254780660

254780660

hypothetical protein CLIBASIA_02735

GeneID in NCBI database:8209663Locus tag:CLIBASIA_02735
Protein GI in NCBI database:254780660Protein Accession:YP_003065073.1
Gene range:-(612774, 613508)Protein Length:244aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized conserved protein
KEGG prediction:hypothetical protein
SEED prediction:FIG000859: hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:RuvABC plus a hypothetical
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----
MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSMPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIADDII
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHcccccccEEEEEEEEEcccccEEEEEEHHccHHHHHHHHHHHHHHccccccccccEEEEEccEEEEEEccccccHHHHHHHHHHccccEEEccccEEEEEEcHHHHHHHHHHHHHcccccEEEEEEEEccccEEcccHHHHHHHHHHHHHHcccccHHHHccccccccccc
ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHcHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccEEEEEEEEEcccEEEEEEEEEccHHHHHHHHHHHHHHcccEEccccccHHHEEEEEEEEEEHHHccHHHHHHHHHHHcccEEEccccEEEEEEcHHHHHHHHHHHHcccccccEEEEEEEEcccEEcccHHHHHHHHHHHHHHHccccEEEEEEcEEcccccc
MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAklsgqnplenpRLRLAIQNaknqsmpkENIERAIKKAgsddlgnytniryegygpeGVAIIIEALTDNRNRTASSIRSIFTkangslgstgstTRFFEQIGEIIyhsnigdsnlAMEVAIESDAFEVLFEDQEYIFycdfnnvgltsKKLEEKIGEAQSIKVIWKplnyirlsnADKVKSIIKMIENleddddvqsvYSNLEIADDII
maghsqfknimhrkeRKDALKSKIFSKLSREITvsaklsgqnplenpRLRLAIqnaknqsmpkeNIERAIKkagsddlgnyTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIftkangslgstgsTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVGLTSKKLEEKIGEAqsikviwkplnyirlsnADKVKSIIKMIEnleddddvqsvysnleiaddii
MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSMPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIADDII
*AGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSMPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIADDII
MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSMPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIADDII
*******************LKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSMPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSMPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIADDII
MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSMPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIADDII
MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSMPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIADDII

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target244 hypothetical protein CLIBASIA_02735 [Candidatus Liberib
315122156249 hypothetical protein CKC_02030 [Candidatus Liberibacter 1 1e-111
150397839248 hypothetical protein Smed_2641 [Sinorhizobium medicae W 1 3e-82
15966506248 hypothetical protein SMc03969 [Sinorhizobium meliloti 1 1 4e-82
227823323248 hypothetical protein NGR_c27950 [Sinorhizobium fredii N 1 2e-81
163758808248 hypothetical protein HPDFL43_15332 [Hoeflea phototrophi 1 3e-81
239832805248 conserved hypothetical protein [Ochrobactrum intermediu 1 1e-80
153008531248 hypothetical protein Oant_1200 [Ochrobactrum anthropi A 1 2e-80
222149669248 hypothetical protein Avi_3631 [Agrobacterium vitis S4] 1 2e-79
260167930248 hypothetical protein BruF5_06092 [Brucella sp. F5/99] L 1 3e-79
121602842248 hypothetical protein BARBAKC583_0163 [Bartonella bacill 1 4e-79
>gi|315122156|ref|YP_004062645.1| hypothetical protein CKC_02030 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 249 Back     alignment and organism information
 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/244 (79%), Positives = 222/244 (90%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRKERKDA++SKIFSKLSREITVSAKLSG NPLENPRLRLAIQNAK+QS
Sbjct: 1   MAGHSQFKNIMHRKERKDAMRSKIFSKLSREITVSAKLSGPNPLENPRLRLAIQNAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPKENIERAIKKAG++DL NYTNIRYEGYGPEG+AIIIE LTDNRNRTAS+IR+IFTKAN
Sbjct: 61  MPKENIERAIKKAGNNDLNNYTNIRYEGYGPEGIAIIIETLTDNRNRTASNIRAIFTKAN 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSLG+ GSTTRFFEQIGEIIYHS +GD + AME AIE  A E L ED+EYIF+CDF+NVG
Sbjct: 121 GSLGAIGSTTRFFEQIGEIIYHSTVGDPDTAMEAAIEVGANEFLDEDKEYIFHCDFSNVG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK+LE+K GEA+SIK+IWKPLN I++S+ +K KSIIKMI+N E+D+DVQ VYSNL+I 
Sbjct: 181 QISKQLEQKFGEAKSIKIIWKPLNLIQISDENKAKSIIKMIDNFENDEDVQDVYSNLDIP 240

