254780662

254780662

NAD-glutamate dehydrogenase

GeneID in NCBI database:8209666Locus tag:CLIBASIA_02745
Protein GI in NCBI database:254780662Protein Accession:YP_003065075.1
Gene range:+(605893, 610623)Protein Length:1576aa
Gene description:NAD-glutamate dehydrogenase
COG prediction:[E] NAD-specific glutamate dehydrogenase
KEGG prediction:NAD-glutamate dehydrogenase; K00260 glutamate dehydrogenase [EC:1.4.1.2]
SEED prediction:NAD-specific glutamate dehydrogenase (EC 1.4.1.2), large form
Pathway involved in KEGG:Nitrogen metabolism [PATH:las00910]
Alanine, aspartate and glutamate metabolism [PATH:las00250]
Arginine and proline metabolism [PATH:las00330]
Subsystem involved in SEED:Glutamate dehydrogenases;
Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED6 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------
MVISRDLKRSKIIGDVDIAIAILGLPSFSASAMFGEASIDDLEKYTPQMLALTSVVSYDIFAGWDHSSACCIDIREVEGINPSGISISIITVIVDNIPFLYQSIIGEIVARCRNLTMAVHPVFTKDKNCDWQLYSPESCGIAQKQISLIQIHCLKITPEEAIEIKKQLIFIIEQLKLVSQDSREMLASLEKMQKSFCHLTGIKEYAVEALTFLNWLNEDNFQFMGMRYHPLVAGQKQVKLDHDMPTELGILRDSSIVVLGFDRVTPATRSFPEGNDFLIITKSNVISVIYRRTYMDHIGIKHFDERGNLIGELHVVGFFTRLVYSQRASKIPLLREKIVKVQNLLNFHPNSHSSRMLQNTLEFYPRDELFQIDSTLLASFCEQIIDIMDRPRVRVLPRIDRFNHFFSSLIYIPREYFDSFVREKIGNYLSEVCEGHVAFYSSILEEGLVRIHFVIVRSGGEISHPSQESLEEGVRSIVACWEDKFYKSAGDGVPRFIFSQTFRDVFSPEKAVEDLPYIISCAEGKEKLRVCFENKEDGKVQIKIFHARGPFSLSKRVPLLENLGFTVISEDTFEIKMLADDEEHLVVLYQMDLSPATIARFDLVDRRDALVEAFKYIFHERVDNDSFNHLIMLTDLRVYEISVLRSYARYLRQASVTWSQNFIARVLSKNPTISQLLFSLFRYRFDPSLSDQERGENTKRILGEIDSALLKVPSLDDDTVLRSYVNLISGTLRTNYFQKNQDDIALVFKFDSRKINSVGTDELHREIFVYGVEVEGVHLRCGKIARGGLRWSDRAADYRTEVLGLVRAQKVKNAVIVPVGAKGGFYPKRLPSEGRRDEIIKIGREAYKTYVRALLSITDNFEGQEIIHPDNTVCLDGNDPYFVVAADKGTATFSDTANILAQEAKFWLDDAFASGGSMGYDHKKMGITARGAWETVKRHFREMDIDIQSTPFTVAGVGDMSGDVFGNGMLLSRKIQLVAAFDHSDIFIDPDPNSETTFDERKRLFDSPSSSWQDFDRKVLSKGGMIISRKEKAVQLTPEAVAVIGISKQIATPSEIISAILMASVDLLWFGGIGTYIRAPRENNADIGDKGNNILRVTADKVRAKVIGEGANLGLTQQARVVYSLNGGRINSDAIDNSGGVNCSDLEVNIKIALASAMRDGRLTLENRNKLLSSMTSEVVELVLRNNYLQSLAISLESRKGMAMMWNFAQLMKFLGKEGALDRELEHLPSVVSFEERIREEVSLSRPEIAILLAYAKLKLSEQLLDSTLIDDPFFFSILLSYFPRQLSELYSEDIMNHQLRRAIVATVLANEIINKGGSCFVVSLAKETGSSTEDVIRSAVIAYAGYELESLWQEVDKLDNQISGELQNKIYEEIRLIFINLTRLLIKNGKFIGDIGNAVKRLVTAFHKLNSLLQEKIPVEWLERFNNWVTNLTNKGFPPDLADRIVRMQFLMVVPDLIDISETCDTSLLVVLDMWSAISVGLGVDRLLSVAHNVVVDDHYENLALSAGLDWMYSARREMIVKAITTGSSVATIMQNEKWKEVKDQVFDILSVEKEVTVAHITVATHLLSGFLLKI
ccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHcccHHHHHHHHHHHHHHHHccccccccEEEccccccccccccccEEEEEEcccccHHHHHHHHHHHHcccHHHEEEccEEEEEEcccccEEcccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccEEEEcEEEEEEEccccccEEEEcccccccccccccccccccccccHHHHHHHccccEEEEEEccccEEEcccccccEEEEEcccccccEEEEEEEEEEEEHHHHcccHHHcHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHcccHHHHHHHHHHHHHccccccEEEEEEccccccEEEEEEEccHHHccHHHHHHHHHHHHHHHccccEEEEEEccccEEEEEEEEEEcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHcccccEEEEEccccccEEEEEEEEccccccHHHcccHHHHcccEEEccccEEEEEcccccccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccEEEEEEcHHHcccccccccccEEEEEEccEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHcccccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHcccccccccEEccccccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccEEEEEEccccHHHHHHHHHHccccEEEEEEEccEEEEccccccHHHHHHHHHHHHccccccccccHHHccccccEEEcccccccccccHHHHcccccccccHHHHHHHHHHccccEEcccccccccccccccccHHHHHHHHHHHccccccEEEEEEEcccccccHHHHHHHHHcccEEcccHHHcccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcc
ccccccHHHHHHHHHHcHHHHHcccHHHHHHHHHHHccHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccEEEEcccccccEEEEEEcccccHHHHHHHHHHHHccccEEEEEccEEEEEEcccccEEEEcccccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEccccEEEEEccccccccccccccccccHccccHHHHHHHccccEEEEEEccccccccccccHcEEEEEEEcccccEEEEEEEEEEEEccHccccHHHcHHHHHHHHHHHHHcccccccccHHHHHHHHHcccHHHHHcccHHHHHHHHHHHHHHHHcccEEEEEEccccccEEEEEEEEcHHcccHHHHHHHHHHHHHHHcccEEEEEEEcccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccHHHHHHHHHHHHHHccccccEEEEEEccccccEEEEEEcccccccHHHHHHHHHHcccEEEccccEEEEEcccccccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcHHHccccccccccEEEEEEcccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHcEEEEEcccccccEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccEcccccEEEEcccccEEEEEEccccccHHHHHHHHHHHHcccccccHcccccccccHHHHcHcHHHHHHHHHHHHHHHccccccccEEEEEEcccccccccccccccHHHEEEEEEcccEEEEcccccHHHHHHHHHHHHccccccHHHccHHHHcccccccccccccccccHHHHHHHccccccccHHHHHHHHHHccccEEEcccccEEEEEcccccccccccccccEEEcccHEEEEEEEccccHcHcHHcHHHHHHccccEccccEEccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHEccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcc
mvisrdlkrskiigdVDIAIAILglpsfsasamfgeasiDDLEKYTPQMLALTSVVSYDifagwdhssaccidireveginpsgisISIITVIVDNIPFLYQSIIGEIVARCRNLtmavhpvftkdkncdwqlyspescgiaQKQISLIQIHCLKITPEEAIEIKKQLIFIIEQLKLVSQDSREMLASLEKMQKSFCHLTGIKEYAVEALTFLNWlnednfqfmgmryhplvagqkqvkldhdmptelgilrdssivvlgfdrvtpatrsfpegndfliiTKSNVISVIYRRTYMDHIGIKHFDERGNLIGELHVVGFFTRLVYSQRASKIPLLREKIVKVQNLlnfhpnshssrmlqntlefyprdelfqIDSTLLASFCEQIIDimdrprvrvlpridrfnhffssliyipreyfdSFVREKIGNYLSEVCEGHVAFYSSILEEGLVRIHFVIVrsggeishpsqesLEEGVRSIVACWEDkfyksagdgvprfifsqtfrdvfspekavedlpyiISCAEGKEKLRVCFENKEDGKVQIKIFhargpfslskrvpllenlgftvisedtFEIKMLADDEEHLVVLYQMdlspatiarFDLVDRRDALVEAFKYIFHervdndsfnhlIMLTDLRVYEISVLRSYARYLRQASVTWSQNFIARVLSKNPTISQLLFSLFRyrfdpslsdqergeNTKRILGEIDSallkvpsldddtvLRSYVNLISGTlrtnyfqknqdDIALVFKfdsrkinsvgtdELHREIFVYGVEVegvhlrcgkiargglrwsdraADYRTEVLGLVRAqkvknavivpvgakggfypkrlpsegrrDEIIKIGREAYKTYVRALLSItdnfegqeiihpdntvcldgndpyFVVAadkgtatfsDTANILAQEAKFWLDdafasggsmgydhkkmgitARGAWETVKRHFREmdidiqstpftvagvgdmsgdvfgngmLLSRKIQLVAAfdhsdifidpdpnsettfderkrlfdspssswqdfDRKVLSkggmiisrkekavqltPEAVAVIGISKQIATPSEIISAILMASVDLLWfggigtyiraprennadigdkgnniLRVTADKVRAKVIgeganlglTQQARVVYSLnggrinsdaidnsggvncsdLEVNIKIALASAMRDGRLTLENRNKLLSSMTSEVVELVLRNNYLQSLAISLESRKGMAMMWNFAQLMKFLGKEgaldrelehlpsvvsfEERIREEVSLSRPEIAILLAYAKLKLSEQLldstliddpfFFSILLSYFPRQLSELYSEDIMNHQLRRAIVATVLANEIINKGGSCFVVSLAketgsstedVIRSAVIAYAGYELESLWQEVDKLDNQISGELQNKIYEEIRLIFINLTRLLIKNGKFIGDIGNAVKRLVTAFHKLNSLLQEKIPVEWLERFNNWVTnltnkgfppdlADRIVRMQFLMVVpdlidisetcDTSLLVVLDMWSAISVGLGVDRLLSVAHNVVVDDHYENLALSAGLDWMYSARREMIVKAITTGSSVATIMQNEKWKEVKDQVFDILSVEKEVTVAHITVATHLLSGFLLKI
