254780661

254780661

exonuclease I

GeneID in NCBI database:8209665Locus tag:CLIBASIA_02740
Protein GI in NCBI database:254780661Protein Accession:YP_003065074.1
Gene range:+(610788, 612203)Protein Length:471aa
Gene description:exonuclease I
COG prediction:[L] Exonuclease I
KEGG prediction:sbcB; exonuclease I (EC:3.1.11.1); K01141 exodeoxyribonuclease I [EC:3.1.11.1]
SEED prediction:Exodeoxyribonuclease I (EC 3.1.11.1)
Pathway involved in KEGG:Mismatch repair [PATH:las03430]
Subsystem involved in SEED:DNA Repair Base Excision
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-
MTNHFVIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFITGITPQKALRDGVVEAEFSRRIHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNFYDSYRWSWDNGNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHVNAHDAKADVYATLALVWLIREKKPKLFEYLYDYRNKNQLRKLIDIQNMTPLVHVSGMFGASRSNTALIAPVAWHPRYKDSVIGCNLSGDMRVFQDLDSVQLAKRLFTSHDELKGLVPVPIKEVHLNKCPILMPIDYCKKEHFERWGIDHKRCLENLTLLRQQTNLRDRFKAIYNKPYTSSSQDVDSQLYDGFFADVDRQIMDRILRTAPEQLSTLNLPFSDRRLPELFFRYRARNFPHTLSEKEKQDWLEHRKKMLTRSRIEEYKNKLQSLSGEYKGDEGKEGLINALYEYLQWVIPKE
ccccEEEEEEEcccccccccccEEEEEEEEcccccccccccEEEEcccccccccccEEEEccccHHHHHHHcccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHcccHHHHHcccccccccHHHHHHHHHHHcHHcccccccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccEEEcccccccccccEEEEEEEcccccccEEEEEEccccHHHHHcccHHHHHHHccccHHHHccccccccEEEEEcccHHHccHHcccHHHHHHccccHHHHHHHHHHHHHcHHHHHHHHHHHHcccccccccHHHHHHcccccHHHHHHHHHHHcccHHHHHHccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccc
cccEEEEEEccccccccccccccHEcEEEcccccccccccEEEEEcccccccccccEEEEccccHHHHHHccccHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHccccHHHHHHcccccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcHHHHHHHccccccccEEEEcccccccccccEEEEEcccccccccEEEEEEcccccHHHHcccHHHHHHHHcccHHHHccccccccEEEEEccccEEEEcccccHHHHHHccccHHHHHHHHHHHHHcHHHHHHHHHHHccccccccccHHHHHHcccccHHHHHHHHHHHHccHHHHHHHccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccc
MTNHFVIYDYetfgrdvaldrpaqfagvrvdrqwekiestevffckpaddylpdpeavfitgitpqkalrdGVVEAEFSRRIhqffsvpntciigynnirfddyysrnifyrNFYDSyrwswdngnsrWDLLDVMRAIYafspdgiqwpsrddgatsfkLQDLALANGIEHVNAHDAKADVYATLALVWLIREKKPKLFEYLYDYRNKNQLRKLidiqnmtplvhvsgmfgasrsntaliapvawhprykdsvigcnlsgdmrvfqdLDSVQLAKRLFTSHdelkglvpvpikevhlnkcpilmpidyckkehferwgiDHKRCLENLTLLRQQTNLRDRFKAiynkpytsssqdvdsqlydgffADVDRQIMDRILRTApeqlstlnlpfsdrrlpELFFRYrarnfphtlseKEKQDWLEHRKKMLTRSRIEEYKNKLQSLsgeykgdegkeGLINALYEYLQWVIPKE
MTNHFVIYDYetfgrdvaldrpAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFITGITPQKALRDGVVEAEFSRrihqffsvpntciigynniRFDDYYSRNIFYRNFYDSYRWSWDNGNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHVNAHDAKADVYATLALVWLIREKKPKLFEYLYDYRNKNQLRKLIDIQNMTPLVHVSGMFGASRSNTALIAPVAWHPRYKDSVIGCNLSGDMRVFQDLDSVQLAKRLFTShdelkglvpvpikevhlnkcPILMPIDYCKKEHFERWGIDHKRCLENLTLLRQQTNLRDRFKAIYnkpytsssqdvdsqLYDGFFADVDRQIMDRILRTapeqlstlnlpfsdrRLPELFFRYRARnfphtlsekekqdWLEHRKKMltrsrieeyknklqslsgeykgdegkeGLINALYEYLQWVIPKE
MTNHFVIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFITGITPQKALRDGVVEAEFSRRIHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNFYDSYRWSWDNGNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHVNAHDAKADVYATLALVWLIREKKPKLFEYLYDYRNKNQLRKLIDIQNMTPLVHVSGMFGASRSNTALIAPVAWHPRYKDSVIGCNLSGDMRVFQDLDSVQLAKRLFTSHDELKGLVPVPIKEVHLNKCPILMPIDYCKKEHFERWGIDHKRCLENLTLLRQQTNLRDRFKAIYNKPYTSSSQDVDSQLYDGFFADVDRQIMDRILRTAPEQLSTLNLPFSDRRLPELFFRYRARNFPHTLSEKEKQDWLEHRKKMLTRSRIEEYKNKLQSLSGEYKGDEGKEGLINALYEYLQWVIPKE
*TNHFVIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFITGITPQKALRDGVVEAEFSRRIHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNFYDSYRWSWDNGNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHVNAHDAKADVYATLALVWLIREKKPKLFEYLYDYRNKNQLRKLIDIQNMTPLVHVSGMFGASRSNTALIAPVAWHPRYKDSVIGCNLSGDMRVFQDLDSVQLAKRLFTSHDELKGLVPVPIKEVHLNKCPILMPIDYCKKEHFERWGIDHKRCLENLTLLRQQTNLRDRFKAIYNKPYTSSSQDVDSQLYDGFFADVDRQIMDRILRTAPEQLSTLNLPFSDRRLPELFFRYRARNFPHTLSEKEKQDWLEHRKKMLTRSRIEEYKNKLQSLSGE*KGDEGKEGLINALYEYLQWVIP**
MTNHFVIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFITGITPQKALRDGVVEAEFSRRIHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNFYDSYRWSWDNGNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHVNAHDAKADVYATLALVWLIREKKPKLFEYLYDYRNKNQLRKLIDIQNMTPLVHVSGMFGASRSNTALIAPVAWHPRYKDSVIGCNLSGDMRVFQDLDSVQLAKRLFTSHDELKGLVPVPIKEVHLNKCPILMPIDYCKKEHFERWGIDHKRCLENLTLLRQQTNLRDRFKAIYNKPYTSSSQDVDSQLYDGFFADVDRQIMDRILRTAPEQLSTLNLPFSDRRLPELFFRYRARNFPHTLSEKEKQDWLEHRKKMLTRSRIEEYKNKLQSLSGEYKGDEGKEGLINALYEYLQWVIPKE
*TNHFVIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFITGITPQKALRDGVVEAEFSRRIHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNFYDSYRWSWDNGNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHVNAHDAKADVYATLALVWLIREKKPKLFEYLYDYRNKNQLRKLIDIQNMTPLVHVSGMFGASRSNTALIAPVAWHPRYKDSVIGCNLSGDMRVFQDLDSVQLAKRLFTSHDELKGLVPVPIKEVHLNKCPILMPIDYCKKEHFERWGIDHKRCLENLTLLRQQTNLRDRFKAIYNKPYTSSSQDVDSQLYDGFFADVDRQIMDRILRTAPEQLSTLNLPFSDRRLPELFFRYRARNFPHTLSEKEKQDWLEHRKKMLTRSRIEEYKNKLQSLSGEYKGDEGKEGLINALYEYLQWVIPK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTNHFVIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFITGITPQKALRDGVVEAEFSRRIHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNFYDSYRWSWDNGNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHVNAHDAKADVYATLALVWLIREKKPKLFEYLYDYRNKNQLRKLIDIQNMTPLVHVSGMFGASRSNTALIAPVAWHPRYKDSVIGCNLSGDMRVFQDLDSVQLAKRLFTSHDELKGLVPVPIKEVHLNKCPILMPIDYCKKEHFERWGIDHKRCLENLTLLRQQTNLRDRFKAIYNKPYTSSSQDVDSQLYDGFFADVDRQIMDRILRTAPEQLSTLNLPFSDRRLPELFFRYRARNFPHTLSEKEKQDWLEHRKxxxxxxxxxxxxxxxxxxxxxxxxxxxxEGLINALYEYLQWVIPKE
MTNHFVIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFITGITPQKALRDGVVEAEFSRRIHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNFYDSYRWSWDNGNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHVNAHDAKADVYATLALVWLIREKKPKLFEYLYDYRNKNQLRKLIDIQNMTPLVHVSGMFGASRSNTALIAPVAWHPRYKDSVIGCNLSGDMRVFQDLDSVQLAKRLFTSHDELKGLVPVPIKEVHLNKCPILMPIDYCKKEHFERWGIDHKRCLENLTLLRQQTNLRDRFKAIYNKPYTSSSQDVDSQLYDGFFADVDRQIMDRILRTAPEQLSTLNLPFSDRRLPELFFRYRARNFPHTLSEKEKQDWLEHRKKMLTRSRIEEYKNKLQSLSGEYKGDEGKEGLINALYEYLQWVIPKE
MTNHFVIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFITGITPQKALRDGVVEAEFSRRIHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNFYDSYRWSWDNGNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHVNAHDAKADVYATLALVWLIREKKPKLFEYLYDYRNKNQLRKLIDIQNMTPLVHVSGMFGASRSNTALIAPVAWHPRYKDSVIGCNLSGDMRVFQDLDSVQLAKRLFTSHDELKGLVPVPIKEVHLNKCPILMPIDYCKKEHFERWGIDHKRCLENLTLLRQQTNLRDRFKAIYNKPYTSSSQDVDSQLYDGFFADVDRQIMDRILRTAPEQLSTLNLPFSDRRLPELFFRYRARNFPHTLSEKEKQDWLEHRKKMLTRSRIEEYKNKLQSLSGEYKGDEGKEGLINALYEYLQWVIPKE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target471 exonuclease I [Candidatus Liberibacter asiaticus str. p
315122155472 exonuclease I [Candidatus Liberibacter solanacearum CLs 1 0.0
85059110473 exonuclease I [Sodalis glossinidius str. 'morsitans'] L 1 1e-166
238789860476 Exodeoxyribonuclease I [Yersinia frederiksenii ATCC 336 1 1e-156
259908083475 exonuclease I [Erwinia pyrifoliae Ep1/96] Length = 475 1 1e-155
153949389476 exonuclease I [Yersinia pseudotuberculosis IP 31758] Le 1 1e-154
238749982476 Exodeoxyribonuclease I [Yersinia rohdei ATCC 43380] Len 1 1e-154
51595906476 exonuclease I [Yersinia pseudotuberculosis IP 32953] Le 1 1e-154
310768007475 exonuclease I [Erwinia sp. Ejp617] Length = 475 1 1e-154
294635527473 exodeoxyribonuclease I [Edwardsiella tarda ATCC 23685] 1 1e-154
188533503475 exonuclease I [Erwinia tasmaniensis Et1/99] Length = 47 1 1e-154
>gi|315122155|ref|YP_004062644.1| exonuclease I [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 472 Back     alignment and organism information
 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/468 (69%), Positives = 386/468 (82%)