Query: 241 DDII 244
           DDI+
Sbjct: 241 DDIM 244


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150397839|ref|YP_001328306.1| hypothetical protein Smed_2641 [Sinorhizobium medicae WSM419] Length = 248 Back     alignment and organism information
>gi|15966506|ref|NP_386859.1| hypothetical protein SMc03969 [Sinorhizobium meliloti 1021] Length = 248 Back     alignment and organism information
>gi|227823323|ref|YP_002827295.1| hypothetical protein NGR_c27950 [Sinorhizobium fredii NGR234] Length = 248 Back     alignment and organism information
>gi|163758808|ref|ZP_02165895.1| hypothetical protein HPDFL43_15332 [Hoeflea phototrophica DFL-43] Length = 248 Back     alignment and organism information
>gi|239832805|ref|ZP_04681134.1| conserved hypothetical protein [Ochrobactrum intermedium LMG 3301] Length = 248 Back     alignment and organism information
>gi|153008531|ref|YP_001369746.1| hypothetical protein Oant_1200 [Ochrobactrum anthropi ATCC 49188] Length = 248 Back     alignment and organism information
>gi|222149669|ref|YP_002550626.1| hypothetical protein Avi_3631 [Agrobacterium vitis S4] Length = 248 Back     alignment and organism information
>gi|260167930|ref|ZP_05754741.1| hypothetical protein BruF5_06092 [Brucella sp. F5/99] Length = 248 Back     alignment and organism information
>gi|121602842|ref|YP_988501.1| hypothetical protein BARBAKC583_0163 [Bartonella bacilliformis KC583] Length = 248 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target244 hypothetical protein CLIBASIA_02735 [Candidatus Liberib
PRK00110245 PRK00110, PRK00110, hypothetical protein; Validated 5e-91
COG0217241 COG0217, COG0217, Uncharacterized conserved protein [Fu 1e-73
TIGR01033238 TIGR01033, TIGR01033, DNA-binding regulatory protein, Y 1e-69
PRK12378235 PRK12378, PRK12378, hypothetical protein; Provisional 1e-60
KOG2972276 KOG2972, KOG2972, KOG2972, Uncharacterized conserved pr 3e-32
pfam01709234 pfam01709, DUF28, Domain of unknown function DUF28 1e-80
>gnl|CDD|178871 PRK00110, PRK00110, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|30566 COG0217, COG0217, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|162166 TIGR01033, TIGR01033, DNA-binding regulatory protein, YebC/PmpR family Back     alignment and domain information
>gnl|CDD|183483 PRK12378, PRK12378, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|38183 KOG2972, KOG2972, KOG2972, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|145061 pfam01709, DUF28, Domain of unknown function DUF28 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 244 hypothetical protein CLIBASIA_02735 [Candidatus Liberib
PRK00110239 hypothetical protein; Validated 100.0
COG0217241 Uncharacterized conserved protein [Function unknown] 100.0
pfam01709234 DUF28 Domain of unknown function DUF28. This domain is 100.0
PRK12378235 hypothetical protein; Provisional 100.0
KOG2972276 consensus 100.0
TIGR01033246 TIGR01033 conserved hypothetical protein TIGR01033; Int 100.0
PRK07562 1177 ribonucleotide-diphosphate reductase subunit alpha; Val 94.53
>PRK00110 hypothetical protein; Validated Back     alignment and domain information
>COG0217 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam01709 DUF28 Domain of unknown function DUF28 Back     alignment and domain information
>PRK12378 hypothetical protein; Provisional Back     alignment and domain information
>KOG2972 consensus Back     alignment and domain information
>TIGR01033 TIGR01033 conserved hypothetical protein TIGR01033; InterPro: IPR002876 This domain is found in bacteria, plants, and yeast proteins Back     alignment and domain information
>PRK07562 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target244 hypothetical protein CLIBASIA_02735 [Candidatus Liberib
1lfp_A249 Crystal Structure Of A Conserved Hypothetical Prote 2e-70
1kon_A249 Crystal Structure Of E.Coli Yebc Length = 249 1e-67
1mw7_A240 X-Ray Structure Of Y162_helpy Northeast Structural 1e-35
>gi|21730736|pdb|1LFP|A Chain A, Crystal Structure Of A Conserved Hypothetical Protein Aq1575 From Aquifex Aeolicus Length = 249 Back     alignment and structure
 Score =  269 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 96/244 (39%), Positives = 147/244 (60%), Gaps = 1/244 (0%)