mvisrdlkrskiigDVDIAIAILGLPSFSASAMFGEASIDDLEKYTPQMLALTSVVSYDIFAGWDHSSACCIDIREVEGINPSGISISIITVIVDNIPFLYQSIIGEIVARCRNLTMAVHPVFTKDKNCDWQLYSPESCGIAQKQISLIQIHCLKITPEEAIEIKKQLIFIIEQLKLVSQDSREMLASLEKMQKSFCHLTGIKEYAVEALTFLNWLNEDNFQFMGMRYHPLVAGQKQVKLDHDMPTELGILRDSSIVVLGFDRVTpatrsfpegndfliitkSNVISVIYRRTYMDHIGIKHFDERGNLIGELHVVGFFTRLVYSQRASKIPLLREKIVKVQNLLnfhpnshssrMLQNTLEFYPRDELFQIDSTLLASFCEQIIDIMDRPRVRVLPRIDRFNHFFSSLIYIPREYFDSFVREKIGNYLSEVCEGHVAFYSSILEEGLVRIHFVIVRSGgeishpsqeslEEGVRSIVACWEDKFYKSAGDGVPRFIFSQTFRDVFspekavedlpyiiSCAEGKEKLRVCFENKEDGKVQIKIFhargpfslskrvpLLENLGFTVISEDTFEIKMLADDEEHLVVLYQMDLSPATIARFDLVDRRDALVEAFKYIfhervdndsfnHLIMLTDLRVYEISVLRSYARYLRQASVTWSQNFIARVLSKNPTISQLLFSLFRYRFDpslsdqergenTKRILGeidsallkvpsldddTVLRSYVNLISgtlrtnyfqknQDDIALVFKFDSRKINSVGTDELHREIFVYGvevegvhlrcgkiargglrwsdrAADYRTEVLglvraqkvknavivpvgakggfypkrlpsegrrdeIIKIGREAYKTYVRALLSITDNFEGQEIIHPDNTVCLDGNDPYFVVAADKGTATFSDTANILAQEAKFWLDDAFASGGSMGYDHKKMGITARGAWETVKRHFREMDIDIQSTPFTVAGVGDMSGDVFGNGMLLSRKIQLVAAFDHSDIFIDPDPNSETTFDERkrlfdspssswqdfdrkVLSKGgmiisrkekavqltPEAVAVIGISKQIATPSEIISAILMASVDLLWFGGIGTYIRAprennadigdkgnnilRVTADKVRAKVIgeganlgltqqARVVYSLNGGRInsdaidnsggvnCSDLEVNIKIALASAMRDGRLTLENRNKLLSSMTSEVVELVLRNNYLQSLAISLESRKGMAMMWNFAQLMKFLGKEGALDRELEHlpsvvsfeerireevslsrpEIAILLAYAKLKLSEQLLDSTLIDDPFFFSILLSYFPRQLSELYSEDIMNHQLRRAIVATVLANEIINKGGSCFVVSLAKetgsstedvIRSAVIAYAGYELESLWQEVDKLDNQISGELQNKIYEEIRLIFINLTRLLIKNGKFIGDIGNAVKRLVTAFHKLNSLLQEKIPVEWLERFNNWVTNLTNKGFPPDLADRIVRMQFLMVVPDLIDISETCDTSLLVVLDMWSAISVGLGVDRLLSVAHNVVVDDHYENLALSAGLDWMYSARREMIVKAITTGSSVATIMQNEKWKEVKDQVFDILSVEKEVTVAHITVATHLLSGFLLKI
MVISRDLKRSKIIGDVDIAIAILGLPSFSASAMFGEASIDDLEKYTPQMLALTSVVSYDIFAGWDHSSACCIDIREVEGINPsgisisiitvivDNIPFLYQSIIGEIVARCRNLTMAVHPVFTKDKNCDWQLYSPESCGIAQKQISLIQIHCLKITPEEAIEIKKQLIFIIEQLKLVSQDSREMLASLEKMQKSFCHLTGIKEYAVEALTFLNWLNEDNFQFMGMRYHPLVAGQKQVKLDHDMPTELGILRDSSIVVLGFDRVTPATRSFPEGNDFLIITKSNVISVIYRRTYMDHIGIKHFDERGNLIGELHVVGFFTRLVYSQRASKIPLLREKIVKVQNLLNFHPNSHSSRMLQNTLEFYPRDELFQIDSTLLASFCEQIIDIMDRPRVRVLPRIDRFNHFFSSLIYIPREYFDSFVREKIGNYLSEVCEGHVAFYSSILEEGLVRIHFVIVRSGGEISHPSQESLEEGVRSIVACWEDKFYKSAGDGVPRFIFSQTFRDVFSPEKAVEDLPYIISCAEGKEKLRVCFENKEDGKVQIKIFHARGPFSLSKRVPLLENLGFTVISEDTFEIKMLADDEEHLVVLYQMDLSPATIARFDLVDRRDALVEAFKYIFHERVDNDSFNHLIMLTDLRVYEISVLRSYARYLRQASVTWSQNFIARVLSKNPTISQLLFSLFRYRFDPSLSDQERGENTKRILGEIDSALLKVPSLDDDTVLRSYVNLISGTLRTNYFQKNQDDIALVFKFDSRKINSVGTDELHREIFVYGVEVEGVHLRCGKIARGGLRWSDRAADYRTEVLGLVRAQKVKNAVIVPVGAKGGFYPKRLPSEGRRDEIIKIGREAYKTYVRALLSITDNFEGQEIIHPDNTVCLDGNDPYFVVAADKGTATFSDTANILAQEAKFWLDDAFASGGSMGYDHKKMGITARGAWETVKRHFREMDIDIQSTPFTVAGVGDMSGDVFGNGMLLSRKIQLVAAFDHSDIFIDPDPNSETTFDERKRLFDSPSSSWQDFDRKVLSKGGMIISRKEKAVQLTPEAVAVIGISKQIATPSEIISAILMASVDLLWFGGIGTYIRAPRENNADIGDKGNNILRVTADKVRAKVIGEGANLGLTQQARVVYSLNGGRINSDAIDNSGGVNCSDLEVNIKIALASAMRDGRLTLENRNKLLSSMTSEVVELVLRNNYLQSLAISLESRKGMAMMWNFAQLMKFLGKEGALDRELEHLPSVVSFEERIREEVSLSRPEiaillayaklklSEQLLDSTLIDDPFFFSILLSYFPRQLSELYSEDIMNHQLRRAIVATVLANEIINKGGSCFVVSLAKETGSSTEDVIRSAVIAYAGYELESLWQEVDKLDNQISGELQNKIYEEIRLIFINLTRLLIKNGKFIGDIGNAVKRLVTAFHKLNSLLQEKIPVEWLERFNNWVTNLTNKGFPPDLADRIVRMQFLMVVPDLIDISETCDTSLLVVLDMWSAISVGLGVDRLLSVAHNVVVDDHYENLALSAGLDWMYSARREMIVKAITTGSSVATIMQNEKWKEVKDQVFDILSVEKEVTVAHITVATHLLSGFLLKI
*************************PSFSASAMFGEASIDDLEKYTPQMLALTSVVSYDIFAGWDH**A**IDIREVEGINPSGISISIITVIVDNIPFLYQSIIGEIVARCRNLTMAVHPVFTKDKNCDWQ***********KQISLIQIHCLKITPEEAIEIKKQLIFIIEQLKLVSQDSREMLASLEKM***************EALTFLNWLNEDNFQFMGMRYHPLVAGQKQ*******PTELGILRDSS***************FPEGNDFLIITKSNVISVIYRRTYMDHIGIKHFDERGNLIGELHVVGFFTRLVYSQRASKIPLLREKIVKVQNLLNFHPNSHSSRMLQNTLEFYPRDELFQIDSTLLASFCEQIIDIMDRPRVRVLPRIDRFNHFFSSLIYIPREYFDSFVREKIGNYLSEVCEGHVAFYSSILEEGLVRIHFVIVRSGGEISHPSQESLEEGVRSIVACWEDKFYKSAGDGVPRFIFSQTFRDVFSPEKAVEDLPYIISCAEGKEKLRVCFENKEDGKVQIKIFHARGPFSLSKRVPLLENLGFTVISEDTFEIKMLADDEEHLVVLYQMDLSPATIARFDLVDRRDALVEAFKYIFHERVDNDSFNHLIMLTDLRVYEISVLRSYARYLRQASVTWSQNFIARVLSKNPTISQLLFSLFRYRFDPSLS********KRILGEIDSALLKVPSLDDDTVLRSYVNLISGTLRTNYFQKNQDDIALVFKFDSRKINSVGTDELHREIFVYGVEVEGVHLRCGKIARGGLRWSDRAADYRTEVLGLVRAQKVKNAVIVPVGAKGGFYPKRLPSEGRRDEIIKIGREAYKTYVRALLSITDNFEGQEIIHPDNTVCLDGNDPYFVVAADKGTATFSDTANILAQEAKFWLDDAFASGGSMGYDHKKMGITARGAWETVKRHFREMDIDIQSTPFTVAGVGDMSGDVFGNGMLLSRKIQLVAAFDHSDIFIDPDPNSETTFDERKRLFDSPSSSWQDFDRKVLSKGGMIISRKEKAVQLTPEAVAVIGISKQIATPSEIISAILMASVDLLWFGGIGTYIRAPRENNADIGDKGNNILRVTADKVRAKVIGEGANLGLTQQARVVYSLNGGRINSDAIDNSGGVNCSDLEVNIKIALASAMRDGRLTLENRNKLLSSMTSEVVELVLRNNYLQSLAISLESRKGMAMMWNFAQLMKFLGKEGALDRELEHLPSVVS*************PEIAILLAYAKLKLSEQLLDSTLIDDPFFFSILLSYFPRQLSELYSEDIMNHQLRRAIVATVLANEIINKGGSCFVVSLAKETGSSTEDVIRSAVIAYAGYELESLWQEVDKLDNQISGELQNKIYEEIRLIFINLTRLLIKNGKFIGDIGNAVKRLVTAFHKLNSLLQEKIPVEWLERFNNWVTNLTNKGFPPDLADRIVRMQFLMVVPDLIDISETCDTSLLVVLDMWSAISVGLGVDRLLSVAHNVVVDDHYENLALSAGLDWMYSARREMIVKAITTGSSVATIMQNEKWKEVKDQVFDILSVEKEVTVAHITVATHLLSGFLLKI
MVISRDLKRSKIIGDVDIAIAILGLPSFSASAMFGEASIDDLEKYTPQMLALTSVVSYDIFAGWDHSSACCIDIREVEGINPSGISISIITVIVDNIPFLYQSIIGEIVARCRNLTMAVHPVFTKDKNCDWQLYSPESCGIAQKQISLIQIHCLKITPEEAIEIKKQLIFIIEQLKLVSQDSREMLASLEKMQKSFCHLTGIKEYAVEALTFLNWLNEDNFQFMGMRYHPLVAGQKQVKLDHDMPTELGILRDSSIVVLGFDRVTPATRSFPEGNDFLIITKSNVISVIYRRTYMDHIGIKHFDERGNLIGELHVVGFFTRLVYSQRASKIPLLREKIVKVQNLLNFHPNSHSSRMLQNTLEFYPRDELFQIDSTLLASFCEQIIDIMDRPRVRVLPRIDRFNHFFSSLIYIPREYFDSFVREKIGNYLSEVCEGHVAFYSSILEEGLVRIHFVIVRSGGEIS*********GVRSIVACWEDKFYKSAGDGVPRFIFSQTFRDVFSPEKAVEDLPYIISCAEGKEKLRVCFENKEDGKVQIKIFHARGPFSLSKRVPLLENLGFTVISEDTFEIKMLADDEEHLVVLYQMDLSPATIARFDLVDRRDALVEAFKYIFHERVDNDSFNHLIMLTDLRVYEISVLRSYARYLRQASVTWSQNFIARVLSKNPTISQLLFSLFRYRFDPSLSDQERGENTKRILGEIDSALLKVPSLDDDTVLRSYVNLISGTLRTNYFQKNQDDIALVFKFDSRKINSVGTDELHREIFVYGVEVEGVHLRCGKIARGGLRWSDRAADYRTEVLGLVRAQKVKNAVIVPVGAKGGFYPKRLPSEGRRDEIIKIGREAYKTYVRALLSITDNFEGQEIIHPDNTVCLDGNDPYFVVAADKGTATFSDTANILAQEAKFWLDDAFASGGSMGYDHKKMGITARGAWETVKRHFREMDIDIQSTPFTVAGVGDMSGDVFGNGMLLSRKIQLVAAFDHSDIFIDPDPNSETTFDERKRLFDSPSSSWQDFDRKVLSKGGMIISRKEKAVQLTPEAVAVIGISKQIATPSEIISAILMASVDLLWFGGIGTYIRAPRENNADIGDKGNNILRVTADKVRAKVIGEGANLGLTQQARVVYSLNGGRINSDAIDNSGGVNCSDLEVNIKIALASAMRDGRLTLENRNKLLSSMTSEVVELVLRNNYLQSLAISLESRKGMAMMWNFAQLMKFLGKEGALDRELEHLPSVVSFEERIREEVSLSRPEIAILLAYAKLKLSEQLLDSTLIDDPFFFSILLSYFPRQLSELYSEDIMNHQLRRAIVATVLANEIINKGGSCFVVSLAKETGSSTEDVIRSAVIAYAGYELESLWQEVDKLDNQISGELQNKIYEEIRLIFINLTRLLIKNGKFIGDIGNAVKRLVTAFHKLNSLLQEKIPVEWLERFNNWVTNLTNKGFPPDLADRIVRMQFLMVVPDLIDISETCDTSLLVVLDMWSAISVGLGVDRLLSVAHNVVVDDHYENLALSAGLDWMYSARREMIVKAITTGSSVATIMQNEKWKEVKDQVFDILSVEKEVTVAHITVATHLLSGFLLKI
*VISRDLKRSKIIGDVDIAIAILGLPSFSASAMFGEASIDDLEKYTPQMLALTSVVSYDIFAGWDHSSACCIDIREVEGINPSGISISIITVIVDNIPFLYQSIIGEIVARCRNLTMAVHPVFTKDKNCDWQLYSPESCGIAQKQISLIQIHCLKITPEEAIEIKKQLIFIIEQLKLVSQDSREMLASLEKMQKSFCHLTGIKEYAVEALTFLNWLNEDNFQFMGMRYHPLVAGQKQVKLDHDMPTELGILRDSSIVVLGFDRVTPATRSFPEGNDFLIITKSNVISVIYRRTYMDHIGIKHFDERGNLIGELHVVGFFTRLVYSQRASKIPLLREKIVKVQNLLNFHPNSHSSRMLQNTLEFYPRDELFQIDSTLLASFCEQIIDIMDRPRVRVLPRIDRFNHFFSSLIYIPREYFDSFVREKIGNYLSEVCEGHVAFYSSILEEGLVRIHFVIVRSGGEISHPSQESLEEGVRSIVACWEDKFYKSAGDGVPRFIFSQTFRDVFSPEKAVEDLPYIISCAEGKEKLRVCFENKEDGKVQIKIFHARGPFSLSKRVPLLENLGFTVISEDTFEIKMLADDEEHLVVLYQMDLSPATIARFDLVDRRDALVEAFKYIFHERVDNDSFNHLIMLTDLRVYEISVLRSYARYLRQASVTWSQNFIARVLSKNPTISQLLFSLFRYRFDPSLSDQERGENTKRILGEIDSALLKVPSLDDDTVLRSYVNLISGTLRTNYFQKNQDDIALVFKFDSRKINSVGTDELHREIFVYGVEVEGVHLRCGKIARGGLRWSDRAADYRTEVLGLVRAQKVKNAVIVPVGAKGGFYPKRLPSEGRRDEIIKIGREAYKTYVRALLSITDNFEGQEIIHPDNTVCLDGNDPYFVVAADKGTATFSDTANILAQEAKFWLDDAFASGGSMGYDHKKMGITARGAWETVKRHFREMDIDIQSTPFTVAGVGDMSGDVFGNGMLLSRKIQLVAAFDHSDIFIDPDPNSETTFDERKRLFDSPSSSWQDFDRKVLSKGGMIISRKEKAVQLTPEAVAVIGISKQIATPSEIISAILMASVDLLWFGGIGTYIRAPRENNADIGDKGNNILRVTADKVRAKVIGEGANLGLTQQARVVYSLNGGRINSDAIDNSGGVNCSDLEVNIKIALASAMRDGRLTLENRNKLLSSMTSEVVELVLRNNYLQSLAISLESRKGMAMMWNFAQLMKFLGKEGALDRELEHLPSVVSFEERIREEVSLSRPEIAILLAYAKLKLSEQLLDSTLIDDPFFFSILLSYFPRQLSELYSEDIMNHQLRRAIVATVLANEIINKGGSCFVVSLAKETGSSTEDVIRSAVIAYAGYELESLWQEVDKLDNQISGELQNKIYEEIRLIFINLTRLLIKNGKFIGDIGNAVKRLVTAFHKLNSLLQEKIPVEWLERFNNWVTNLTNKGFPPDLADRIVRMQFLMVVPDLIDISETCDTSLLVVLDMWSAISVGLGVDRLLSVAHNVVVDDHYENLALSAGLDWMYSARREMIVKAITTGSSVATIMQNEKWKEVKDQVFDILSVEKEVTVAHITVATHLLSGFLLKI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHx
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVISRDLKRSKIIGDVDIAIAILGLPSFSASAMFGEASIDDLEKYTPQMLALTSVVSYDIFAGWDHSSACCIDIREVEGINPSGISISIITVIVDNIPFLYQSIIGEIVARCRNLTMAVHPVFTKDKNCDWQLYSPESCGIAQKQISLIQIHCLKITPEEAIEIKKQLIFIIEQLKLVSQDSREMLASLEKMQKSFCHLTGIKEYAVEALTFLNWLNEDNFQFMGMRYHPLVAGQKQVKLDHDMPTELGILRDSSIVVLGFDRVTPATRSFPEGNDFLIITKSNVISVIYRRTYMDHIGIKHFDERGNLIGELHVVGFFTRLVYSQRASKIPLLREKIVKVQNLLNFHPNSHSSRMLQNTLEFYPRDELFQIDSTLLASFCEQIIDIMDRPRVRVLPRIDRFNHFFSSLIYIPREYFDSFVREKIGNYLSEVCEGHVAFYSSILEEGLVRIHFVIVRSGGEISHPSQESLEEGVRSIVACWEDKFYKSAGDGVPRFIFSQTFRDVFSPEKAVEDLPYIISCAEGKEKLRVCFENKEDGKVQIKIFHARGPFSLSKRVPLLENLGFTVISEDTFEIKMLADDEEHLVVLYQMDLSPATIARFDLVDRRDALVEAFKYIFHERVDNDSFNHLIMLTDLRVYEISVLRSYARYLRQASVTWSQNFIARVLSKNPTISQLLFSLFRYRFDPSLSDQERGENTKRILGEIDSALLKVPSLDDDTVLRSYVNLISGTLRTNYFQKNQDDIALVFKFDSRKINSVGTDELHREIFVYGVEVEGVHLRCGKIARGGLRWSDRAADYRTEVLGLVRAQKVKNAVIVPVGAKGGFYPKRLPSEGRRDEIIKIGREAYKTYVRALLSITDNFEGQEIIHPDNTVCLDGNDPYFVVAADKGTATFSDTANILAQEAKFWLDDAFASGGSMGYDHKKMGITARGAWETVKRHFREMDIDIQSTPFTVAGVGDMSGDVFGNGMLLSRKIQLVAAFDHSDIFIDPDPNSETTFDERKRLFDSPSSSWQDFDRKVLSKGGMIISRKEKAVQLTPEAVAVIGISKQIATPSEIISAILMASVDLLWFGGIGTYIRAPRENNADIGDKGNNILRVTADKVRAKVIGEGANLGLTQQARVVYSLNGGRINSDAIDNSGGVNCSDLEVNIKIALASAMRDGRLTLENRNKLLSSMTSEVVELVLRNNYLQSLAISLESRKGMAMMWNFAQLMKFLGKEGALDRELEHLPSVVSFEERIREEVSLSRPEIAILLAYAKLKLSEQLLDSTLIDDPFFFSILLSYFPRQLSELYSEDIMNHQLRRAIVATVLANEIINKGGSCFVVSLAKETGSSTEDVIRSAVIAYAGYELESLWQEVDKLDNQISGELQNKIYEEIRLIFINLTRLLIKNGKFIGDIGNAVKRLVTAFHKLNSLLQEKIPVEWLERFNNWVTNLTNKGFPPDLADRIVRMQFLMVVPDLIDISETCDTSLLVVLDMWSAISVGLGVDRLLSVAHNVVVDDHYENLALSAGLDWMYSARREMIVKAITTGSSVATIMQNEKWKEVKDQVFDILSVEKEVTVAHITVATHLLSGFLLKI
MVISRDLKRSKIIGDVDIAIAILGLPSFSASAMFGEASIDDLEKYTPQMLALTSVVSYDIFAGWDHSSACCIDIREVEGINPSGISISIITVIVDNIPFLYQSIIGEIVARCRNLTMAVHPVFTKDKNCDWQLYSPESCGIAQKQISLIQIHCLKITPEEAIEIKKQLIFIIEQLKLVSQDSREMLASLEKMQKSFCHLTGIKEYAVEALTFLNWLNEDNFQFMGMRYHPLVAGQKQVKLDHDMPTELGILRDSSIVVLGFDRVTPATRSFPEGNDFLIITKSNVISVIYRRTYMDHIGIKHFDERGNLIGELHVVGFFTRLVYSQRASKIPLLREKIVKVQNLLNFHPNSHSSRMLQNTLEFYPRDELFQIDSTLLASFCEQIIDIMDRPRVRVLPRIDRFNHFFSSLIYIPREYFDSFVREKIGNYLSEVCEGHVAFYSSILEEGLVRIHFVIVRSGGEISHPSQESLEEGVRSIVACWEDKFYKSAGDGVPRFIFSQTFRDVFSPEKAVEDLPYIISCAEGKEKLRVCFENKEDGKVQIKIFHARGPFSLSKRVPLLENLGFTVISEDTFEIKMLADDEEHLVVLYQMDLSPATIARFDLVDRRDALVEAFKYIFHERVDNDSFNHLIMLTDLRVYEISVLRSYARYLRQASVTWSQNFIARVLSKNPTISQLLFSLFRYRFDPSLSDQERGENTKRILGEIDSALLKVPSLDDDTVLRSYVNLISGTLRTNYFQKNQDDIALVFKFDSRKINSVGTDELHREIFVYGVEVEGVHLRCGKIARGGLRWSDRAADYRTEVLGLVRAQKVKNAVIVPVGAKGGFYPKRLPSEGRRDEIIKIGREAYKTYVRALLSITDNFEGQEIIHPDNTVCLDGNDPYFVVAADKGTATFSDTANILAQEAKFWLDDAFASGGSMGYDHKKMGITARGAWETVKRHFREMDIDIQSTPFTVAGVGDMSGDVFGNGMLLSRKIQLVAAFDHSDIFIDPDPNSETTFDERKRLFDSPSSSWQDFDRKVLSKGGMIISRKEKAVQLTPEAVAVIGISKQIATPSEIISAILMASVDLLWFGGIGTYIRAPRENNADIGDKGNNILRVTADKVRAKVIGEGANLGLTQQARVVYSLNGGRINSDAIDNSGGVNCSDLEVNIKIALASAMRDGRLTLENRNKLLSSMTSEVVELVLRNNYLQSLAISLESRKGMAMMWNFAQLMKFLGKEGALDRELEHLPSVVSFEERIREEVSLSRPEIAILLAYAKLKLSEQLLDSTLIDDPFFFSILLSYFPRQLSELYSEDIMNHQLRRAIVATVLANEIINKGGSCFVVSLAKETGSSTEDVIRSAVIAYAGYELESLWQEVDKLDNQISGELQNKIYEEIRLIFINLTRLLIKNGKFIGDIGNAVKRLVTAFHKLNSLLQEKIPVEWLERFNNWVTNLTNKGFPPDLADRIVRMQFLMVVPDLIDISETCDTSLLVVLDMWSAISVGLGVDRLLSVAHNVVVDDHYENLALSAGLDWMYSARREMIVKAITTGSSVATIMQNEKWKEVKDQVFDILSVEKEVTVAHITVATHLLSGFLLKI
MVISRDLKRSKIIGDVDIAIAILGLPSFSASAMFGEASIDDLEKYTPQMLALTSVVSYDIFAGWDHSSACCIDIREVEGINPSGISISIITVIVDNIPFLYQSIIGEIVARCRNLTMAVHPVFTKDKNCDWQLYSPESCGIAQKQISLIQIHCLKITPEEAIEIKKQLIFIIEQLKLVSQDSREMLASLEKMQKSFCHLTGIKEYAVEALTFLNWLNEDNFQFMGMRYHPLVAGQKQVKLDHDMPTELGILRDSSIVVLGFDRVTPATRSFPEGNDFLIITKSNVISVIYRRTYMDHIGIKHFDERGNLIGELHVVGFFTRLVYSQRASKIPLLREKIVKVQNLLNFHPNSHSSRMLQNTLEFYPRDELFQIDSTLLASFCEQIIDIMDRPRVRVLPRIDRFNHFFSSLIYIPREYFDSFVREKIGNYLSEVCEGHVAFYSSILEEGLVRIHFVIVRSGGEISHPSQESLEEGVRSIVACWEDKFYKSAGDGVPRFIFSQTFRDVFSPEKAVEDLPYIISCAEGKEKLRVCFENKEDGKVQIKIFHARGPFSLSKRVPLLENLGFTVISEDTFEIKMLADDEEHLVVLYQMDLSPATIARFDLVDRRDALVEAFKYIFHERVDNDSFNHLIMLTDLRVYEISVLRSYARYLRQASVTWSQNFIARVLSKNPTISQLLFSLFRYRFDPSLSDQERGENTKRILGEIDSALLKVPSLDDDTVLRSYVNLISGTLRTNYFQKNQDDIALVFKFDSRKINSVGTDELHREIFVYGVEVEGVHLRCGKIARGGLRWSDRAADYRTEVLGLVRAQKVKNAVIVPVGAKGGFYPKRLPSEGRRDEIIKIGREAYKTYVRALLSITDNFEGQEIIHPDNTVCLDGNDPYFVVAADKGTATFSDTANILAQEAKFWLDDAFASGGSMGYDHKKMGITARGAWETVKRHFREMDIDIQSTPFTVAGVGDMSGDVFGNGMLLSRKIQLVAAFDHSDIFIDPDPNSETTFDERKRLFDSPSSSWQDFDRKVLSKGGMIISRKEKAVQLTPEAVAVIGISKQIATPSEIISAILMASVDLLWFGGIGTYIRAPRENNADIGDKGNNILRVTADKVRAKVIGEGANLGLTQQARVVYSLNGGRINSDAIDNSGGVNCSDLEVNIKIALASAMRDGRLTLENRNKLLSSMTSEVVELVLRNNYLQSLAISLESRKGMAMMWNFAQLMKFLGKEGALDRELEHLPSVVSFEERIREEVSLSRPEIAILLAYAKLKLSEQLLDSTLIDDPFFFSILLSYFPRQLSELYSEDIMNHQLRRAIVATVLANEIINKGGSCFVVSLAKETGSSTEDVIRSAVIAYAGYELESLWQEVDKLDNQISGELQNKIYEEIRLIFINLTRLLIKNGKFIGDIGNAVKRLVTAFHKLNSLLQEKIPVEWLERFNNWVTNLTNKGFPPDLADRIVRMQFLMVVPDLIDISETCDTSLLVVLDMWSAISVGLGVDRLLSVAHNVVVDDHYENLALSAGLDWMYSARREMIVKAITTGSSVATIMQNEKWKEVKDQVFDILSVEKEVTVAHITVATHLLSGFLLKI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target1576 NAD-glutamate dehydrogenase [Candidatus Liberibacter as
3151221541587 NAD-glutamate dehydrogenase [Candidatus Liberibacter so 1 0.0
3271912241642 putative NAD-specific glutamate dehydrogenase protein [ 1 0.0
2095514841591 NAD-glutamate dehydrogenase [Rhizobium leguminosarum bv 1 0.0
1162544441592 NAD-dependent glutamate dehydrogenase (NAD(+)-dependent 1 0.0
2412069201591 NAD-glutamate dehydrogenase [Rhizobium leguminosarum bv 1 0.0
2220879121596 NAD-specific glutamate dehydrogenase protein [Agrobacte 1 0.0
863596831591 putative NAD-specific glutamate dehydrogenase protein [ 1 0.0
1908939601651 NAD-specific glutamate dehydrogenase [Rhizobium etli CI 1 0.0
158900151585 NAD-glutamate dehydrogenase [Agrobacterium tumefaciens 1 0.0
3073161341595 NAD-glutamate dehydrogenase [Sinorhizobium meliloti AK8 1 0.0
>gi|315122154|ref|YP_004062643.1| NAD-glutamate dehydrogenase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 1587 Back     alignment and organism information
 Score = 2590 bits (6713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1265/1587 (79%), Positives = 1413/1587 (89%), Gaps = 12/1587 (0%)