Query: 3   NHFVIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFITG 62
           +HFVIYDYETFG DVA DRPAQFAG+R+D Q E I+S EVFFCKP+DDYL DPE+V ITG
Sbjct: 2   DHFVIYDYETFGLDVARDRPAQFAGIRIDHQLETIQSKEVFFCKPSDDYLVDPESVLITG 61

Query: 63  ITPQKALRDGVVEAEFSRRIHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNFYDSYRWSW 122
           ITPQKALRDGVVE EF++R++QFF  PNTCI GYNNIRFDD YS+NIFYRNFYD Y WS+
Sbjct: 62  ITPQKALRDGVVEHEFAQRVYQFFCKPNTCIFGYNNIRFDDKYSQNIFYRNFYDPYGWSY 121

Query: 123 DNGNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHVNAHDAKADVY 182
            NGNSRWDL++VMRAIYAFSPDGIQWP RDDG  SFKLQDLALANGIE+VNAHDA+ DV 
Sbjct: 122 KNGNSRWDLINVMRAIYAFSPDGIQWPHRDDGFPSFKLQDLALANGIEYVNAHDAEQDVD 181

Query: 183 ATLALVWLIREKKPKLFEYLYDYRNKNQLRKLIDIQNMTPLVHVSGMFGASRSNTALIAP 242
           ATLAL  L+R +KPKLF YLY+ RNK  L+ LIDI+N+TPLVHVS  FGA+++NTALIAP
Sbjct: 182 ATLALARLVRREKPKLFNYLYNSRNKMHLKSLIDIRNLTPLVHVSSKFGAAQANTALIAP 241

Query: 243 VAWHPRYKDSVIGCNLSGDMRVFQDLDSVQLAKRLFTSHDELKGLVPVPIKEVHLNKCPI 302
           +AWHPR  + +I CNLSGDM+V QDLDS++L KRLFT HD+L GL PVP+K VH+N+CP+
Sbjct: 242 IAWHPRNANEIIACNLSGDMQVLQDLDSIELGKRLFTRHDQLNGLSPVPLKSVHINRCPV 301

Query: 303 LMPIDYCKKEHFERWGIDHKRCLENLTLLRQQTNLRDRFKAIYNKPYTSSSQDVDSQLYD 362
           L PI     + FER GID KRC++NL LLRQQ +L+++  AIY+KP+ S S+DVDS+LYD
Sbjct: 302 LFPIGSFHSKKFERLGIDDKRCVDNLKLLRQQVDLQEKVIAIYDKPFVSLSEDVDSRLYD 361

Query: 363 GFFADVDRQIMDRILRTAPEQLSTLNLPFSDRRLPELFFRYRARNFPHTLSEKEKQDWLE 422
           GF +D D ++ D I  T PE+LSTLN  F+D+RLPEL FRYRARNFPHTL  KEKQ WLE
Sbjct: 362 GFLSDEDCKMRDCIPLTEPEKLSTLNFQFTDQRLPELLFRYRARNFPHTLDSKEKQAWLE 421

Query: 423 HRKKMLTRSRIEEYKNKLQSLSGEYKGDEGKEGLINALYEYLQWVIPK 470
           HRK + TRSRIEEY+NKL +L   YK +E +E L+  L++YLQ ++PK
Sbjct: 422 HRKAIFTRSRIEEYENKLHTLLNAYKSNEREERLVQLLFDYLQLIVPK 469


