alignment and structure
>2z06_A (A:) Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus HB8} Back     alignment and structure
>3ib7_A (A:23-284) ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, hydrolase; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>1ute_A (A:) Protein (II purple acid phosphatase); tartrate resistant acid phosphatase, metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} Back     alignment and structure
>1hp1_A (A:1-327) 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} Back     alignment and structure
>3ive_A (A:1-307) Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Back     alignment and structure
>2z1a_A (A:1-327) 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus HB8} Back     alignment and structure
>3c9f_A (A:1-326) 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein structure initiative, PSI-2; 1.90A {Candida albicans SC5314} Back     alignment and structure
>3jyf_A (A:) 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3gve_A (A:) YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} Back     alignment and structure
>2wdc_A (A:1-358) SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A Back     alignment and structure
>1ii7_A (A:) MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2q8u_A (A:1-281) Exonuclease, putative; TM1635, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 2.20A {Thermotoga maritima MSB8} Back     alignment and structure
>1xzw_A (A:122-426) Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} Back     alignment and structure
>1uf3_A (A:) Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} Back     alignment and structure
>2qfp_A (A:115-424) Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} Back     alignment and structure
>3d03_A (A:1-98,A:224-274) Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} Back     alignment and structure
>1s3l_A (A:) Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC structure funded by NIH; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>2nxf_A (A:1-117,A:290-322) Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} Back     alignment and structure