Query: 2    VISRDLKRSKIIGDVDIAIAILGLPSFSASAMFGEASIDDLEKYTPQMLALTSVVSYDIF 61
            + SR+LKRS+II DV+ AIA+LGLPSFS+S MF +A+IDDLE+YTP MLALT++VS+DI 
Sbjct: 1    MFSRNLKRSRIIDDVNAAIAVLGLPSFSSSVMFEKANIDDLERYTPLMLALTAIVSHDIL 60

Query: 62   AGWDHS-SACCIDIREVEGINPSGISISIITVIVDNIPFLYQSIIGEIVARCRNLTMAVH 120
              WD S SA CIDIREVEGINPSG S SI+TVIVDN+PFLYQS+IGEIVA  RN+ MA+H
Sbjct: 61   MDWDSSPSAECIDIREVEGINPSGASTSIVTVIVDNLPFLYQSVIGEIVASHRNIMMAIH 120

Query: 121  PVFTKDKNCDWQLYSPESCGIAQKQISLIQIHCLKITPEEAIEIKKQLIFIIEQLKLVSQ 180
            PV  KDKN DW LYSPE   I+Q+QISLIQ+H  KI+P EA +IKKQLIFII+QLKL++Q
Sbjct: 121  PVLVKDKNSDWHLYSPEIHDISQRQISLIQVHIPKISPAEAEDIKKQLIFIIDQLKLIAQ 180

Query: 181  DSREMLASLEKMQKSFCHLTGIK-----EYAVEALTFLNWLNEDNFQFMGMRYHPLVAGQ 235
            DS+ M +S++++Q S    T +      E  VEALTFL+WL EDNF+FMGMRY+     Q
Sbjct: 181  DSQAMHSSIDEIQNSLSRFTNVSNKNKGEDIVEALTFLDWLKEDNFKFMGMRYYSQGVEQ 240

Query: 236  KQVKLDHDMPTELGILRDSSIVVLGFDR----VTPATRSFPEGNDFLIITKSNVISVIYR 291
            +++ L+HD+ + LGIL++  +++L F R    V P  R F EG DFLI+TKSNV+SV+YR
Sbjct: 241  EKIGLNHDVASGLGILKNPDLLILSFYREDKLVEPEVRDFLEGPDFLIVTKSNVMSVVYR 300

Query: 292  RTYMDHIGIKHFDERGNLIGELHVVGFFTRLVYSQRASKIPLLREKIVKVQNLLNFHPNS 351
            R YMD IGIKHFDE+G LIGELHVVGFFT L YSQRA+KIPLLREKI+KVQNLLNF+P+S
Sbjct: 301  RAYMDFIGIKHFDEKGKLIGELHVVGFFTHLAYSQRATKIPLLREKIIKVQNLLNFYPDS 360

Query: 352  HSSRMLQNTLEFYPRDELFQIDSTLLASFCEQIIDIMDRPRVRVLPRIDRFNHFFSSLIY 411
            HS RMLQN LE YPRDELFQID  LLASFCEQIIDI+DRPR RVLPRIDRFN F S LIY
Sbjct: 361  HSDRMLQNMLESYPRDELFQIDPMLLASFCEQIIDIIDRPRTRVLPRIDRFNRFVSLLIY 420

Query: 412  IPREYFDSFVREKIGNYLSEVCEGHV-AFYSSILEEGLVRIHFVIVRSGGEISHPSQESL 470
            IPREYFDS VREKIGNYLSEV  GHV AFYSS LEEGLVRIHFVI RSGGE  +PSQE L
Sbjct: 421  IPREYFDSSVREKIGNYLSEVYVGHVSAFYSSFLEEGLVRIHFVIGRSGGETPNPSQEYL 480