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|85059110|ref|YP_454812.1| exonuclease I [Sodalis glossinidius str. 'morsitans'] Length = 473 Back     alignment and organism information
>gi|238789860|ref|ZP_04633641.1| Exodeoxyribonuclease I [Yersinia frederiksenii ATCC 33641] Length = 476 Back     alignment and organism information
>gi|259908083|ref|YP_002648439.1| exonuclease I [Erwinia pyrifoliae Ep1/96] Length = 475 Back     alignment and organism information
>gi|153949389|ref|YP_001401389.1| exonuclease I [Yersinia pseudotuberculosis IP 31758] Length = 476 Back     alignment and organism information
>gi|238749982|ref|ZP_04611486.1| Exodeoxyribonuclease I [Yersinia rohdei ATCC 43380] Length = 476 Back     alignment and organism information
>gi|51595906|ref|YP_070097.1| exonuclease I [Yersinia pseudotuberculosis IP 32953] Length = 476 Back     alignment and organism information
>gi|310768007|gb|ADP12957.1| exonuclease I [Erwinia sp. Ejp617] Length = 475 Back     alignment and organism information
>gi|294635527|ref|ZP_06714007.1| exodeoxyribonuclease I [Edwardsiella tarda ATCC 23685] Length = 473 Back     alignment and organism information
>gi|188533503|ref|YP_001907300.1| exonuclease I [Erwinia tasmaniensis Et1/99] Length = 475 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target471 exonuclease I [Candidatus Liberibacter asiaticus str. p
PRK11779476 PRK11779, sbcB, exonuclease I; Provisional 0.0
COG2925475 COG2925, SbcB, Exonuclease I [DNA replication, recombin 1e-169
pfam08411268 pfam08411, Exonuc_X-T_C, Exonuclease C-terminal 1e-90
cd06138183 cd06138, ExoI_N, N-terminal DEDDh 3'-5' exonuclease dom 7e-80
pfam00929162 pfam00929, Exonuc_X-T, Exonuclease 5e-15
cd06127159 cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family 5e-14
TIGR01407 850 TIGR01407, dinG_rel, DnaQ family exonuclease/DinG famil 9e-08
smart00479169 smart00479, EXOIII, exonuclease domain in DNA-polymeras 7e-05
TIGR01405 1213 TIGR01405, polC_Gram_pos, DNA polymerase III, alpha cha 2e-04
COG2176 1444 COG2176, PolC, DNA polymerase III, alpha subunit (gram- 9e-04
PRK07942232 PRK07942, PRK07942, DNA polymerase III subunit epsilon; 0.001
COG0847243 COG0847, DnaQ, DNA polymerase III, epsilon subunit and 0.002
>gnl|CDD|183310 PRK11779, sbcB, exonuclease I; Provisional Back     alignment and domain information
>gnl|CDD|32749 COG2925, SbcB, Exonuclease I [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|149465 pfam08411, Exonuc_X-T_C, Exonuclease C-terminal Back     alignment and domain information
>gnl|CDD|99841 cd06138, ExoI_N, N-terminal DEDDh 3'-5' exonuclease domain of Escherichia coli exonuclease I and similar proteins Back     alignment and domain information
>gnl|CDD|144506 pfam00929, Exonuc_X-T, Exonuclease Back     alignment and domain information
>gnl|CDD|176648 cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family Back     alignment and domain information
>gnl|CDD|162341 TIGR01407, dinG_rel, DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>gnl|CDD|128755 smart00479, EXOIII, exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases Back     alignment and domain information
>gnl|CDD|162340 TIGR01405, polC_Gram_pos, DNA polymerase III, alpha chain, Gram-positive type Back     alignment and domain information
>gnl|CDD|32359 COG2176, PolC, DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|181176 PRK07942, PRK07942, DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|31188 COG0847, DnaQ, DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 471 exonuclease I [Candidatus Liberibacter asiaticus str. p
PRK11779477 sbcB exonuclease I; Provisional 100.0
COG2925475 SbcB Exonuclease I [DNA replication, recombination, and 100.0
TIGR01405 1264 polC_Gram_pos DNA polymerase III, alpha subunit, Gram-p 100.0
COG2176 1444 PolC DNA polymerase III, alpha subunit (gram-positive t 100.0
pfam08411268 Exonuc_X-T_C Exonuclease C-terminal. This bacterial dom 100.0
cd06138183 ExoI_N This subfamily is composed of the N-terminal dom 100.0
PRK08074 932 bifunctional ATP-dependent DNA helicase/DNA polymerase 100.0
PRK08517259 DNA polymerase III subunit epsilon; Provisional 100.0
TIGR01407 944 dinG_rel DnaQ family exonuclease/DinG family helicase, 100.0
PRK06309232 DNA polymerase III subunit epsilon; Validated 100.0
PRK00448 1436 polC DNA polymerase III PolC; Validated 100.0
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polymerase 100.0
PRK07883 575 hypothetical protein; Validated 100.0
PRK07740240 hypothetical protein; Provisional 100.0
PRK07942234 DNA polymerase III subunit epsilon; Provisional 100.0
PRK09145203 DNA polymerase III subunit epsilon; Validated 99.97
PRK07247195 DNA polymerase III subunit epsilon; Validated 99.97
PRK06063313 DNA polymerase III subunit epsilon; Provisional 99.97
PRK06631229 consensus 99.97
cd06136177 TREX1_2 Three prime repair exonuclease (TREX) 1 and 2 a 99.97
cd06131167 DNA_pol_III_epsilon_Ecoli_like This subfamily is compos 99.96
smart00479169 EXOIII exonuclease domain in DNA-polymerase alpha and e 99.96
PRK06195309 DNA polymerase III subunit epsilon; Validated 99.96
PRK06022234 consensus 99.96
cd06134189 RNaseT RNase T is a DEDDh-type DnaQ-like 3'-5' exoribon 99.96
PRK05711240 DNA polymerase III subunit epsilon; Provisional 99.96
cd06130156 DNA_pol_III_epsilon_like This subfamily is composed of 99.96
PRK08858246 consensus 99.96
PRK07009241 consensus 99.96
pfam00929162 Exonuc_X-T Exonuclease. This family includes a variety 99.95
cd06133176 ERI-1_3'hExo_like This subfamily is composed of Caenorh 99.95
PRK06859253 consensus 99.95
PRK05168213 ribonuclease T; Provisional 99.95
PRK08816244 consensus 99.95
PRK07982243 consensus 99.95
cd06127159 DEDDh DEDDh exonucleases, part of the DnaQ-like (or DED 99.95
PRK09146239 DNA polymerase III subunit epsilon; Validated 99.93
TIGR00573228 dnaq exonuclease, DNA polymerase III, epsilon subunit f 99.9
COG0847243 DnaQ DNA polymerase III, epsilon subunit and related 3' 99.89
PRK09182293 DNA polymerase III subunit epsilon; Validated 99.86
PRK07748205 sporulation inhibitor KapD; Provisional 99.81
cd06135173 Orn Oligoribonuclease (Orn) is a DEDDh-type DnaQ-like 3 99.74
PRK05359181 oligoribonuclease; Provisional 99.65
cd06144152 REX4_like This subfamily is composed of RNA exonuclease 99.65
TIGR01298201 RNaseT ribonuclease T; InterPro: IPR005987 Ribonuclease 99.49
PRK05601377 DNA polymerase III subunit epsilon; Validated 99.45
COG1949184 Orn Oligoribonuclease (3'-5' exoribonuclease) [RNA proc 99.38
cd06149157 ISG20 Interferon (IFN) Stimulated Gene product of 20 kD 99.09
cd05782208 DNA_polB_like1_exo A subfamily of the 3'-5' exonuclease 99.03
cd06137161 DEDDh_RNase This group is composed of eukaryotic exorib 99.01
KOG3242208 consensus 98.88
cd05781188 DNA_polB_B3_exo The 3'-5' exonuclease domain of archaea 98.83
cd06139193 DNA_polA_I_Ecoli_like_exo The 3'-5' exonuclease domain 98.82
COG5018210 KapD Inhibitor of the KinA pathway to sporulation, pred 98.77
cd05785207 DNA_polB_like2_exo A subfamily of the 3'-5' exonuclease 98.74
KOG0542280 consensus 98.74
cd05779204 DNA_polB_epsilon_exo The 3'-5' exonuclease domain of eu 98.74
KOG4793318 consensus 98.66
cd06145150 REX1_like This subfamily is composed of RNA exonuclease 98.6
pfam04857235 CAF1 CAF1 family ribonuclease. The major pathways of mR 98.59
KOG2249280 consensus 98.57
COG3359278 Predicted exonuclease [DNA replication, recombination, 98.57
cd05160200 DNA_polB_exo The 3'-5' exonuclease domain of family-B D 98.52
cd06126181 DEDDy DEDDy exonucleases, part of the DnaQ-like (or DED 98.46
PTZ00315570 2'-phosphotransferase; Provisional 98.35
cd05780195 DNA_polB_Kod1_like_exo The 3'-5' exonuclease domain of 98.32
cd05777230 DNA_polB_delta_exo The 3'-5' exonuclease domain of euka 98.32
pfam10108211 Exon_PolB Predicted 3'-5' exonuclease related to the ex 98.23
cd06128166 DNA_polA_exo The 3'-5' exonuclease domain of family-A D 98.22
PRK05762 785 DNA polymerase II; Reviewed 98.17
PTZ00166 1081 DNA polymerase delta catalytic subunit; Provisional 98.15
cd00007155 35EXOc 3'-5' exonuclease. The 35EXOc domain is responsi 98.14
KOG0304239 consensus 98.09
PRK06887 954 consensus 98.07
smart00486471 POLBc DNA polymerase type-B family. DNA polymerase alph 98.01
pfam01612172 3_5_exonuc 3'-5' exonuclease. This domain is responsibl 98.0
KOG2248380 consensus 98.0
cd05784193 DNA_polB_II_exo The 3'-5' exonuclease domain of Escheri 97.95
PRK05755 889 DNA polymerase I; Provisional 97.9
cd06143174 PAN2_exo PAN2 is the catalytic subunit of poly(A) nucle 97.89
PRK07456 975 consensus 97.79
cd06142178 RNaseD_exo Ribonuclease (RNase) D is a bacterial enzyme 97.76
smart00474172 35EXOc 3'-5' exonuclease. 3\' -5' exonuclease proofread 97.71
PRK07556 977 consensus 97.7
cd06140178 DNA_polA_I_Bacillus_like_exo Bacillus stearothermophilu 97.57
PRK07997 928 consensus 97.48
PRK08835 931 consensus 97.46
PRK07625 922 consensus 97.4
PRK08786 927 consensus 97.28
PRK05797 869 consensus 97.14
PRK08434 887 consensus 96.94
KOG1798 2173 consensus 96.93
COG0417 792 PolB DNA polymerase elongation subunit (family B) [DNA 96.67
cd06147192 Rrp6p_like_exo Yeast Rrp6p and its human homolog, the P 96.11
COG0749 593 PolA DNA polymerase I - 3'-5' exonuclease and polymeras 95.79
PRK07898 902 consensus 95.01
KOG4793318 consensus 94.48
COG5228299 POP2 mRNA deadenylase subunit [RNA processing and modif 94.37
cd06129159 RNaseD_like The RNase D-like group is composed of RNase 92.11
COG0349361 Rnd Ribonuclease D [Translation, ribosomal structure an 91.97
PRK08076 877 consensus 90.78
PRK06807313 DNA polymerase III subunit epsilon; Validated 100.0
TIGR01406246 dnaQ_proteo DNA polymerase III, epsilon subunit; InterP 99.94
PRK06310250 DNA polymerase III subunit epsilon; Validated 100.0
PRK07983219 exodeoxyribonuclease X; Provisional 99.92
cd06125130 DnaQ_like_exo The DnaQ-like exonuclease superfamily is 99.82
pfam03104254 DNA_pol_B_exo DNA polymerase family B, exonuclease doma 98.13
cd05778231 DNA_polB_zeta_exo The 3'-5' exonuclease domain of eukar 97.91
cd05783204 DNA_polB_B1_exo The 3'-5' exonuclease domain of Sulfolo 97.77
cd05776234 DNA_polB_alpha_exo The 3'-5' exonuclease domain of euka 97.46
pfam11074127 DUF2779 Domain of unknown function(DUF2779). This domai 91.76
PRK06722242 exonuclease; Provisional 99.62
PRK05761 777 DNA polymerase I; Reviewed 95.23
cd06141168 WRN_exo WRN is a unique RecQ DNA helicase exhibiting an 91.08
>PRK11779 sbcB exonuclease I; Provisional Back     alignment and domain information
>COG2925 SbcB Exonuclease I [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha subunit, Gram-positive type; InterPro: IPR006308 These are the polypeptide chains of DNA polymerase III Back     alignment and domain information
>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam08411 Exonuc_X-T_C Exonuclease C-terminal Back     alignment and domain information
>cd06138 ExoI_N This subfamily is composed of the N-terminal domain of E Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK08517 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative; InterPro: IPR006310 These are a family of proteins in Gram-positive bacteria Back     alignment and domain information
>PRK06309 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK00448 polC DNA polymerase III PolC; Validated Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07883 hypothetical protein; Validated Back     alignment and domain information
>PRK07740 hypothetical protein; Provisional Back     alignment and domain information
>PRK07942 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK09145 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07247 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK06063 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK06631 consensus Back     alignment and domain information
>cd06136 TREX1_2 Three prime repair exonuclease (TREX) 1 and 2 are closely related DEDDh-type DnaQ-like 3'-5' exonucleases Back     alignment and domain information
>cd06131 DNA_pol_III_epsilon_Ecoli_like This subfamily is composed of the epsilon subunit of Escherichia coli DNA polymerase III (polIII) and similar proteins Back     alignment and domain information
>smart00479 EXOIII exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases Back     alignment and domain information
>PRK06195 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK06022 consensus Back     alignment and domain information