Query: 2   AGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSM 61
           AGHS +  I H+K + DA + K+FSKL REI V+ +L G NP  NPRLR AI+ AK  + 
Sbjct: 2   AGHSHWAQIKHKKAKVDAQRGKLFSKLIREIIVATRLGGPNPEFNPRLRTAIEQAKKANX 61

Query: 62  PKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           P ENIERAIKK   + +   +  + YEGY P GVA+ + A TDNRNRT S +R +FTK  
Sbjct: 62  PWENIERAIKKGAGELEGEQFEEVIYEGYAPGGVAVXVLATTDNRNRTTSEVRHVFTKHG 121

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG++G  +  FE+ G I   +        +E AIE  A +V   ++ +I Y     + 
Sbjct: 122 GNLGASGCVSYLFERKGYIEVPAKEVSEEELLEKAIEVGAEDVQPGEEVHIIYTVPEELY 181

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
              + LE+     +  ++ WKP++ +++++ +  + +IK++  LE+ DDVQ V +N EI 
Sbjct: 182 EVKENLEKLGVPIEKAQITWKPISTVQINDEETAQKVIKLLNALEELDDVQQVIANFEIP 241

Query: 241 DDII 244
           ++I+
Sbjct: 242 EEIL 245


>gi|22219064|pdb|1KON|A Chain A, Crystal Structure Of E.Coli Yebc Length = 249 Back     alignment and structure
gi|28373800|pdb|1MW7|A Chain A, X-Ray Structure Of Y162_helpy Northeast Structural Genomics Consortium Target Pr6 Length = 240 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target244 hypothetical protein CLIBASIA_02735 [Candidatus Liberib
1lfp_A249 Hypothetical protein AQ_1575; NEW fold, thermostability 2e-73
1kon_A249 Protein YEBC, YEBC; alpha/beta, two-domains, montreal-k 4e-71
1mw7_A240 Hypothetical protein HP0162; structural genomics, PSI, 1e-62
>1lfp_A Hypothetical protein AQ_1575; NEW fold, thermostability, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; 1.72A {Aquifex aeolicus} SCOP: e.39.1.1 Length = 249 Back     alignment and structure
 Score =  270 bits (691), Expect = 2e-73
 Identities = 99/245 (40%), Positives = 150/245 (61%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS +  I H+K + DA + K+FSKL REI V+ +L G NP  NPRLR AI+ AK  +
Sbjct: 1   MAGHSHWAQIKHKKAKVDAQRGKLFSKLIREIIVATRLGGPNPEFNPRLRTAIEQAKKAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENIERAIKK   +  G  +  + YEGY P GVA+++ A TDNRNRT S +R +FTK 
Sbjct: 61  MPWENIERAIKKGAGELEGEQFEEVIYEGYAPGGVAVMVLATTDNRNRTTSEVRHVFTKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG++G  +  FE+ G I   +        +E AIE  A +V   ++ +I Y     +
Sbjct: 121 GGNLGASGCVSYLFERKGYIEVPAKEVSEEELLEKAIEVGAEDVQPGEEVHIIYTVPEEL 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + LE+     +  ++ WKP++ +++++ +  + +IK++  LE+ DDVQ V +N EI
Sbjct: 181 YEVKENLEKLGVPIEKAQITWKPISTVQINDEETAQKVIKLLNALEELDDVQQVIANFEI 240

Query: 240 ADDII 244
            ++I+
Sbjct: 241 PEEIL 245


>1kon_A Protein YEBC, YEBC; alpha/beta, two-domains, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics; 2.20A {Escherichia coli} SCOP: e.39.1.1 Length = 249 Back     alignment and structure
>1mw7_A Hypothetical protein HP0162; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Helicobacter pylori} SCOP: e.39.1.1 Length = 240 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target244 hypothetical protein CLIBASIA_02735 [Candidatus Liberib
1lfp_A249 Hypothetical protein AQ_1575; NEW fold, thermostability 100.0
1kon_A249 Protein YEBC, YEBC; alpha/beta, two-domains, montreal-k 100.0
1mw7_A240 Hypothetical protein HP0162; structural genomics, PSI, 100.0
>1lfp_A Hypothetical protein AQ_1575; NEW fold, thermostability, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; 1.72A {Aquifex aeolicus} SCOP: e.39.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=661.27  Aligned_cols=244  Identities=40%  Similarity=0.637  Sum_probs=238.6