Query: 471  EEGVRSIVACWEDKFYKSAGDGVPRFIFSQTFRDVFSPEKAVEDLPYIISCAEGKEKLRV 530
            EEGVRSIVA WE+KFYKSAGDG+PRF+FSQTF+DVFSPEKAV+ L YI +C EGKEKL V
Sbjct: 481  EEGVRSIVAYWEEKFYKSAGDGIPRFVFSQTFQDVFSPEKAVKYLHYITNCTEGKEKLCV 540

Query: 531  CFENKEDGKVQIKIFHARGPFSLSKRVPLLENLGFTVISEDTFEIKMLADDEEHLVVLYQ 590
             F +KEDG +QIKIFHA  PFSLSKRVPLLENLGFTVISEDTFEIKM+ADD EHLVVLYQ
Sbjct: 541  DFSSKEDGGIQIKIFHANEPFSLSKRVPLLENLGFTVISEDTFEIKMIADDGEHLVVLYQ 600

Query: 591  MDLSPATIARFDLVDRRDALVEAFKYIFHERVDNDSFNHLIMLTDLRVYEISVLRSYARY 650
            MDL PA   +FDL +RRDALVEAFKYIF +RVDNDSFNHLIMLTDLRVYEISVLRSYARY
Sbjct: 601  MDLKPANAVQFDLENRRDALVEAFKYIFQDRVDNDSFNHLIMLTDLRVYEISVLRSYARY 660

Query: 651  LRQASVTWSQNFIARVLSKNPTISQLLFSLFRYRFDPSLSDQERGENTKRILGEIDSALL 710
            LRQ SV WSQ+FIA++LSKNP+ISQLLFSLF  RFDP+LS++ER ++ K IL EIDS+LL
Sbjct: 661  LRQTSVIWSQDFIAQILSKNPSISQLLFSLFHSRFDPNLSNKERDKSIKGILKEIDSSLL 720

Query: 711  KVPSLDDDTVLRSYVNLISGTLRTNYFQKNQDDIALVFKFDSRKINSVGTDELHREIFVY 770
            KV SLDDDTVLR YVNLI GTLRTNYFQK+  D+ALVFKFDS +I S+G +ELHREIFVY
Sbjct: 721  KVSSLDDDTVLRCYVNLIIGTLRTNYFQKHPYDLALVFKFDSSQIKSLGAEELHREIFVY 780

Query: 771  GVEVEGVHLRCGKIARGGLRWSDRAADYRTEVLGLVRAQKVKNAVIVPVGAKGGFYPKRL 830
             VEVEGVHLRCGKIARGGLRWSDRA DYRTEVLGLVRAQKVKNAVIVPVGAKGGFYPKRL
Sbjct: 781  CVEVEGVHLRCGKIARGGLRWSDRAEDYRTEVLGLVRAQKVKNAVIVPVGAKGGFYPKRL 840

Query: 831  PSEGRRDEIIKIGREAYKTYVRALLSITDNFEGQEIIHPDNTVCLDGNDPYFVVAADKGT 890
            PSEG RDEIIKIGR+AYKTY+RALLS+TDNFEGQ+IIHP NTVCLDG+DPYFVVAADKGT
Sbjct: 841  PSEGPRDEIIKIGRKAYKTYIRALLSVTDNFEGQKIIHPANTVCLDGDDPYFVVAADKGT 900

Query: 891  ATFSDTANILAQEAKFWLDDAFASGGSMGYDHKKMGITARGAWETVKRHFREMDIDIQST 950
            ATFSDTAN L+QEAKFWLDDAFASGGS GYDHKKM ITARGAWETVKRHFREMDIDIQ+ 
Sbjct: 901  ATFSDTANSLSQEAKFWLDDAFASGGSKGYDHKKMAITARGAWETVKRHFREMDIDIQTM 960

Query: 951  PFTVAGVGDMSGDVFGNGMLLSRKIQLVAAFDHSDIFIDPDPNSETTFDERKRLFDSPSS 1010
            PFTVAGVGDMSGDVFGNGMLLSR+I+LVAAFD SDIFIDPDP+ ETTF+ERKRLF++PSS
Sbjct: 961  PFTVAGVGDMSGDVFGNGMLLSRQIKLVAAFDRSDIFIDPDPDLETTFNERKRLFNAPSS 1020

Query: 1011 SWQDFDRKVLSKGGMIISRKEKAVQLTPEAVAVIGISKQIATPSEIISAILMASVDLLWF 1070
            SWQDFDRKVLSKGGMIISR+EK+V+LTPEA AVIG+SK I T SEI+SAILMA VDLLWF
Sbjct: 1021 SWQDFDRKVLSKGGMIISRREKSVRLTPEAAAVIGVSKAINTSSEIVSAILMAPVDLLWF 1080

Query: 1071 GGIGTYIRAPRENNADIGDKGNNILRVTADKVRAKVIGEGANLGLTQQARVVYSLNGGRI 1130
            GGIGTYI + ++++ADIGDK NNI+RVTAD V+AKVIGEGANLGLTQ+AR+VYSL+GGRI
Sbjct: 1081 GGIGTYISSSQDSDADIGDKANNIVRVTADNVQAKVIGEGANLGLTQRARIVYSLSGGRI 1140

Query: 1131 NSDAIDNSGGVNCSDLEVNIKIALASAMRDGRLTLENRNKLLSSMTSEVVELVLRNNYLQ 1190
            NSDAIDNS GVNCSDLEVNIKIALASAMRDGRLTLE+RNKLLSSMTSEV+ LVLRNNYLQ
Sbjct: 1141 NSDAIDNSAGVNCSDLEVNIKIALASAMRDGRLTLEDRNKLLSSMTSEVIALVLRNNYLQ 1200

Query: 1191 SLAISLESRKGMAMMWNFAQLMKFLGKEGALDRELEHLPSVVSFEERIREEVSLSRPEIA 1250
            SLAISLE RKGMAMMWNFAQLMKFL KEG+LDR++EHLPS+ +FEERI  ++ LSRPE+ 
Sbjct: 1201 SLAISLEVRKGMAMMWNFAQLMKFLEKEGSLDRKIEHLPSIAAFEERISADIPLSRPEVG 1260

Query: 1251 ILLAYAKLKLSEQLLDSTLIDDPFFFSILLSYFPRQLSELYSEDIMNHQLRRAIVATVLA 1310
            ILL+YAKLKLSE+LL+ TLIDDP+F ++LL+YFP +LS+LYSEDIMNHQLRRAI+ATVLA
Sbjct: 1261 ILLSYAKLKLSEKLLEGTLIDDPWFTNLLLNYFPEKLSQLYSEDIMNHQLRRAIIATVLA 1320

Query: 1311 NEIINKGGSCFVVSLAKETGSSTEDVIRSAVIAYAGYELESLWQEVDKLDNQISGELQNK 1370
            N IINKGGSCFVVSL+KET SS E+V+RSAVIAYAGYEL+ LW+EVD+LDNQISGELQNK
Sbjct: 1321 NRIINKGGSCFVVSLSKETSSSIENVVRSAVIAYAGYELDYLWKEVDRLDNQISGELQNK 1380

Query: 1371 IYEEIRLIFINLTRLLIKNGKFIGDIGNAVKRLVTAFHKLNSLLQEKIPVEWLERFNNWV 1430
            IYEEIR IFINLTRLLIKNG FIGDIGNAVKRL+TAFHKL++LLQEKIP EW ERFN  V
Sbjct: 1381 IYEEIRFIFINLTRLLIKNGTFIGDIGNAVKRLLTAFHKLDALLQEKIPEEWSERFNKRV 1440

Query: 1431 TNLTNKGFPPDLADRIVRMQFLMVVPDLIDISETCDTSLLVVLDMWSAISVGLGVDRLLS 1490
             NL + GFPPD+A++IVRMQFLMVVPDLIDISETC+TSLLVVLDMWSAIS GLGVDRLLS
Sbjct: 1441 MNLISNGFPPDIANKIVRMQFLMVVPDLIDISETCNTSLLVVLDMWSAISAGLGVDRLLS 1500

Query: 1491 VAHNVVVDDHYENLALSAGLDWMYSARREMIVKAITTGSSVATIMQNEKWKEVKDQVFDI 1550
            VA+NVVVDDHYENLALSAGLDWMYSARREMI KAIT GSSVATIMQNEKW+EVKDQVFDI
Sbjct: 1501 VANNVVVDDHYENLALSAGLDWMYSARREMIAKAITAGSSVATIMQNEKWQEVKDQVFDI 1560

Query: 1551 LSV-EKEVTVAHITVATHLLSGFLLKI 1576
            LS  E+EVTVA ITVATHLLSGFLLKI
Sbjct: 1561 LSTEEEEVTVAQITVATHLLSGFLLKI 1587