>cd06134 RNaseT RNase T is a DEDDh-type DnaQ-like 3'-5' exoribonuclease E implicated in the 3' maturation of small stable RNAs and 23srRNA, and in the end turnover of tRNA Back     alignment and domain information
>PRK05711 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>cd06130 DNA_pol_III_epsilon_like This subfamily is composed of uncharacterized bacterial proteins with similarity to the epsilon subunit of DNA polymerase III (polIII), a multisubunit polymerase which is the main DNA replicating enzyme in bacteria, functioning as the chromosomal replicase Back     alignment and domain information
>PRK08858 consensus Back     alignment and domain information
>PRK07009 consensus Back     alignment and domain information
>pfam00929 Exonuc_X-T Exonuclease Back     alignment and domain information
>cd06133 ERI-1_3'hExo_like This subfamily is composed of Caenorhabditis elegans ERI-1, human 3' exonuclease (3'hExo), Drosophila exonuclease snipper (snp), and similar proteins from eukaryotes and bacteria Back     alignment and domain information
>PRK06859 consensus Back     alignment and domain information
>PRK05168 ribonuclease T; Provisional Back     alignment and domain information
>PRK08816 consensus Back     alignment and domain information
>PRK07982 consensus Back     alignment and domain information
>cd06127 DEDDh DEDDh exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction Back     alignment and domain information
>PRK09146 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR00573 dnaq exonuclease, DNA polymerase III, epsilon subunit family; InterPro: IPR006054 All proteins in this entry for which functions are known are components of the DNA polymerase III complex (epsilon subunit) Back     alignment and domain information
>COG0847 DnaQ DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09182 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07748 sporulation inhibitor KapD; Provisional Back     alignment and domain information
>cd06135 Orn Oligoribonuclease (Orn) is a DEDDh-type DnaQ-like 3'-5' exoribonuclease that is responsible for degrading small oligoribonucleotides to mononucleotides Back     alignment and domain information
>PRK05359 oligoribonuclease; Provisional Back     alignment and domain information
>cd06144 REX4_like This subfamily is composed of RNA exonuclease 4 (REX4 or Rex4p), XPMC2, Interferon (IFN) Stimulated Gene product of 20 kDa (ISG20), and similar proteins Back     alignment and domain information
>TIGR01298 RNaseT ribonuclease T; InterPro: IPR005987 Ribonuclease T (3 Back     alignment and domain information
>PRK05601 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG1949 Orn Oligoribonuclease (3'-5' exoribonuclease) [RNA processing and modification] Back     alignment and domain information
>cd06149 ISG20 Interferon (IFN) Stimulated Gene product of 20 kDa (ISG20) is an IFN-induced antiviral exonuclease with a strong preference for single-stranded RNA and minor activity towards single-stranded DNA Back     alignment and domain information
>cd05782 DNA_polB_like1_exo A subfamily of the 3'-5' exonuclease domain of family-B DNA polymerases Back     alignment and domain information
>cd06137 DEDDh_RNase This group is composed of eukaryotic exoribonucleases that include PAN2, RNA exonuclease 1 (REX1 or Rex1p), REX3 (Rex3p), REX4 (or Rex4p), ISG20, and similar proteins Back     alignment and domain information
>KOG3242 consensus Back     alignment and domain information
>cd05781 DNA_polB_B3_exo The 3'-5' exonuclease domain of archaeal proteins with similarity to Sulfurisphaera ohwakuensis DNA polymerase B3 Back     alignment and domain information
>cd06139 DNA_polA_I_Ecoli_like_exo The 3'-5' exonuclease domain of DNA polymerases has a fundamental role in reducing polymerase errors and is involved in proofreading activity Back     alignment and domain information
>COG5018 KapD Inhibitor of the KinA pathway to sporulation, predicted exonuclease [General function prediction only] Back     alignment and domain information
>cd05785 DNA_polB_like2_exo A subfamily of the 3'-5' exonuclease domain of family-B DNA polymerases Back     alignment and domain information
>KOG0542 consensus Back     alignment and domain information
>cd05779 DNA_polB_epsilon_exo The 3'-5' exonuclease domain of eukaryotic DNA polymerase epsilon Back     alignment and domain information
>KOG4793 consensus Back     alignment and domain information
>cd06145 REX1_like This subfamily is composed of RNA exonuclease 1 (REX1 or Rex1p), REX3 (or Rex3p), and similar eukaryotic proteins Back     alignment and domain information
>pfam04857 CAF1 CAF1 family ribonuclease Back     alignment and domain information
>KOG2249 consensus Back     alignment and domain information
>COG3359 Predicted exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>cd05160 DNA_polB_exo The 3'-5' exonuclease domain of family-B DNA polymerases Back     alignment and domain information
>cd06126 DEDDy DEDDy exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction Back     alignment and domain information
>PTZ00315 2'-phosphotransferase; Provisional Back     alignment and domain information
>cd05780 DNA_polB_Kod1_like_exo The 3'-5' exonuclease domain of archaeal family-B DNA polymerases with similarity to Pyrococcus kodakaraensis Kod1, including polymerases from Desulfurococcus (D Back     alignment and domain information
>cd05777 DNA_polB_delta_exo The 3'-5' exonuclease domain of eukaryotic DNA polymerase delta Back     alignment and domain information
>pfam10108 Exon_PolB Predicted 3'-5' exonuclease related to the exonuclease domain of PolB Back     alignment and domain information
>cd06128 DNA_polA_exo The 3'-5' exonuclease domain of family-A DNA polymerases has a fundamental role in reducing polymerase errors and is involved in proofreading activity Back     alignment and domain information
>PRK05762 DNA polymerase II; Reviewed Back     alignment and domain information
>PTZ00166 DNA polymerase delta catalytic subunit; Provisional Back     alignment and domain information
>cd00007 35EXOc 3'-5' exonuclease Back     alignment and domain information
>KOG0304 consensus Back     alignment and domain information
>PRK06887 consensus Back     alignment and domain information
>smart00486 POLBc DNA polymerase type-B family Back     alignment and domain information
>pfam01612 3_5_exonuc 3'-5' exonuclease Back     alignment and domain information
>KOG2248 consensus Back     alignment and domain information
>cd05784 DNA_polB_II_exo The 3'-5' exonuclease domain of Escherichia coli DNA polymerase II (PolII) and similar bacterial proteins Back     alignment and domain information
>PRK05755 DNA polymerase I; Provisional Back     alignment and domain information
>cd06143 PAN2_exo PAN2 is the catalytic subunit of poly(A) nuclease (PAN), a Pab1p-dependent 3'-5' exoribonuclease which plays an important role in the posttranscriptional maturation of pre-mRNAs Back     alignment and domain information
>PRK07456 consensus Back     alignment and domain information
>cd06142 RNaseD_exo Ribonuclease (RNase) D is a bacterial enzyme involved in the maturation of small stable RNAs and the 3' maturation of tRNA Back     alignment and domain information
>smart00474 35EXOc 3'-5' exonuclease Back     alignment and domain information
>PRK07556 consensus Back     alignment and domain information
>cd06140 DNA_polA_I_Bacillus_like_exo Bacillus stearothermophilus-like Polymerase I (pol I), a subgroup of the family-A DNA polymerases, contains an inactive DnaQ-like 3'-5' exonuclease domain in the same polypeptide chain as the polymerase region Back     alignment and domain information
>PRK07997 consensus Back     alignment and domain information
>PRK08835 consensus Back     alignment and domain information
>PRK07625 consensus Back     alignment and domain information
>PRK08786 consensus Back     alignment and domain information
>PRK05797 consensus Back     alignment and domain information
>PRK08434 consensus Back     alignment and domain information
>KOG1798 consensus Back     alignment and domain information
>COG0417 PolB DNA polymerase elongation subunit (family B) [DNA replication, recombination, and repair] Back     alignment and domain information
>cd06147 Rrp6p_like_exo Yeast Rrp6p and its human homolog, the Polymyositis/scleroderma autoantigen 100kDa (PM/Scl-100), are exosome-associated proteins involved in the degradation and processing of precursors to stable RNAs Back     alignment and domain information
>COG0749 PolA DNA polymerase I - 3'-5' exonuclease and polymerase domains [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07898 consensus Back     alignment and domain information
>KOG4793 consensus Back     alignment and domain information
>COG5228 POP2 mRNA deadenylase subunit [RNA processing and modification] Back     alignment and domain information
>cd06129 RNaseD_like The RNase D-like group is composed of RNase D, WRN, and similar proteins Back     alignment and domain information
>COG0349 Rnd Ribonuclease D [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08076 consensus Back     alignment and domain information
>PRK06807 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR01406 dnaQ_proteo DNA polymerase III, epsilon subunit; InterPro: IPR006309 These represent DnaQ, the DNA polymerase III epsilon subunit, as found in most Proteobacteria Back     alignment and domain information
>PRK06310 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07983 exodeoxyribonuclease X; Provisional Back     alignment and domain information
>cd06125 DnaQ_like_exo The DnaQ-like exonuclease superfamily is a structurally conserved group of 3'-5' exonucleases, which catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction Back     alignment and domain information
>pfam03104 DNA_pol_B_exo DNA polymerase family B, exonuclease domain Back     alignment and domain information
>cd05778 DNA_polB_zeta_exo The 3'-5' exonuclease domain of eukaryotic DNA polymerase zeta Back     alignment and domain information
>cd05783 DNA_polB_B1_exo The 3'-5' exonuclease domain of Sulfolobus solfataricus DNA polymerase B1 and similar archaeal proteins Back     alignment and domain information
>cd05776 DNA_polB_alpha_exo The 3'-5' exonuclease domain of eukaryotic DNA polymerase alpha Back     alignment and domain information
>pfam11074 DUF2779 Domain of unknown function(DUF2779) Back     alignment and domain information
>PRK06722 exonuclease; Provisional Back     alignment and domain information
>PRK05761 DNA polymerase I; Reviewed Back     alignment and domain information
>cd06141 WRN_exo WRN is a unique RecQ DNA helicase exhibiting an exonuclease activity Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target471 exonuclease I [Candidatus Liberibacter asiaticus str. p
1fxx_A482 The Structure Of Exonuclease I Suggests How Process 1e-110
2p1j_A186 Crystal Structure Of A Polc-Type Dna Polymerase Iii 4e-20
2gui_A194 Structure And Function Of Cyclized Versions Of The 2e-12
1j53_A186 Structure Of The N-Terminal Exonuclease Domain Of T 2e-12
3nh0_A235 Crystal Structure Of Rnase T In Complex With A Non- 2e-09
3ngy_A235 Crystal Structure Of Rnase T (E92g Mutant) Length = 2e-08
2is3_A215 Crystal Structure Of Escherichia Coli Rnase T Lengt 3e-08
1y97_A238 The Human Trex2 3' Exonuclease Structure Suggests A 6e-06
2f96_A224 2.1 A Crystal Structure Of Pseudomonas Aeruginosa R 2e-05
2xri_A224 Crystal Structure Of Human Eri1 Exoribonuclease 3 L 1e-04
2o4g_A247 Structure Of Trex1 In Complex With A Nucleotide Len 2e-04
2oa8_A233 Crystal Structure Of Mtrex1 With Ssdna Length = 233 0.001
2ioc_B242 The Crystal Structure Of Trex1 Explains The 3' Nucl 0.001
2igi_A180 Crystal Structure Of E. Coli Oligoribonuclease Leng 5e-06
1yta_A180 Crystal Structure Of Oligoribonuclease, The Lone Es 9e-06
2gbz_A194 The Crystal Structure Of Xc847 From Xanthomonas Cam 1e-05
1j9a_A184 Oligoribonuclease Length = 184 8e-05
1zbh_A299 3'-End Specific Recognition Of Histone Mrna Stem-Lo 0.001
1zbu_A349 Crystal Structure Of Full-Length 3'-Exonuclease Len 0.001
2o4i_A247 Structure Of Trex1 In Complex With Dna Length = 247 0.003
>gi|12084680|pdb|1FXX|A Chain A, The Structure Of Exonuclease I Suggests How Processivity Is Achieved Length = 482 Back     alignment and structure
 Score =  402 bits (1032), Expect = e-110,   Method: Composition-based stats.
 Identities = 244/475 (51%), Positives = 329/475 (69%), Gaps = 7/475 (1%)