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCC-CCC
Q ss_conf             9774112655646775578889799999999999998189994148999999999996688878999999850377-666
Q gi|254780660|r    1 MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSMPKENIERAIKKAGSD-DLG   79 (244)
Q Consensus         1 maGHsKW~nIkh~K~~~D~~k~k~f~k~~keI~~A~k~gG~dp~~N~~L~~ai~~Ak~~~mPk~~Ie~aIkk~~~~-~~~   79 (244)
                      ||||||||||||+||++|++||++|+||+|+|++|+|+|||||+.|||||+||++||++||||++|||||+||.|. +..
T Consensus         1 maGHsKW~~Ikh~K~~~D~~k~k~f~k~~r~I~~A~k~GG~dp~~N~~L~~ai~~Ak~~nmPk~~Ie~AIkk~~g~~~~~   80 (249)
T 1lfp_A            1 MAGHSHWAQIKHKKAKVDAQRGKLFSKLIREIIVATRLGGPNPEFNPRLRTAIEQAKKANMPWENIERAIKKGAGELEGE   80 (249)
T ss_dssp             ----CCSCCSSSSSSCTTTSHHHHHHHHHHHHHHHHHHHCSCGGGCHHHHHHHHHHHHTTCCHHHHHHHHHHHHSCSSSC
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCCCC
T ss_conf             99652666765688898999999999999999999972899976199999999999984999889999998504566666


Q ss_pred             CCCEEEEEEECCCCEEEEEEEECCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCEEEECCCCCCCHHHHHHHHCCC
Q ss_conf             64023678650599399999944630235899898764256831478860456864472797067753013667751268
Q gi|254780660|r   80 NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESD  159 (244)
Q Consensus        80 ~~~~~~yEg~gP~gvaiiVe~lTDN~nRt~~~vr~~f~K~gG~lg~~Gsv~~~F~~~G~i~~~~~~~d~d~~~e~aie~g  159 (244)
                      +|++++|||||||||+|||||||||+|||+++|||+|+|+||+||++|||+|||+|+|+|.++.+..++|.+++.+||+|
T Consensus        81 ~~~~~~yEg~gP~GvaiiVe~lTDN~nRt~~~vr~~f~K~gG~lg~~GsV~~~F~~~G~i~~~~~~~~ed~l~e~aie~g  160 (249)
T 1lfp_A           81 QFEEVIYEGYAPGGVAVMVLATTDNRNRTTSEVRHVFTKHGGNLGASGCVSYLFERKGYIEVPAKEVSEEELLEKAIEVG  160 (249)
T ss_dssp             CCEEEEEEEEETTTEEEEEEEEESCHHHHHHHHHHHHHHTTCEECCTTSSGGGEEEEEEEEEEGGGSCHHHHHHHHHHHT
T ss_pred             CEEEEEEEEECCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHEECCEEEECCCCCCHHHHHHHHHHCC
T ss_conf             60799999987888589999938877789999999998718814788505676101132762588776778899987369


Q ss_pred             CCCCCCCCCCEEEEECCCCHHHHHHHHHHCCCCCCCCEEEECCCCCEECCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             75223468825999643201345665420256742221786037610248989999999999875238881311025626
Q gi|254780660|r  160 AFEVLFEDQEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI  239 (244)
Q Consensus       160 a~Dv~~~d~~~~i~~~~~~~~~v~~~Le~~~~~~~~sei~~~P~~~V~l~d~e~~~~~~klie~Led~DDVq~VytN~~i  239 (244)
                      |+|++.+++.++|+|+|++|.+|+++|++.++.+++++++|+|+++|+|+++|+++++.+|+++|||+||||+||||++|
T Consensus       161 aedve~~e~~~~i~~~~~~~~~v~~~Le~~g~~i~~sei~~~P~~~v~l~dee~~~~~~kLid~Lee~dDVq~Vy~N~ei  240 (249)
T 1lfp_A          161 AEDVQPGEEVHIIYTVPEELYEVKENLEKLGVPIEKAQITWKPISTVQINDEETAQKVIKLLNALEELDDVQQVIANFEI  240 (249)
T ss_dssp             CSEEECCSSEEEEEECGGGHHHHHHHHHTTTCCCSEEEEEEEESSCEECCCHHHHHHHHHHHHHHHTSTTEEEEEECEEC
T ss_pred             CCCCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCCCCEEEEEECCCEECCCHHHHHHHHHHHHHHHCCCCCCCEEECCCC
T ss_conf             62001577518996079999999999987487612020268507834248799999999999987452170125367866