Query: 1   MTN------HFVIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPD 54
           M N       F+ +DYETFG   ALDRPAQFA +R D ++  I   EVF+CKPADDYLP 
Sbjct: 1   MMNDGKQQSTFLFHDYETFGTHPALDRPAQFAAIRTDSEFNVIGEPEVFYCKPADDYLPQ 60

Query: 55  PEAVFITGITPQKALRDGVVEAEFSRRIHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNF 114
           P AV ITGITPQ+A   G  EA F+ RIH  F+VP TCI+GYNN+RFDD  +RNIFYRNF
Sbjct: 61  PGAVLITGITPQEARAKGENEAAFAARIHSLFTVPKTCILGYNNVRFDDEVTRNIFYRNF 120

Query: 115 YDSYRWSWDNGNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHVNA 174
           YD Y WSW + NSRWDLLDVMRA YA  P+GI WP  DDG  SF+L+ L  ANGIEH NA
Sbjct: 121 YDPYAWSWQHDNSRWDLLDVMRACYALRPEGINWPENDDGLPSFRLEHLTKANGIEHSNA 180

Query: 175 HDAKADVYATLALVWLIREKKPKLFEYLYDYRNKNQLRKLIDIQNMTPLVHVSGMFGASR 234
           HDA ADVYAT+A+  L++ ++P+LF+YL+ +RNK++L  LID+  M PLVHVSGMFGA R
Sbjct: 181 HDAMADVYATIAMAKLVKTRQPRLFDYLFTHRNKHKLMALIDVPQMKPLVHVSGMFGAWR 240

Query: 235 SNTALIAPVAWHPRYKDSVIGCNLSGDMRVFQDLDSVQLAKRLFTSHDELKGLVPVPIKE 294
            NT+ +AP+AWHP  +++VI  +L+GD+    +LDS  L +RL+T+  +L     VP+K 
Sbjct: 241 GNTSWVAPLAWHPENRNAVIMVDLAGDISPLLELDSDTLRERLYTAKTDLGDNAAVPVKL 300

Query: 295 VHLNKCPILMPIDYCKKEHFERWGIDHKRCLENLTLLRQQTNLRDRFKAIYNK-PYTSSS 353
           VH+NKCP+L   +  + E  +R GI+ + CL+NL +LR+   +R++  AI+ +    + S
Sbjct: 301 VHINKCPVLAQANTLRPEDADRLGINRQHCLDNLKILRENPQVREKVVAIFAEAEPFTPS 360

Query: 354 QDVDSQLYDGFFADVDRQIMDRILRTAPEQLSTLNLPFSDRRLPELFFRYRARNFPHTLS 413
            +VD+QLY+GFF+D DR  M  +L T P  L  L++ F D+R+ +L F YRARNFP TL 
Sbjct: 361 DNVDAQLYNGFFSDADRAAMKIVLETEPRNLPALDITFVDKRIEKLLFNYRARNFPGTLD 420

Query: 414 EKEKQDWLEHRKKMLTRSRIEEYKNKLQSLSGEYKGDEGKEGLINALYEYLQWVI 468
             E+Q WLEHR+++ T   ++ Y ++LQ L  +Y  D+ K  L+ AL++Y   ++
Sbjct: 421 YAEQQRWLEHRRQVFTPEFLQGYADELQMLVQQYADDKEKVALLKALWQYADEIV 475


>gi|145580424|pdb|2P1J|A Chain A, Crystal Structure Of A Polc-Type Dna Polymerase Iii Exonuclease Domain From Thermotoga Maritima Length = 186 Back     alignment and structure
>gi|145579465|pdb|2GUI|A Chain A, Structure And Function Of Cyclized Versions Of The Proofread Exonuclease Subunit Of E. Coli Dna Polymerase Iii Length = 194 Back     alignment and structure
>gi|24987377|pdb|1J53|A Chain A, Structure Of The N-Terminal Exonuclease Domain Of The Epsilon Subunit Of E.Coli Dna Polymerase Iii At Ph 8.5 Length = 186 Back     alignment and structure
>gi|323462912|pdb|3NH0|A Chain A, Crystal Structure Of Rnase T In Complex With A Non-Preferred Ssdna (Aac) Length = 235 Back     alignment and structure
>gi|323462903|pdb|3NGY|A Chain A, Crystal Structure Of Rnase T (E92g Mutant) Length = 235 Back     alignment and structure
>gi|146386891|pdb|2IS3|A Chain A, Crystal Structure Of Escherichia Coli Rnase T Length = 215 Back     alignment and structure
>gi|60594178|pdb|1Y97|A Chain A, The Human Trex2 3' Exonuclease Structure Suggests A Mechanism For Efficient Non-Processive Dna Catalysis Length = 238 Back     alignment and structure
>gi|90109308|pdb|2F96|A Chain A, 2.1 A Crystal Structure Of Pseudomonas Aeruginosa Rnase T (Ribonuclease T) Length = 224 Back     alignment and structure
>gi|307776322|pdb|2XRI|A Chain A, Crystal Structure Of Human Eri1 Exoribonuclease 3 Length = 224 Back     alignment and structure
>gi|145579949|pdb|2O4G|A Chain A, Structure Of Trex1 In Complex With A Nucleotide Length = 247 Back     alignment and structure
>gi|134105090|pdb|2OA8|A Chain A, Crystal Structure Of Mtrex1 With Ssdna Length = 233 Back     alignment and structure
>gi|134104561|pdb|2IOC|B Chain B, The Crystal Structure Of Trex1 Explains The 3' Nucleotide Specificity And Reveals A Polyproline Ii Helix For Protein Partenring Length = 242 Back     alignment and structure
>gi|158428766|pdb|2IGI|A Chain A, Crystal Structure Of E. Coli Oligoribonuclease Length = 180 Back     alignment and structure
>gi|90108543|pdb|1YTA|A Chain A, Crystal Structure Of Oligoribonuclease, The Lone Essential Exoribonuclease In Escherichia Coli Length = 180 Back     alignment and structure
gi|126030541|pdb|2GBZ|A Chain A, The Crystal Structure Of Xc847 From Xanthomonas Campestris: A 3-5 Oligoribonuclease Of Dnaq Fold Family With A Novel Opposingly-Shifted Helix Length = 194 Back     alignment and structure
>gi|33357113|pdb|1J9A|A Chain A, Oligoribonuclease Length = 184 Back     alignment and structure
>gi|116666689|pdb|1ZBH|A Chain A, 3'-End Specific Recognition Of Histone Mrna Stem-Loop By 3'- Exonuclease Length = 299 Back     alignment and structure
>gi|116666695|pdb|1ZBU|A Chain A, Crystal Structure Of Full-Length 3'-Exonuclease Length = 349 Back     alignment and structure
>gi|145579953|pdb|2O4I|A Chain A, Structure Of Trex1 In Complex With Dna Length = 247 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target471 exonuclease I [Candidatus Liberibacter asiaticus str. p
2qxf_A482 Exodeoxyribonuclease I; alpha-beta domain, DNAQ superfa 6e-89
2gbz_A194 Oligoribonuclease; ORN, deddh, structural genomics, X-R 1e-18
2ioc_B242 Three prime repair exonuclease 1; proline helix, nucleo 3e-17
2igi_A180 Oligoribonuclease; RNAse, exoribonuclease, exonuclease, 2e-16
1y97_A238 Three prime repair exonuclease 2; TREX2, hydrolase; 2.5 7e-16
2f96_A224 Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolase, SA 1e-11
2is3_A215 Ribonuclease T; RNAse, exoribonuclease, exonuclease, hy 7e-11
3cg7_A308 CRN-4, cell death-related nuclease 4; hydrolase, apopto 4e-10
2xri_A224 ERI1 exoribonuclease 3; hydrolase, metal binding; 2.15A 8e-10
1zbu_A349 ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; HET: 1e-08
1w0h_A204 3'-5' exonuclease ERI1; nuclease domain, hydrolase; HET 5e-08
2p1j_A186 POLIII, DNA polymerase III POLC-type; structural genomi 3e-06
2gui_A194 DNA polymerase III epsilon subunit; DNA polymerase proo 0.001
>2qxf_A Exodeoxyribonuclease I; alpha-beta domain, DNAQ superfamily, SH3-like domain, product bound structure, DNA damage, DNA repair, exonuclease; HET: TMP; 1.50A {Escherichia coli K12} SCOP: c.55.3.5 PDB: 1fxx_A* 3c94_A 3c95_A Length = 482 Back     alignment and structure
 Score =  323 bits (828), Expect = 6e-89
 Identities = 242/462 (52%), Positives = 325/462 (70%), Gaps = 1/462 (0%)

Query: 5   FVIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFITGIT 64
           F+ +DYETFG   ALDRPAQFA +R D ++  I   EVF+CKPADDYLP P AV ITGIT
Sbjct: 11  FLFHDYETFGTHPALDRPAQFAAIRTDSEFNVIGEPEVFYCKPADDYLPQPGAVLITGIT 70

Query: 65  PQKALRDGVVEAEFSRRIHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNFYDSYRWSWDN 124
           PQ+A   G  EA F+ RIH  F+VP TCI+GYNN+RFDD  +RNIFYRNFYD Y WSW +
Sbjct: 71  PQEARAKGENEAAFAARIHSLFTVPKTCILGYNNVRFDDEVTRNIFYRNFYDPYAWSWQH 130

Query: 125 GNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHVNAHDAKADVYAT 184
            NSRWDLLDVMRA YA  P+GI WP  DDG  SF+L+ L  ANGIEH NAHDA ADVYAT
Sbjct: 131 DNSRWDLLDVMRACYALRPEGINWPENDDGLPSFRLEHLTKANGIEHSNAHDAMADVYAT 190

Query: 185 LALVWLIREKKPKLFEYLYDYRNKNQLRKLIDIQNMTPLVHVSGMFGASRSNTALIAPVA 244
           +A+  L++ ++P+LF+YL+ +RNK++L  LID+  M PLVHVSGMFGA R NT+ +AP+A
Sbjct: 191 IAMAKLVKTRQPRLFDYLFTHRNKHKLMALIDVPQMKPLVHVSGMFGAWRGNTSWVAPLA 250

Query: 245 WHPRYKDSVIGCNLSGDMRVFQDLDSVQLAKRLFTSHDELKGLVPVPIKEVHLNKCPILM 304
           WHP  +++VI  +L+GD+    +LDS  L +RL+T+  +L     VP+K VH+NKCP+L 
Sbjct: 251 WHPENRNAVIMVDLAGDISPLLELDSDTLRERLYTAKTDLGDNAAVPVKLVHINKCPVLA 310

Query: 305 PIDYCKKEHFERWGIDHKRCLENLTLLRQQTNLRDRFKAIYNKPY-TSSSQDVDSQLYDG 363
             +  + E  +R GI+ + CL+NL +LR+   +R++  AI+ +    + S +VD+QLY+G
Sbjct: 311 QANTLRPEDADRLGINRQHCLDNLKILRENPQVREKVVAIFAEAEPFTPSDNVDAQLYNG 370