Q ss_pred             CCCCC
Q ss_conf             62439
Q gi|254780660|r  240 ADDII  244 (244)
Q Consensus       240 ~eeil  244 (244)
                      +||+|
T Consensus       241 ~ee~~  245 (249)
T 1lfp_A          241 PEEIL  245 (249)
T ss_dssp             CSCCS
T ss_pred             CHHHH
T ss_conf             99999



>1kon_A Protein YEBC, YEBC; alpha/beta, two-domains, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics; 2.20A {Escherichia coli} SCOP: e.39.1.1 Back     alignment and structure
>1mw7_A Hypothetical protein HP0162; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Helicobacter pylori} SCOP: e.39.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 244 hypothetical protein CLIBASIA_02735 [Candidatus Liberib
d1kona_244 e.39.1.1 (A:) Hypothetical protein YebC {Escherichia co 2e-61
d1lfpa_243 e.39.1.1 (A:) Hypothetical protein aq1575 {Aquifex aeol 2e-56
d1mw7a_220 e.39.1.1 (A:) Hypothetical protein HP0162 {Helicobacter 5e-44
>d1kona_ e.39.1.1 (A:) Hypothetical protein YebC {Escherichia coli [TaxId: 562]} Length = 244 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: YebC-like
superfamily: YebC-like
family: YebC-like
domain: Hypothetical protein YebC
species: Escherichia coli [TaxId: 562]
 Score =  229 bits (585), Expect = 2e-61
 Identities = 96/244 (39%), Positives = 140/244 (57%), Gaps = 5/244 (2%)

Query: 3   GHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSMP 62
           GHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A + +M 
Sbjct: 1   GHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNNMT 60

Query: 63  KENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKANG 121
           ++ + RAI +  G DD  N   I YEGYGP G AI+IE L+DNRNRT + +R  F+K  G
Sbjct: 61  RDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKCGG 120

Query: 122 SLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE-YIFYCDFNNVG 180
           +LG+ GS    F + G I +     D +  ME A+E+ A +V+  D      Y  +  +G
Sbjct: 121 NLGTDGSVAYLFSKKGVISFEKG--DEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEEMG 178

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
                LE    +A S +V   P     +  A+    ++++I+ LED DDVQ VY N EI+
Sbjct: 179 KVRDALEAAGLKADSAEVSMIPSTKADMD-AETAPKLMRLIDMLEDCDDVQEVYHNGEIS 237

Query: 241 DDII 244
           D++ 
Sbjct: 238 DEVA 241


>d1lfpa_ e.39.1.1 (A:) Hypothetical protein aq1575 {Aquifex aeolicus [TaxId: 63363]} Length = 243 Back     information, alignment and structure
>d1mw7a_ e.39.1.1 (A:) Hypothetical protein HP0162 {Helicobacter pylori [TaxId: 210]} Length = 220 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target244 hypothetical protein CLIBASIA_02735 [Candidatus Liberib
d1kona_244 Hypothetical protein YebC {Escherichia coli [TaxId: 562 100.0
d1lfpa_243 Hypothetical protein aq1575 {Aquifex aeolicus [TaxId: 6 100.0
d1mw7a_220 Hypothetical protein HP0162 {Helicobacter pylori [TaxId 100.0
>d1kona_ e.39.1.1 (A:) Hypothetical protein YebC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: YebC-like
superfamily: YebC-like
family: YebC-like
domain: Hypothetical protein YebC
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=638.83  Aligned_cols=239  Identities=39%  Similarity=0.633  Sum_probs=229.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCC-CCCCC
Q ss_conf             74112655646775578889799999999999998189994148999999999996688878999999850377-66664
Q gi|254780660|r    3 GHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSMPKENIERAIKKAGSD-DLGNY   81 (244)
Q Consensus         3 GHsKW~nIkh~K~~~D~~k~k~f~k~~keI~~A~k~gG~dp~~N~~L~~ai~~Ak~~~mPk~~Ie~aIkk~~~~-~~~~~   81 (244)
                      ||||||||||+|+++|++||++|+||+|+|++|||+|||||+.|+|||+||++||++||||++|||||+||.|. ...+|
T Consensus         1 GHsKW~nIkh~K~a~D~~k~k~f~k~~k~I~~A~k~GG~DP~~N~~L~~ai~~Ak~~nmPkd~IeraIkk~~g~~~~~~~   80 (244)
T d1kona_           1 GHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNNMTRDTLNRAIARGVGGDDDANM   80 (244)
T ss_dssp             CCCSGGGTSSSTTTTTSCHHHHHHHHHHHHHHHHHC-----CCSTTTHHHHHHHHHTTCCHHHHHHHHSCC------CCC
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCE
T ss_conf             98556666678899889999999999999999998179997619999999999988279657999999834587777743