Query: 364 FFADVDRQIMDRILRTAPEQLSTLNLPFSDRRLPELFFRYRARNFPHTLSEKEKQDWLEH 423
           FF+D DR  M  +L T P  L  L++ F D+R+ +L F YRARNFP TL   E+Q WLEH
Sbjct: 371 FFSDADRAAMKIVLETEPRNLPALDITFVDKRIEKLLFNYRARNFPGTLDYAEQQRWLEH 430

Query: 424 RKKMLTRSRIEEYKNKLQSLSGEYKGDEGKEGLINALYEYLQ 465
           R+++ T   ++ Y ++LQ L  +Y  D+ K  L+ AL++Y  
Sbjct: 431 RRQVFTPEFLQGYADELQMLVQQYADDKEKVALLKALWQYAD 472


>2gbz_A Oligoribonuclease; ORN, deddh, structural genomics, X-RAY diffraction, hydrolase; 2.30A {Xanthomonas campestris PV} Length = 194 Back     alignment and structure
>2ioc_B Three prime repair exonuclease 1; proline helix, nucleotide complex, DNAQ family, hydrolase; HET: D5M; 2.10A {Mus musculus} SCOP: c.55.3.5 PDB: 3b6o_A* 2o4g_A* 3b6p_A* 2o4i_A 2oa8_A Length = 242 Back     alignment and structure
>2igi_A Oligoribonuclease; RNAse, exoribonuclease, exonuclease, hydrolase, mRNA decay; 1.70A {Escherichia coli K12} SCOP: c.55.3.5 PDB: 1yta_A 1j9a_A Length = 180 Back     alignment and structure
>1y97_A Three prime repair exonuclease 2; TREX2, hydrolase; 2.50A {Homo sapiens} SCOP: c.55.3.5 Length = 238 Back     alignment and structure
>2f96_A Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolase, SAD, PSI, MCSG, protein structure initiative; 2.09A {Pseudomonas aeruginosa PAO1} SCOP: c.55.3.5 Length = 224 Back     alignment and structure
>2is3_A Ribonuclease T; RNAse, exoribonuclease, exonuclease, hydrolase, stable RNA maturation, tRNA END-turnover; 3.10A {Escherichia coli K12} Length = 215 Back     alignment and structure
>3cg7_A CRN-4, cell death-related nuclease 4; hydrolase, apoptosis, 3'-5' exonuclease, deddh; 2.50A {Caenorhabditis elegans} PDB: 3cm5_A 3cm6_A Length = 308 Back     alignment and structure
>2xri_A ERI1 exoribonuclease 3; hydrolase, metal binding; 2.15A {Homo sapiens} Length = 224 Back     alignment and structure
>1zbu_A ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; HET: AMP; 3.00A {Homo sapiens} Length = 349 Back     alignment and structure
>1w0h_A 3'-5' exonuclease ERI1; nuclease domain, hydrolase; HET: AMP; 1.59A {Homo sapiens} SCOP: c.55.3.5 Length = 204 Back     alignment and structure
>2p1j_A POLIII, DNA polymerase III POLC-type; structural genomics, exonuclease, PSI-2, protein structure initiative; HET: DNA; 2.50A {Thermotoga maritima MSB8} Length = 186 Back     alignment and structure
>2gui_A DNA polymerase III epsilon subunit; DNA polymerase proofreading domain, transferase; HET: DNA U5P; 1.60A {Escherichia coli} SCOP: c.55.3.5 PDB: 1j54_A* 1j53_A* 2ido_A* Length = 194 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target471 exonuclease I [Candidatus Liberibacter asiaticus str. p
2qxf_A482 Exodeoxyribonuclease I; alpha-beta domain, DNAQ superfa 100.0
2ioc_B242 Three prime repair exonuclease 1; proline helix, nucleo 100.0
1y97_A238 Three prime repair exonuclease 2; TREX2, hydrolase; 2.5 99.97
2p1j_A186 POLIII, DNA polymerase III POLC-type; structural genomi 99.96
2is3_A215 Ribonuclease T; RNAse, exoribonuclease, exonuclease, hy 99.95
2xri_A224 ERI1 exoribonuclease 3; hydrolase, metal binding; 2.15A 99.95
2gui_A194 DNA polymerase III epsilon subunit; DNA polymerase proo 99.94
2f96_A224 Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolase, SA 99.94
3cg7_A308 CRN-4, cell death-related nuclease 4; hydrolase, apopto 99.93
1w0h_A204 3'-5' exonuclease ERI1; nuclease domain, hydrolase; HET 99.93
1zbh_A299 3'-5' exonuclease ERI1; histone mRNA 3'-END-specific re 99.91
2gbz_A194 Oligoribonuclease; ORN, deddh, structural genomics, X-R 99.91
1zbu_A349 ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; HET: 99.9
1wlj_A189 Interferon stimulated gene 20KDA; exoribonuclease, hydr 99.89
2igi_A180 Oligoribonuclease; RNAse, exoribonuclease, exonuclease, 99.88
1x9m_A 698 DNA polymerase; DNA ploymerase, N-2-acetylaminofluorene 98.95
2gv9_A 1193 DNA polymerase; polymerase alpha fold, transferase; HET 98.75
2d5r_A252 CCR4-NOT transcription complex subunit 7; poly(A) deade 98.71
2p51_A333 SPCC18.06C protein; DEDD nuclease fold, hydrolase, gene 98.65
1uoc_A289 POP2; hydrolase, DEDD nuclease, mRNA degradation, poly( 98.48
3iay_A 919 DNA polymerase delta catalytic subunit; protein-DNA com 98.31
1qht_A 775 Protein (DNA polymerase); archaea, hyperthermostable, f 98.17
3k59_A 786 POL II, DNA polymerase II; protein-DNA complex, DNA dam 98.04
2hhv_A 580 DNA polymerase I; DNA replication, klenow fragment, pro 97.91
1s5j_A 847 DNA polymerase I; replication, disulfide bonds, transfe 97.43
1yt3_A375 Ribonuclease D, RNAse D; exoribonuclease, exonuclease, 97.2
2hbj_A410 Exosome complex exonuclease RRP6; RNA metabolism, RNA s 96.13
2py5_A 575 DNA polymerase; protein-DNA complex, replication, trans 94.84
2kfn_A 605 Klenow fragment of DNA polymerase I; complex (polymeras 98.46
3nae_A 903 DNA polymerase, GP43; RB69 DNA polymerase; HET: DNA G35 97.95
1noy_A388 Protein (DNA polymerase (E.C.2.7.7.7)); exonuclease, DN 97.47
2a1r_A430 Poly(A)-specific ribonuclease PARN; DEDD, nuclease doma 97.32
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, cytop 95.74
>2qxf_A Exodeoxyribonuclease I; alpha-beta domain, DNAQ superfamily, SH3-like domain, product bound structure, DNA damage, DNA repair, exonuclease; HET: TMP; 1.50A {Escherichia coli K12} SCOP: c.55.3.5 PDB: 1fxx_A* 3c94_A 3c95_A 3hl8_A* 3hp9_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=760.29  Aligned_cols=469  Identities=52%  Similarity=0.955  Sum_probs=452.2

Q ss_pred             CCCEEEEECCCCCCCCCCCEEEEEEEEEECCCCEECCEEEEEEECCCCCCCCCHHHHHHHCCCHHHHHHCCCCHHHHHHH
Q ss_conf             88379997527889877260489999998389728040022662178887785789898579988996079997999999
Q gi|254780661|r    2 TNHFVIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFITGITPQKALRDGVVEAEFSRR   81 (471)
Q Consensus         2 ~~~~v~~D~ETtG~~~~~~~iiq~~~i~~d~~~~~~~~~~~~~~~~~~~~~p~p~a~~v~git~~~~~~~~~~~~e~~~~   81 (471)
                      ..+|||||+||||++|.+|||||+|||++|.+|++++++++++|||+|+++|+|+|+.|||||++++.++|.|++|++++
T Consensus         8 ~~~~v~~D~ETTGl~~~~d~iiq~~ai~~d~~~~~~~~~~~~~~~~~~~~~p~~~a~~v~gi~~~~~~~~~~~~~e~~~~   87 (482)
T 2qxf_A            8 QSTFLFHDYETFGTHPALDRPAQFAAIRTDSEFNVIGEPEVFYCKPADDYLPQPGAVLITGITPQEARAKGENEAAFAAR   87 (482)
T ss_dssp             CCEEEEEEEEESSSCTTTSCEEEEEEEEECTTSCBCSCCEEEEBCCCTTCCCCHHHHHHHCCCHHHHHHHCBCHHHHHHH
T ss_pred             CCCEEEEEEECCCCCCCCCCEEEEEEEEECCCCCEEEEEEEEEECCCCCCCCCHHHHHHHCCCHHHHHCCCCCHHHHHHH
T ss_conf             89789999887897999982289999999899858514567763479999988789688494999997399999999999