Q ss_pred             CEEEEEEECCCCEEEEEEEECCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCEEEECCCCCCCHHHHHHHHCCCCC
Q ss_conf             02367865059939999994463023589989876425683147886045686447279706775301366775126875
Q gi|254780660|r   82 TNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAF  161 (244)
Q Consensus        82 ~~~~yEg~gP~gvaiiVe~lTDN~nRt~~~vr~~f~K~gG~lg~~Gsv~~~F~~~G~i~~~~~~~d~d~~~e~aie~ga~  161 (244)
                      ++++|||||||||+|||||||||+|||+++||++|+|+||+||++|||+|||+|+|+|.++..  ++|.+++++||+||+
T Consensus        81 ~e~~yEg~gp~gvaiiVe~lTDN~nRt~~~vR~~f~K~gG~lg~~GsV~~~F~~kG~i~~~~~--~~d~l~e~aie~gAe  158 (244)
T d1kona_          81 ETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKCGGNLGTDGSVAYLFSKKGVISFEKG--DEDTIMEAALEAGAE  158 (244)
T ss_dssp             EEEEEEEEETTTEEEEEEEEESCHHHHHHHHHHHHHTTTCEECCTTSSGGGEEEEEEEEESSS--CHHHHHHHHHHHTCS
T ss_pred             EEEEEEEECCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCEECCCCCHHHHHHEECEECCCCC--CHHHHHHHHHHHCCC
T ss_conf             799998886986389999962747779999999999749956788507456421010044789--989999999985042


Q ss_pred             CCCC-CCCCEEEEECCCCHHHHHHHHHHCCCCCCCCEEEECCCCCEECCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             2234-688259996432013456654202567422217860376102489899999999998752388813110256266
Q gi|254780660|r  162 EVLF-EDQEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA  240 (244)
Q Consensus       162 Dv~~-~d~~~~i~~~~~~~~~v~~~Le~~~~~~~~sei~~~P~~~V~l~d~e~~~~~~klie~Led~DDVq~VytN~~i~  240 (244)
                      |++. +++.++|+|+|++|.+|+++|++.++.+.+++|+|+|+++|+|++ |+++++.+|+|.|||+||||+||||++|+
T Consensus       159 Dv~~~d~~~~~i~~~~~dl~~v~~~Le~~g~~~~~aei~~~P~~~v~l~~-e~~~k~~kLid~Led~DDVq~Vy~N~~i~  237 (244)
T d1kona_         159 DVVTYDDGAIDVYTAWEEMGKVRDALEAAGLKADSAEVSMIPSTKADMDA-ETAPKLMRLIDMLEDCDDVQEVYHNGEIS  237 (244)
T ss_dssp             EEEECTTSCEEEEEEGGGHHHHHHHHHHTTCCCSEEEEEEEESSCCCCCT-TTSHHHHHHHHHHHHSSSEEEEEECCCCC
T ss_pred             HHCCCCCCCEEEEECCHHHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCH-HHHHHHHHHHHHHHCCCCCCEEEECCCCC
T ss_conf             00025777369994304399999999755887224369997688414399-99999999999874434734387888529


Q ss_pred             CCCC
Q ss_conf             2439
Q gi|254780660|r  241 DDII  244 (244)
Q Consensus       241 eeil  244 (244)
                      ||+|
T Consensus       238 ee~l  241 (244)
T d1kona_         238 DEVA  241 (244)
T ss_dssp             HHHH
T ss_pred             HHHH
T ss_conf             9998



>d1lfpa_ e.39.1.1 (A:) Hypothetical protein aq1575 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1mw7a_ e.39.1.1 (A:) Hypothetical protein HP0162 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 244 hypothetical protein CLIBASIA_02735 [Candidatus Li
1kon_A_1-7979 (A:1-79) Protein YEBC, YEBC; alpha/beta, two-domai 7e-27
1lfp_A_1-7878 (A:1-78) Hypothetical protein AQ_1575; NEW fold, t 2e-25
1mw7_A_1-7373 (A:1-73) Hypothetical protein HP0162; structural g 1e-23
1kon_A_80-132_208-24995 (A:80-132,A:208-249) Protein YEBC, YEBC; alpha/bet 9e-20
1lfp_A_79-129_206-24995 (A:79-129,A:206-249) Hypothetical protein AQ_1575; 3e-19
1mw7_A_74-126_210-24084 (A:74-126,A:210-240) Hypothetical protein HP0162; 1e-18
1kon_A_80-132_208-24995 (A:80-132,A:208-249) Protein YEBC, YEBC; alpha/bet 1e-07
1lfp_A_79-129_206-24995 (A:79-129,A:206-249) Hypothetical protein AQ_1575; 7e-08
1mw7_A_74-126_210-24084 (A:74-126,A:210-240) Hypothetical protein HP0162; 9e-06
1lfp_A_130-20576 (A:130-205) Hypothetical protein AQ_1575; NEW fold 1e-09
1mw7_A_127-20983 (A:127-209) Hypothetical protein HP0162; structura 7e-09
1kon_A_133-20775 (A:133-207) Protein YEBC, YEBC; alpha/beta, two-do 4e-07
>1kon_A (A:1-79) Protein YEBC, YEBC; alpha/beta, two-domains, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics; 2.20A {Escherichia coli}Length = 79 Back     alignment and structure
 Score =  115 bits (289), Expect = 7e-27
 Identities = 33/73 (45%), Positives = 49/73 (67%)

Query: 1  MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
          MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A + +
Sbjct: 4  MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNN 63

Query: 61 MPKENIERAIKKA 73
          M ++ + RAI + 
Sbjct: 64 MTRDTLNRAIARG 76


>1lfp_A (A:1-78) Hypothetical protein AQ_1575; NEW fold, thermostability, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; 1.72A {Aquifex aeolicus}Length = 78 Back     alignment and structure
>1mw7_A (A:1-73) Hypothetical protein HP0162; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Helicobacter pylori}Length = 73 Back     alignment and structure
>1kon_A (A:80-132,A:208-249) Protein YEBC, YEBC; alpha/beta, two-domains, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics; 2.20A {Escherichia coli}Length = 95 Back     alignment and structure
>1lfp_A (A:79-129,A:206-249) Hypothetical protein AQ_1575; NEW fold, thermostability, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; 1.72A {Aquifex aeolicus}Length = 95 Back     alignment and structure
>1mw7_A (A:74-126,A:210-240) Hypothetical protein HP0162; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Helicobacter pylori}Length = 84 Back     alignment and structure
>1kon_A (A:80-132,A:208-249) Protein YEBC, YEBC; alpha/beta, two-domains, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics; 2.20A {Escherichia coli}Length = 95 Back     alignment and structure
>1lfp_A (A:79-129,A:206-249) Hypothetical protein AQ_1575; NEW fold, thermostability, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; 1.72A {Aquifex aeolicus}Length = 95 Back     alignment and structure
>1mw7_A (A:74-126,A:210-240) Hypothetical protein HP0162; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Helicobacter pylori}Length = 84 Back     alignment and structure
>1lfp_A (A:130-205) Hypothetical protein AQ_1575; NEW fold, thermostability, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; 1.72A {Aquifex aeolicus}Length = 76 Back     alignment and structure
>1mw7_A (A:127-209) Hypothetical protein HP0162; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Helicobacter pylori}Length = 83 Back     alignment and structure
>1kon_A (A:133-207) Protein YEBC, YEBC; alpha/beta, two-domains, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics; 2.20A {Escherichia coli}Length = 75 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target244 hypothetical protein CLIBASIA_02735 [Candidatus Liberib
1lfp_A_79-129_206-24995 Hypothetical protein AQ_1575; NEW fold, thermostab 99.95
1kon_A_80-132_208-24995 Protein YEBC, YEBC; alpha/beta, two-domains, montr 99.94
1mw7_A_74-126_210-24084 Hypothetical protein HP0162; structural genomics, 99.93
1lfp_A_1-7878 Hypothetical protein AQ_1575; NEW fold, thermostab 99.95
1kon_A_1-7979 Protein YEBC, YEBC; alpha/beta, two-domains, montr 99.95
1mw7_A_1-7373 Hypothetical protein HP0162; structural genomics, 99.9
1lfp_A_130-20576 Hypothetical protein AQ_1575; NEW fold, thermostab 99.64
1mw7_A_127-20983 Hypothetical protein HP0162; structural genomics, 99.61
1kon_A_133-20775 Protein YEBC, YEBC; alpha/beta, two-domains, montr 99.56
>1lfp_A (A:79-129,A:206-249) Hypothetical protein AQ_1575; NEW fold, thermostability, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; 1.72A {Aquifex aeolicus} Back     alignment and structure
Probab=99.95  E-value=6.1e-28  Score=220.45  Aligned_cols=91  Identities=43%  Similarity=0.737  Sum_probs=84.6