Q ss_pred             HHHHHHCCCCEEEEEECHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHH
Q ss_conf             99995117965999505578999999999850785321325688710015888865556532100244444544331089
Q gi|254780661|r   82 IHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNFYDSYRWSWDNGNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQ  161 (471)
Q Consensus        82 i~~~~~~~~~~~ig~N~~~FD~~~lr~~~~r~~~~~y~~~~~~~~~~~D~l~~~~~~~~~~p~~~~~~~~~~~~~~~kL~  161 (471)
                      |+++|+.|++++|||||++||++|+|+.||||+++||.++++++|.++|++.++++++.++|+.++||.+.+|+++|||+
T Consensus        88 i~~~~~~~~~~~vg~N~~~FD~~~l~~~~~r~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~kL~  167 (482)
T 2qxf_A           88 IHSLFTVPKTCILGYNNVRFDDEVTRNIFYRNFYDPYAWSWQHDNSRWDLLDVMRACYALRPEGINWPENDDGLPSFRLE  167 (482)
T ss_dssp             HHHHHTSTTEEEEESSTTTTHHHHHHHHHHHTTSCSSGGGTGGGCEEEEHHHHHHHHHHHCCTTSCCCBCTTSSBCCCHH
T ss_pred             HHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHCCCCCHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHH
T ss_conf             99998448976999676334799999998874478501220268750256888888864044221243234686646699


Q ss_pred             HHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCEEEE
Q ss_conf             89987188764310133318999999999986422689999962388989974200157607997010104778750688
Q gi|254780661|r  162 DLALANGIEHVNAHDAKADVYATLALVWLIREKKPKLFEYLYDYRNKNQLRKLIDIQNMTPLVHVSGMFGASRSNTALIA  241 (471)
Q Consensus       162 ~la~~n~i~~~~aH~A~~D~~~t~~l~k~i~~~~p~~~~~~l~~~~K~~v~~~l~~~~~~~~~~v~~~~~~~~~~~~~v~  241 (471)
                      .+|++||+.+++||||++||.||++|+++|+.++|.+|++++.+++|+.|.+++..+++.+++++++.++.+.++.++++
T Consensus       168 ~l~~~~~i~~~~aHdA~~D~~~t~~l~~~l~~~~p~~~~~~l~~~~K~~v~~~l~~~~~~~~~~~~~~~~~~~~~~~~v~  247 (482)
T 2qxf_A          168 HLTKANGIEHSNAHDAMADVYATIAMAKLVKTRQPRLFDYLFTHRNKHKLMALIDVPQMKPLVHVSGMFGAWRGNTSWVA  247 (482)
T ss_dssp             HHHHHTTCCCC---CTTHHHHHHHHHHHHHHHHSHHHHHHHHHTTSHHHHHHTCCTTTTCCEEEECGGGCGGGTTEEEEE
T ss_pred             HHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHCHHHHHHHHHHCCHHHHHHHHHHCCCCCEEEEEECCCCCCCCEEEEC
T ss_conf             99998199877886635517999999999987471678788871578889998601113420566101155667402312


Q ss_pred             EEECCCCCCCEEEEEECCCCCCHHCCCCHHHHHHHHHCCHHHHHCCCCCCEEEEECCCCCEECCHHHCCHHHHHHCCCCH
Q ss_conf             63028887744787103568720007998899987406514420247743057653678754375570313455403588
Q gi|254780661|r  242 PVAWHPRYKDSVIGCNLSGDMRVFQDLDSVQLAKRLFTSHDELKGLVPVPIKEVHLNKCPILMPIDYCKKEHFERWGIDH  321 (471)
Q Consensus       242 ~~~~~p~~~n~~i~fDL~~Dp~~~l~l~~~el~~~l~~~~~~~~~~~~~~lr~ik~Nk~Pil~~~~~~~~~~~~~~~i~~  321 (471)
                      +++.||.|.|+.+||||++||+++++++.+++++.++++........+.++|++++|++|++++.+++.......++++.
T Consensus       248 ~~~~~p~~~n~~i~fDL~~Dp~~~l~L~~~el~~~l~~~~~~~~~~~~~~ir~i~~Nk~pil~~~~~~~~~~~~~~~~~~  327 (482)
T 2qxf_A          248 PLAWHPENRNAVIMVDLAGDISPLLELDSDTLRERLYTAKTDLGDNAAVPVKLVHINKCPVLAQANTLRPEDADRLGINR  327 (482)
T ss_dssp             EEEECSSCTTEEEEEETTSCCHHHHHCC-------------------CCCEEEEETTSCCEEEEGGGSCHHHHHHHTCCH
T ss_pred             CCCCCCCCCCEEEECCCCCCHHHHHCCCHHHHHHHHHHCCCCHHHCCCCCEEEEECCCCCCCCCHHHCCCCCHHHHHHHH
T ss_conf             46467777660463200039597744899999999850232112135664267402568755645551600076654039


Q ss_pred             HHHHHHHHHHHHCHHHHHHHHHHHHCCC-CCCCCCHHHHHCCCCCCHHHHHHHHHHHCCCHHHHHHHHCCCCCHHHHHHH
Q ss_conf             9999989997618546888874430133-443332045410246897662216889759988986212048983799999
Q gi|254780661|r  322 KRCLENLTLLRQQTNLRDRFKAIYNKPY-TSSSQDVDSQLYDGFFADVDRQIMDRILRTAPEQLSTLNLPFSDRRLPELF  400 (471)
Q Consensus       322 ~~l~~r~~~l~~n~~~~~~~~~~~~~~~-~~~~~~~E~~IY~gF~s~~Dk~~~~~fh~a~~~~k~~i~~~f~D~Rl~~l~  400 (471)
                      +.+.+|++.+++|+++.+++..+..... .+++.++|++||+||+++.|+.+|++||.++|+++++++.+|+|+|+++|+
T Consensus       328 ~~l~~r~~~i~~n~~~~~~i~~~~~~~~~~~~~~~~e~~iy~gF~s~~Dk~l~~~fh~a~~~ek~~~~~~f~D~Rl~~l~  407 (482)
T 2qxf_A          328 QHCLDNLKILRENPQVREKVVAIFAEAEPFTPSDNVDAQLYNGFFSDADRAAMKIVLETEPRNLPALDITFVDKRIEKLL  407 (482)
T ss_dssp             HHHHHHHHHHHHCTTHHHHC-------------CCGGGCGGGCCCCHHHHHHHHHHHHSCTTTSTTCCCCCCSTHHHHHH
T ss_pred             HHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHH
T ss_conf             99999999998696889988999875234665411466675057987899999999847999999888358776899999


Q ss_pred             HHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCC
Q ss_conf             9996311810089999999999999750678889999999999965149988999999999999975278
Q gi|254780661|r  401 FRYRARNFPHTLSEKEKQDWLEHRKKMLTRSRIEEYKNKLQSLSGEYKGDEGKEGLINALYEYLQWVIPK  470 (471)
Q Consensus       401 ~R~i~~n~P~~Ls~~~~~~~~~~i~~rl~~~~i~~~~~ei~~l~~~~~~d~~~~~iL~~l~~yl~~l~~~  470 (471)
                      +|++|||+|+.||++++++|+++|++||+++|++++++++++++.+...+++++.||++|++|+++|+-.
T Consensus       408 ~r~i~rn~p~~L~~ee~~~~~~~i~~rl~~~t~~~~~~ei~~l~~~~~~~~~k~~iL~~l~~y~~~l~e~  477 (482)
T 2qxf_A          408 FNYRARNFPGTLDYAEQQRWLEHRRQVFTPEFLQGYADELQMLVQQYADDKEKVALLKALWQYADEIVEH  477 (482)
T ss_dssp             HHHHHHHCGGGCCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHC---
T ss_pred             HHHHHHHCHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999874821199999999999999985678599999999999976308999999999999999999876



>2ioc_B Three prime repair exonuclease 1; proline helix, nucleotide complex, DNAQ family, hydrolase; HET: D5M; 2.10A {Mus musculus} SCOP: c.55.3.5 PDB: 3b6o_A* 2o4g_A* 3b6p_A* 2o4i_A 2oa8_A Back     alignment and structure
>1y97_A Three prime repair exonuclease 2; TREX2, hydrolase; 2.50A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>2p1j_A POLIII, DNA polymerase III POLC-type; structural genomics, exonuclease, PSI-2, protein structure initiative; HET: DNA; 2.50A {Thermotoga maritima MSB8} Back     alignment and structure