Q ss_pred             CCCCCEEEEEEECCCCEEEEEEEECCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCEEEECCCCCCCHHHHHHHHC
Q ss_conf             66640236786505993999999446302358998987642568314788604568644727970677530136677512
Q gi|254780660|r   78 LGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIE  157 (244)
Q Consensus        78 ~~~~~~~~yEg~gP~gvaiiVe~lTDN~nRt~~~vr~~f~K~gG~lg~~Gsv~~~F~~~G~i~~~~~~~d~d~~~e~aie  157 (244)
                      +.+|++++|||||||||++||||||||+|||+++||++|+|+||+||++||.                            
T Consensus         1 g~~y~ei~YEg~gPgGvaiiVe~lTDN~nRT~~~vR~~f~K~gG~l~~~Gst----------------------------   52 (95)
T 1lfp_A            1 GEQFEEVIYEGYAPGGVAVXVLATTDNRNRTTSEVRHVFTKHGGNLGASGCT----------------------------   52 (95)
T ss_dssp             SCCCEEEEEEEEETTTEEEEEEEEESCHHHHHHHHHHHHHHTTCEECCTTSC----------------------------
T ss_pred             CCCEEEEEEEEECCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCEECCCCCC----------------------------
T ss_conf             6661799999987888589999927877779999999987249726788734----------------------------


Q ss_pred             CCCCCCCCCCCCEEEEECCCCHHHHHHHHHHCCCCCCCCEEEECCCCCEECCCHHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             68752234688259996432013456654202567422217860376102489899999999998752388813110256
Q gi|254780660|r  158 SDAFEVLFEDQEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL  237 (244)
Q Consensus       158 ~ga~Dv~~~d~~~~i~~~~~~~~~v~~~Le~~~~~~~~sei~~~P~~~V~l~d~e~~~~~~klie~Led~DDVq~VytN~  237 (244)
                                                                     ++++ ++|+++++++|+|+|||+||||+||||+
T Consensus        53 -----------------------------------------------~v~~-~~e~~~k~~klid~Led~DDVQ~Vy~N~   84 (95)
T 1lfp_A           53 -----------------------------------------------VQIN-DEETAQKVIKLLNALEELDDVQQVIANF   84 (95)
T ss_dssp             -----------------------------------------------EECC-CHHHHHHHHHHHHHHHTSTTEEEEEECE
T ss_pred             -----------------------------------------------EECC-CHHHHHHHHHHHHHHHCCCCCCCEEECC
T ss_conf             -----------------------------------------------3158-8999999999999874531701264778


Q ss_pred             CCCCCCC
Q ss_conf             2662439
Q gi|254780660|r  238 EIADDII  244 (244)
Q Consensus       238 ~i~eeil  244 (244)
                      +++|++|
T Consensus        85 e~~de~~   91 (95)
T 1lfp_A           85 EIPEEIL   91 (95)
T ss_dssp             ECCSCCS
T ss_pred             CCCHHHH
T ss_conf             6599999



>1kon_A (A:80-132,A:208-249) Protein YEBC, YEBC; alpha/beta, two-domains, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics; 2.20A {Escherichia coli} Back     alignment and structure
>1mw7_A (A:74-126,A:210-240) Hypothetical protein HP0162; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Helicobacter pylori} Back     alignment and structure
>1lfp_A (A:1-78) Hypothetical protein AQ_1575; NEW fold, thermostability, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; 1.72A {Aquifex aeolicus} Back     alignment and structure
>1kon_A (A:1-79) Protein YEBC, YEBC; alpha/beta, two-domains, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics; 2.20A {Escherichia coli} Back     alignment and structure
>1mw7_A (A:1-73) Hypothetical protein HP0162; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Helicobacter pylori} Back     alignment and structure
>1lfp_A (A:130-205) Hypothetical protein AQ_1575; NEW fold, thermostability, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; 1.72A {Aquifex aeolicus} Back     alignment and structure
>1mw7_A (A:127-209) Hypothetical protein HP0162; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Helicobacter pylori} Back     alignment and structure
>1kon_A (A:133-207) Protein YEBC, YEBC; alpha/beta, two-domains, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics; 2.20A {Escherichia coli} Back     alignment and structure