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|327191224|gb|EGE58267.1| putative NAD-specific glutamate dehydrogenase protein [Rhizobium etli CNPAF512] Length = 1642 Back     alignment and organism information
>gi|209551484|ref|YP_002283401.1| NAD-glutamate dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 1591 Back     alignment and organism information
>gi|116254444|ref|YP_770282.1| NAD-dependent glutamate dehydrogenase (NAD(+)-dependent glutamate dehydrogenase) [Rhizobium leguminosarum bv. viciae 3841] Length = 1592 Back     alignment and organism information
>gi|241206920|ref|YP_002978016.1| NAD-glutamate dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 1591 Back     alignment and organism information
>gi|222087912|ref|YP_002546450.1| NAD-specific glutamate dehydrogenase protein [Agrobacterium radiobacter K84] Length = 1596 Back     alignment and organism information
>gi|86359683|ref|YP_471575.1| putative NAD-specific glutamate dehydrogenase protein [Rhizobium etli CFN 42] Length = 1591 Back     alignment and organism information
>gi|190893960|ref|YP_001980502.1| NAD-specific glutamate dehydrogenase [Rhizobium etli CIAT 652] Length = 1651 Back     alignment and organism information
>gi|15890015|ref|NP_355696.1| NAD-glutamate dehydrogenase [Agrobacterium tumefaciens str. C58] Length = 1585 Back     alignment and organism information
>gi|307316134|ref|ZP_07595578.1| NAD-glutamate dehydrogenase [Sinorhizobium meliloti AK83] Length = 1595 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target1576 NAD-glutamate dehydrogenase [Candidatus Liberibacter as
COG29021592 COG2902, COG2902, NAD-specific glutamate dehydrogenase 0.0
PTZ003241002 PTZ00324, PTZ00324, glutamate dehydrogenase 2; Provisio 6e-21
KOG2250514 KOG2250, KOG2250, KOG2250, Glutamate/leucine/phenylalan 1e-07
pfam00208237 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenylalani 1e-05
COG0334411 COG0334, GdhA, Glutamate dehydrogenase/leucine dehydrog 3e-05
smart00839102 smart00839, ELFV_dehydrog, Glutamate/Leucine/Phenylalan 2e-04
pfam050881526 pfam05088, Bac_GDH, Bacterial NAD-glutamate dehydrogena 0.0
>gnl|CDD|32727 COG2902, COG2902, NAD-specific glutamate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|185555 PTZ00324, PTZ00324, glutamate dehydrogenase 2; Provisional Back     alignment and domain information
>gnl|CDD|37461 KOG2250, KOG2250, KOG2250, Glutamate/leucine/phenylalanine/valine dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|143965 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>gnl|CDD|30682 COG0334, GdhA, Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|129072 smart00839, ELFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>gnl|CDD|147324 pfam05088, Bac_GDH, Bacterial NAD-glutamate dehydrogenase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 1576 NAD-glutamate dehydrogenase [Candidatus Liberibacter as
pfam050881526 Bac_GDH Bacterial NAD-glutamate dehydrogenase. This fam 100.0
COG29021592 NAD-specific glutamate dehydrogenase [Amino acid transp 100.0
PTZ003241020 glutamate dehydrogenase; Provisional 100.0
KOG2250514 consensus 99.97
PRK09414446 glutamate dehydrogenase; Provisional 99.74
PTZ00079469 NADP-specific glutamate dehydrogenase; Provisional 99.7
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Ami 99.67
pfam00208237 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine de 99.57
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate de 99.48
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate de 99.37
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of gluta 99.25
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucin 98.5
smart00839102 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine de 98.35
pfam02812131 ELFV_dehydrog_N Glu/Leu/Phe/Val dehydrogenase, dimeriza 96.98
PRK05092934 PII uridylyl-transferase; Provisional 96.83
PRK04374869 PII uridylyl-transferase; Provisional 95.81
PRK05007881 PII uridylyl-transferase; Provisional 91.96
PRK04374869 PII uridylyl-transferase; Provisional 94.32
PRK03381781 PII uridylyl-transferase; Provisional 93.29
TIGR01693903 UTase_glnD protein-P-II uridylyltransferase; InterPro: 92.13
>pfam05088 Bac_GDH Bacterial NAD-glutamate dehydrogenase Back     alignment and domain information
>COG2902 NAD-specific glutamate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00324 glutamate dehydrogenase; Provisional Back     alignment and domain information
>KOG2250 consensus Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>smart00839 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>pfam02812 ELFV_dehydrog_N Glu/Leu/Phe/Val dehydrogenase, dimerization domain Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD protein-P-II uridylyltransferase; InterPro: IPR010043 This entry describes GlnD, the uridylyltransferase/uridylyl-removing enzyme for signal-transduction protein PII, and acts as the sensory component of the nitrogen regulation (ntr) system Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target1576 NAD-glutamate dehydrogenase [Candidatus Liberibacter as
1b26_A416 Glutamate Dehydrogenase Length = 416 8e-10
1b3b_A415 Thermotoga Maritima Glutamate Dehydrogenase Mutant 9e-10
1bvu_A418 Glutamate Dehydrogenase From Thermococcus Litoralis 5e-09
2tmg_A415 Thermotoga Maritima Glutamate Dehydrogenase Mutant 8e-09
3k8z_A423 Crystal Structure Of Gudb1 A Decryptified Secondary 1e-07
1gtm_A419 Structure Of Glutamate Dehydrogenase Length = 419 9e-07
1euz_A419 Glutamate Dehydrogenase From Thermococcus Profundus 1e-06
1v9l_A421 L-Glutamate Dehydrogenase From Pyrobaculum Islandic 5e-06
1nr1_A496 Crystal Structure Of The R463a Mutant Of Human Glut 2e-04
1nqt_A496 Crystal Structure Of Bovine Glutamate Dehydrogenase 2e-04
1l1f_A505 Structure Of Human Glutamate Dehydrogenase-Apo Form 3e-04
3etd_A501 Structure Of Glutamate Dehydrogenase Complexed With 6e-04
3mw9_A501 Bovine Glutamate Dehydrogenase Complexed With Nadh, 8e-04
>gi|6730075|pdb|1B26|A Chain A, Glutamate Dehydrogenase Length = 416 Back     alignment and structure
 Score = 73.3 bits (179), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 69/367 (18%), Positives = 124/367 (33%), Gaps = 86/367 (23%)

Query: 785  ARGGLRWSDRAADYRTEVLGLVRAQKVKNAV--IVPVGAKGGFYPKRLPSEGRRDEIIKI 842
            A+GG+R+         EV  L      K AV  +   G KGG   +  P +  R+E+ ++
Sbjct: 68   AKGGIRY--HPDVTLDEVKALAFWMTWKTAVMNLPFGGGKGG--VRVDPKKLSRNELERL 123

Query: 843  GREAYKTYVRALLSITDNFEGQEIIHPDNTVCLDGNDPYFVVAADKGTATFSDTANILAQ 902
             R  +   ++ ++   ++    ++    + +    +     V       T          
Sbjct: 124  SRRFFSE-IQVIIGPYNDIPAPDVNTNADVIAWYMDTYSMNVG-----HTVLGIVT---- 173

Query: 903  EAKFWLDDAFASGGSMGYDHKKMGITARGAWETVKRHFREMDIDIQSTPFTVAGVGDMSG 962
                        GGS G    +   T RG           + ID +     V G G++ G
Sbjct: 174  ------GKPVELGGSKG----REEATGRGVKVCAGLAMDVLGIDPKKATVAVQGFGNV-G 222

Query: 963  DVFGNGMLLSRKI--QLVAAFDHSDIFIDPDPNSETTFDERKRLFDSPSSSWQDFDRKVL 1020
                  +L+S+++  ++VA  D      +P+       +E  R                 
Sbjct: 223  QFA--ALLISQELGSKVVAVSDSRGGIYNPE---GFDVEELIR---------------YK 262

Query: 1021 SKGGMIISRKEKAVQLTPEAVAVIGISKQIATPSEIISAILMASVDLLWFGGIGTYIRAP 1080
             + G +++                   K     +E    +L   VD+L        + A 
Sbjct: 263  KEHGTVVT-----------------YPKGERITNE---ELLELDVDIL--------VPAA 294

Query: 1081 RENNADIGDKGNNILRVTADKVRAKVIGEGANLGLTQQARVVYSLNGGRINSDAIDNSGG 1140
             E     G          A++++AK + EGAN   T +A  + S  G  +  D + N+GG
Sbjct: 295  LEGAIHAG---------NAERIKAKAVVEGANGPTTPEADEILSRRGILVVPDILANAGG 345

Query: 1141 VNCSDLE 1147
            V  S  E
Sbjct: 346  VTVSYFE 352


>gi|6730085|pdb|1B3B|A Chain A, Thermotoga Maritima Glutamate Dehydrogenase Mutant N97d, G376k Length = 415 Back     alignment and structure
>gi|6137475|pdb|1BVU|A Chain A, Glutamate Dehydrogenase From Thermococcus Litoralis Length = 418 Back     alignment and structure
>gi|6730587|pdb|2TMG|A Chain A, Thermotoga Maritima Glutamate Dehydrogenase Mutant S128r, T158e, N117r, S160e Length = 415 Back     alignment and structure
>gi|297342993|pdb|3K8Z|A Chain A, Crystal Structure Of Gudb1 A Decryptified Secondary Glutamate Dehydrogenase From B. Subtilis Length = 423 Back     alignment and structure
>gi|1942606|pdb|1GTM|A Chain A, Structure Of Glutamate Dehydrogenase Length = 419 Back     alignment and structure
gi|14278303|pdb|1EUZ|A Chain A, Glutamate Dehydrogenase From Thermococcus Profundus In The Unligated State Length = 419 Back     alignment and structure
gi|58177006|pdb|1V9L|A Chain A, L-Glutamate Dehydrogenase From Pyrobaculum Islandicum Complexed With Nad Length = 421 Back     alignment and structure
>gi|30749713|pdb|1NR1|A Chain A, Crystal Structure Of The R463a Mutant Of Human Glutamate Dehydrogenase Length = 496 Back     alignment and structure
>gi|30749701|pdb|1NQT|A Chain A, Crystal Structure Of Bovine Glutamate Dehydrogenase-Adp Complex Length = 496 Back     alignment and structure
>gi|20151189|pdb|1L1F|A Chain A, Structure Of Human Glutamate Dehydrogenase-Apo Form Length = 505 Back     alignment and structure
>gi|239781822|pdb|3ETD|A Chain A, Structure Of Glutamate Dehydrogenase Complexed With Bithionol Length = 501 Back     alignment and structure
>gi|298508693|pdb|3MW9|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nadh, Gtp, Glu Length = 501 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target1576 NAD-glutamate dehydrogenase [Candidatus Liberibacter as
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhibition 5e-07
1hwx_A501 GDH, glutamate dehydrogenase; allostery, abortive compl 6e-07
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, ox 5e-06
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxidoredu 2e-04
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.2 0.002
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} PDB: 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Length = 501 Back     alignment and structure
 Score = 52.9 bits (126), Expect = 5e-07
 Identities = 58/368 (15%), Positives = 94/368 (25%), Gaps = 77/368 (20%)

Query: 785  ARGGLRWSDRAADYRTEVLGLVRAQKVKNAVI-VPV-GAKGG--FYPKRLPSEGRRDEII 840
             +GG+R+S   +    EV  L      K AV+ VP  GAK G    PK            
Sbjct: 89   CKGGIRYSTDVS--VDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTDNELEKITR 146

Query: 841  KIGREAYKTYVRALLSITDNFEGQEIIHPDNTVCLDGND-PYFVVAADKGTATFSDTANI 899
            +   E  K              G  +  P   +     +  +           +   A+ 
Sbjct: 147  RFTMELAKKGFI----------GPGVDVPAPDMSTGEREMSWIADTYASTIGHYDINAHA 196

Query: 900  LAQEAKFWLDDAFASGGSMGYDHKKMGITARGAWETVKRHFREMDIDIQSTPFTVAGVGD 959
                             + G              E        M        F V G G+
Sbjct: 197  CVTGKPISQGGIHGRISATGRGV--FHGIENFINEASYMSILGMTPGFGDKTFVVQGFGN 254

Query: 960  MSGDVFGNGMLLSRKIQLVAAFDHSDIFIDPDPNSETTFDERKRLFDSPSSSWQDFDRKV 1019
            +         L     + +   +      +PD       ++                   
Sbjct: 255  VGL--HSMRYLHRFGAKCITVGESDGSIWNPDGIDPKELED------------------- 293

Query: 1020 LSKGGMIISRKEKAVQLTPEAVAVIGISKQIATPSEIISAILMASVDLLWFGGIGTYIRA 1079
                      +   +   P+A    G             +IL    D+L           
Sbjct: 294  -------FKLQHGTILGFPKAKIYEG-------------SILEVDCDILIPAASE----- 328

Query: 1080 PRENNADIGDKGNNILRVTADKVRAKVIGEGANLGLTQQARVVYSLNGGRINSDAIDNSG 1139
                          + +  A +V+AK+I EGAN   T +A  ++      +  D   N+G
Sbjct: 329  ------------KQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNIMVIPDLYLNAG 376

Query: 1140 GVNCSDLE 1147
            GV  S  E
Sbjct: 377  GVTVSYFE 384


>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Length = 424 Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Length = 421 Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus dsm 3638} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Length = 419 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target1576 NAD-glutamate dehydrogenase [Candidatus Liberibacter as
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxidoredu 99.92
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, ox 99.91
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.2 99.89
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug design, 99.85
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, muta 99.85
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90 99.79
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibac 99.64
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrogenase 99.62
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhibition 99.87
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
Probab=99.92  E-value=4.8e-23  Score=219.75  Aligned_cols=317  Identities=20%  Similarity=0.199  Sum_probs=226.2

Q ss_pred             CEEEEEEECCCC---CCCEEEEECCHHHHHHHHHHHHHHHHHCCC--CCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHH
Q ss_conf             657998405423---304042008857888889998998453287--428887532787168998899899999999999
Q gi|254780662|r  773 EVEGVHLRCGKI---ARGGLRWSDRAADYRTEVLGLVRAQKVKNA--VIVPVGAKGGFYPKRLPSEGRRDEIIKIGREAY  847 (1576)
Q Consensus       773 ~~eGvHlR~g~v---ARGGlRwSdR~edfrtEvlgL~kaQ~vKN~--vIvp~GaKGgfv~k~~~~~~~r~~~~~e~~~~y  847 (1576)
                      -|.|++..+..+   |+||+|++.  +.=..||+.|+++|..||+  .||-||+|||+.+.  |...+..    |..+..
T Consensus        53 ~~~g~rv~H~~~~GP~kGGiR~~~--~~~~~ev~~LA~~MT~K~al~~lp~GG~KggI~~d--p~~~~~~----e~~~~~  124 (421)
T 1v9l_A           53 VFEGYRVQHCDVLGPYKGGVRFHP--EVTLADDVALAILMTLKNSLAGLPYGGAKGAVRVD--PKKLSQR----ELEELS  124 (421)
T ss_dssp             EEEEEEEEEECSSSSEEEEEECCT--TCCHHHHHHHHHHHHHHHHHTTCSCCEEEEEECSC--GGGSCHH----HHHHHH
T ss_pred             EEEEEEEEECCCCCCCCCCCCCCC--CCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEEECC--CCCCCHH----HHHHHH
T ss_conf             998999998798788876303578--76899999999898999998389977776589679--8657878----999999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCEECCCCCCEEEEECCCCCCH-HHHH-HHHHHHHCCCCCCCHHCCCCC--CCCCCC
Q ss_conf             999989887762568884028831030538986799817788832-6899-999998808998501105699--998843
Q gi|254780662|r  848 KTYVRALLSITDNFEGQEIIHPDNTVCLDGNDPYFVVAADKGTAT-FSDT-ANILAQEAKFWLDDAFASGGS--MGYDHK  923 (1576)
Q Consensus       848 ~~fi~~lLditDN~~~g~vv~p~~vv~~d~~d~ylvvaaDkgTa~-fsD~-An~ia~~~gfwlgdAFaSGgs--~GydHK  923 (1576)
                      +.|.+.+-++.                  | +.+-+-|+|-||.. .++| +...+.-+|++.+..| +|++  .|-.+.
T Consensus       125 r~~~~~~~~~~------------------G-~~~dipapDvgt~~~~m~~~~d~~~~~~g~~~~~~~-tgk~~~~gG~~~  184 (421)
T 1v9l_A          125 RGYARAIAPLI------------------G-DVVDIPAPDVGTNAQIMAWMVDEYSKIKGYNVPGVF-TSKPPELWGNPV  184 (421)
T ss_dssp             HHHHHHHGGGC------------------B-TTTEEEECCTTCCHHHHHHHHHHHHHHHTSCCGGGS-CSCCSSSSCCGG
T ss_pred             HHHHHHHHHCC------------------C-CCCEECCCCCCCCHHHHHHHHHHEEEEEEEECCCCC-CCCCCCCCCCCC
T ss_conf             99999998607------------------9-984555776887999999986336689864025634-689754578887


Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCCCCHHHCCCCCEEEEEECCCEEEECCCCCCCCCHHHHHH
Q ss_conf             10114678999999999980899654864599605886332443111276620899973943686777881379899999
Q gi|254780662|r  924 KMGITARGAWETVKRHFREMDIDIQSTPFTVAGVGDMSGDVFGNGMLLSRKIQLVAAFDHSDIFIDPDPNSETTFDERKR 1003 (1576)
Q Consensus       924 ~mGITarGaw~~v~rhfrelg~D~q~~~fTvvgiGdmsGDVfGNgmLls~~i~lvaafdh~hif~DP~PD~~~s~~Er~R 1003 (1576)
                      ....|.+|+..+++.-+++++.+++...+.+-|.|...+.+.  -.|.-...|+|++.|+.+..+||+   +++.++..+
T Consensus       185 r~~atG~gv~~~~~~~~~~~~~~l~g~~vaIQGfGnVG~~~A--~~L~~~GakvvavsD~~G~i~~~~---Gld~~~l~~  259 (421)
T 1v9l_A          185 REYATGFGVAVATREMAKKLWGGIEGKTVAIQGMGNVGRWTA--YWLEKMGAKVIAVSDINGVAYRKE---GLNVELIQK  259 (421)
T ss_dssp             GGGHHHHHHHHHHHHHHHHHHSCCTTCEEEEECCSHHHHHHH--HHHHTTTCEEEEEECSSCEEECTT---CCCTHHHHH
T ss_pred             CCEEEEEEEHHHHHHHHHHCCCCCCCCEEEEECCCCHHHHHH--HHHHHCCCEEEEEECCCCCEECCC---CCCHHHHHH
T ss_conf             626998705788899997526996788799950784079999--988635868999974787422545---446999999


Q ss_pred             HHHCCCCCCCCCCHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCCCCHHHHHHHHCCCCCEEECCCCCCCEECCCCCC
Q ss_conf             99668987003897871789708982144421798999870988554288899986303653044338742111268986
Q gi|254780662|r 1004 LFDSPSSSWQDFDRKVLSKGGMIISRKEKAVQLTPEAVAVIGISKQIATPSEIISAILMASVDLLWFGGIGTYIRAPREN 1083 (1576)
Q Consensus      1004 Lf~lprssw~dyd~~liS~gGgv~~r~~k~i~ls~~~~~~l~~~~~~~~p~eli~~iL~a~vDLlw~gGiGTYvka~~e~ 1083 (1576)
                      +....+++..++-..   ..++                      +....|+    .++..++|+|.+|.+|--|      
T Consensus       260 ~~~~~g~~~~~~~~~---~~~~----------------------~~~~~~~----~i~~~~~DIliPcA~~~~I------  304 (421)
T 1v9l_A          260 NKGLTGPALVELFTT---KDNA----------------------EFVKNPD----AIFKLDVDIFVPAAIENVI------  304 (421)
T ss_dssp             TTTSCHHHHHHHHHH---TSCC----------------------CCCSSTT----GGGGCCCSEEEECSCSSCB------
T ss_pred             HHHCCHHHHHHHHCC---CCCC----------------------EEEECCH----HHHCCCCCEEEECCCCCEE------
T ss_conf             863330122211102---6883----------------------7960754----7512565577312420044------


Q ss_pred             CCCCCCCCCCCEECCCCCEEEEEEEECCCCCCCHHHHHHHHHCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             20015210000002588304689985551030767899999739868353313443732440476799986588770798
Q gi|254780662|r 1084 NADIGDKGNNILRVTADKVRAKVIGEGANLGLTQQARVVYSLNGGRINSDAIDNSGGVNCSDLEVNIKIALASAMRDGRL 1163 (1576)
Q Consensus      1084 ~~~vgd~and~~rv~g~~lr~kvi~EG~NLg~Tq~~Rie~a~~Gg~intDaidNsaGV~~Sd~EVniKIll~~~~~~g~l 1163 (1576)
                         ..        .|...++||+|+||||..+|+.|+-.+..+|+.+.+|++.|+|||++|.+|..     .. ...-..
T Consensus       305 ---~~--------~~a~~l~akiIvegAN~p~t~eA~~~L~~rGI~viPD~laNaGGVi~Sy~Ew~-----qn-~~~~~w  367 (421)
T 1v9l_A          305 ---RG--------DNAGLVKARLVVEGANGPTTPEAERILYERGVVVVPDILANAGGVIMSYLEWV-----EN-LQWYIW  367 (421)
T ss_dssp             ---CT--------TTTTTCCCSEEECCSSSCBCHHHHHHHHTTTCEEECHHHHSTHHHHHHHHHHH-----HH-HTTCCC
T ss_pred             ---CH--------HHHHHCCCCEEEECCCCCCCHHHHHHHHHCCCEEECHHHHCCCCCEEEHHHHH-----CC-CCCCCC
T ss_conf             ---28--------66741235779921799999779999997998997858813864102078776-----40-024689


Q ss_pred             CHHHHHHHHHH
Q ss_conf             98899889998
Q gi|254780662|r 1164 TLENRNKLLSS 1174 (1576)
Q Consensus      1164 t~~~Rn~lL~~ 1174 (1576)
                      +.++=++-|..
T Consensus       368 ~~eev~~~l~~  378 (421)
T 1v9l_A          368 DEEETRKRLEN  378 (421)
T ss_dssp             CHHHHHHHHHH
T ss_pred             CHHHHHHHHHH
T ss_conf             99999999999



>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus dsm 3638} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} PDB: 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target1576 NAD-glutamate dehydrogenase [Candidatus Liberibacter as
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxId: 23 99.41
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 99.38
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [ 99.34
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 99.29
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId 98.54
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913] 99.31
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421 98.61
d1v9la2176 Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 97.42
d1bgva2194 Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 97.34
d1c1da2148 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId 97.22
d1b26a2175 Glutamate dehydrogenase {Thermotoga maritima [TaxId: 23 97.0
d1gtma2178 Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [ 96.96
d1hwxa2208 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913] 96.62
d1leha2134 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421 96.39
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Aminoacid dehydrogenase-like, C-terminal domain
domain: Glutamate dehydrogenase
species: Thermotoga maritima [TaxId: 2336]
Probab=99.41  E-value=6.8e-12  Score=118.67  Aligned_cols=192  Identities=26%  Similarity=0.288  Sum_probs=140.5

Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCCCCHH-HCC-C-CCEEEEEECCCEEEECCC
Q ss_conf             6999988431011467899999999998089965486459960588633244311-127-6-620899973943686777
Q gi|254780662|r  915 GGSMGYDHKKMGITARGAWETVKRHFREMDIDIQSTPFTVAGVGDMSGDVFGNGM-LLS-R-KIQLVAAFDHSDIFIDPD  991 (1576)
Q Consensus       915 Ggs~GydHK~mGITarGaw~~v~rhfrelg~D~q~~~fTvvgiGdmsGDVfGNgm-Lls-~-~i~lvaafdh~hif~DP~  991 (1576)
                      |||.|-.    -=|++|++.+++.-++.+|.+++...|.+-|    .|.|.++.. +|+ + -.++|+.-|+.+-.++|+
T Consensus         1 GGs~gR~----eATg~Gv~~~~~~~~~~~~~~l~g~~vaIqG----~GnVG~~~a~~L~~e~Ga~vv~vsd~~G~i~~~~   72 (234)
T d1b26a1           1 GGSKGRE----EATGRGVKVCAGLAMDVLGIDPKKATVAVQG----FGNVGQFAALLISQELGSKVVAVSDSRGGIYNPE   72 (234)
T ss_dssp             TCCTTHH----HHHHHHHHHHHHHHHHHTTCCTTTCEEEEEC----CSHHHHHHHHHHHHHHCCEEEEEEETTEEEECTT
T ss_pred             CCCCCCC----CHHHHHHHHHHHHHHHHCCCCCCCCEEEEEC----CCHHHHHHHHHHHHHCCCCEEEEECCCCCEEECC
T ss_conf             9988855----2401889999999999759986889899989----8889999999999866875487645887088144


Q ss_pred             CCCCCCHHHHHHHHHCCCCCCCCCCHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCCCCHHHHHHHHCCCCCEEECCC
Q ss_conf             88137989999999668987003897871789708982144421798999870988554288899986303653044338
Q gi|254780662|r  992 PNSETTFDERKRLFDSPSSSWQDFDRKVLSKGGMIISRKEKAVQLTPEAVAVIGISKQIATPSEIISAILMASVDLLWFG 1071 (1576)
Q Consensus       992 PD~~~s~~Er~RLf~lprssw~dyd~~liS~gGgv~~r~~k~i~ls~~~~~~l~~~~~~~~p~eli~~iL~a~vDLlw~g 1071 (1576)
                         +.+..++.++.+..++.- +|.                              .....++++    ++..|+|.|.+|
T Consensus        73 ---Gld~~~l~~~~~~~~~~~-~~~------------------------------~~~~~~~~~----~~~~~~DI~~Pc  114 (234)
T d1b26a1          73 ---GFDVEELIRYKKEHGTVV-TYP------------------------------KGERITNEE----LLELDVDILVPA  114 (234)
T ss_dssp             ---CCCHHHHHHHHHHSSCST-TCS------------------------------SCEEECHHH----HHTSCCSEEEEC
T ss_pred             ---CCCHHHHHHHHHHHCCEE-CCC------------------------------CCEEECCCC----CCCCCCCEEECC
T ss_conf             ---202688899998621100-233------------------------------432212454----546664556002


Q ss_pred             CCCCEECCCCCCCCCCCCCCCCCEECCCCCEEEEEEEECCCCCCCHHHHHHHHHCCCEEECCCCCCCCCCCCCCHHHHHH
Q ss_conf             74211126898620015210000002588304689985551030767899999739868353313443732440476799
Q gi|254780662|r 1072 GIGTYIRAPRENNADIGDKGNNILRVTADKVRAKVIGEGANLGLTQQARVVYSLNGGRINSDAIDNSGGVNCSDLEVNIK 1151 (1576)
Q Consensus      1072 GiGTYvka~~e~~~~vgd~and~~rv~g~~lr~kvi~EG~NLg~Tq~~Rie~a~~Gg~intDaidNsaGV~~Sd~EVniK 1151 (1576)
                      .        .+. ....+        |...++||+|+||||-.+|+.+.-.+..+|+.+.+|++.|+|||.+|-+|..  
T Consensus       115 A--------~~~-~I~~~--------~a~~l~~~~I~e~AN~p~t~~a~~~L~~rgI~~~PD~~aNaGGVi~s~~E~~--  175 (234)
T d1b26a1         115 A--------LEG-AIHAG--------NAERIKAKAVVEGANGPTTPEADEILSRRGILVVPDILANAGGVTVSYFEWV--  175 (234)
T ss_dssp             S--------CTT-CBCHH--------HHTTCCCSEEECCSSSCBCHHHHHHHHHTTCEEECHHHHTTHHHHHHHHHHH--
T ss_pred             H--------HCC-CCCHH--------HHHHHHHCEEEECCCCCCCHHHHHHHHHCCEEEECHHHHCCCCEEEEEHHCC--
T ss_conf             1--------003-23688--------9997531457614889888779999997993885658861877442100014--


Q ss_pred             HHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             986588770798988998899987
Q gi|254780662|r 1152 IALASAMRDGRLTLENRNKLLSSM 1175 (1576)
Q Consensus      1152 Ill~~~~~~g~lt~~~Rn~lL~~m 1175 (1576)
                          +-...-..+.++-++-|.++
T Consensus       176 ----qn~~~~~w~~e~V~~~l~~~  195 (234)
T d1b26a1         176 ----QDLQSFFWDLDQVRNALEKM  195 (234)
T ss_dssp             ----HHHTTCCCCHHHHHHHHHHH
T ss_pred             ----CCCCHHCCCHHHHHHHHHHH
T ss_conf             ----55201101099999999999



>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1v9la2 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1bgva2 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1c1da2 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1b26a2 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gtma2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1leha2 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target1576 NAD-glutamate dehydrogenase [Candidatus Liberibacter as
2tmg_A_1-32_181-415267 Protein (glutamate dehydrogenase); metabolic role, 99.49
1bgv_A_202-449248 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 98.77
1vl6_A_168-323156 Malate oxidoreductase; TM0542, NAD-dependent malic 96.75
1v9l_A_177-395219 Glutamate dehydrogenase; protein-NAD complex, oxid 99.09
2bma_A_224-445222 Glutamate dehydrogenase (NADP+); malaria, drug des 98.92
1gtm_A_183-393211 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 98.59
1leh_A_1-137137 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 98.57
2bma_A_1-223_446-470248 Glutamate dehydrogenase (NADP+); malaria, drug des 97.37
1c1d_A_1-144144 L-phenylalanine dehydrogenase; amino acid dehydrog 97.24
1bgv_A_1-201201 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 97.05
2tmg_A_33-180148 Protein (glutamate dehydrogenase); metabolic role, 96.92
1gtm_A_1-182_394-419208 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 97.42
1v9l_A_1-176_396-421202 Glutamate dehydrogenase; protein-NAD complex, oxid 97.3
1hwx_A_1-207_475-501234 GDH, glutamate dehydrogenase; allostery, abortive 95.79
1hwx_A_242-372131 GDH, glutamate dehydrogenase; allostery, abortive 97.37
>2tmg_A (A:1-32,A:181-415) Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} Back     alignment and structure
Probab=99.49  E-value=2.2e-12  Score=126.47  Aligned_cols=166  Identities=24%  Similarity=0.262  Sum_probs=135.8

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCCCCHHH-CC--CCCEEEEEECCCEEEECCCCCCCCCHHHH
Q ss_conf             0114678999999999980899654864599605886332443111-27--66208999739436867778813798999
Q gi|254780662|r  925 MGITARGAWETVKRHFREMDIDIQSTPFTVAGVGDMSGDVFGNGML-LS--RKIQLVAAFDHSDIFIDPDPNSETTFDER 1001 (1576)
Q Consensus       925 mGITarGaw~~v~rhfrelg~D~q~~~fTvvgiGdmsGDVfGNgmL-ls--~~i~lvaafdh~hif~DP~PD~~~s~~Er 1001 (1576)
                      -..|+.|+..+++.-++.+|.|+....|.+.|.|    +|.+|-.. |.  ...|+|++.|+.+..+||+   |.+..|.
T Consensus        37 ~~ATg~GV~~~~~~al~~~g~~l~g~rvaIqGfG----~VG~~~A~~L~~e~GakiV~v~D~~G~i~~~~---GlD~~~L  109 (267)
T 2tmg_A           37 EEATGRGVKVCAGLAMDVLGIDPKKATVAVQGFG----NVGQFAALLISQELGSKVVAVSDSRGGIYNPE---GFDVEEL  109 (267)
T ss_dssp             TTHHHHHHHHHHHHHHHHTTCCTTTCEEEEECCS----HHHHHHHHHHHHTTCCEEEEEECSSCEEECTT---CCCHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEC----CCHHHHHHHHHHHCCCEEEEEECCCCEEECCC---CCCHHHH
T ss_conf             6678878899999888747998578759999806----81699998767757974999716773478875---6761679


Q ss_pred             HHHHHCCCCCCCCCCHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCCCCHHHHHHHHCCCCCEEECCCCCCCEECCCC
Q ss_conf             99996689870038978717897089821444217989998709885542888999863036530443387421112689
Q gi|254780662|r 1002 KRLFDSPSSSWQDFDRKVLSKGGMIISRKEKAVQLTPEAVAVIGISKQIATPSEIISAILMASVDLLWFGGIGTYIRAPR 1081 (1576)
Q Consensus      1002 ~RLf~lprssw~dyd~~liS~gGgv~~r~~k~i~ls~~~~~~l~~~~~~~~p~eli~~iL~a~vDLlw~gGiGTYvka~~ 1081 (1576)
                      .++.+.. -++.+|...                              ..++++    .++..++|+|.+|..+       
T Consensus       110 ~~~~~~~-g~~~~~~~a------------------------------~~~~~~----~i~~~~~DV~iP~A~~-------  147 (267)
T 2tmg_A          110 IRYKKEH-GTVVTYPKG------------------------------ERITNE----ELLELDVDILVPAALE-------  147 (267)
T ss_dssp             HHHHHHS-SCSTTCSSS------------------------------EEECHH----HHTTCSCSEEEECSST-------
T ss_pred             HHHHHHC-CCCCCCCCC------------------------------EECCCC----CCCCCCCCEEEECCCC-------
T ss_conf             9999861-876556674------------------------------433641----0005765689645766-------


Q ss_pred             CCCCCCCCCCCCCEECCCCCEEEEEEEECCCCCCCHHHHHHHHHCCCEEECCCCCCCCCCCCCCHHHH
Q ss_conf             86200152100000025883046899855510307678999997398683533134437324404767
Q gi|254780662|r 1082 ENNADIGDKGNNILRVTADKVRAKVIGEGANLGLTQQARVVYSLNGGRINSDAIDNSGGVNCSDLEVN 1149 (1576)
Q Consensus      1082 e~~~~vgd~and~~rv~g~~lr~kvi~EG~NLg~Tq~~Rie~a~~Gg~intDaidNsaGV~~Sd~EVn 1149 (1576)
                       ...+.         -+...++||+|+||+|..+|+.++-.++.+|+.+.+|++.|+|||+||.+|..
T Consensus       148 -~~I~~---------e~a~~l~ak~VvegAN~plt~ea~~~L~~rGI~v~PD~~aNaGGVi~s~~E~~  205 (267)
T 2tmg_A          148 -GAIHA---------GNAERIKAKAVVEGANGPTTPEADEILSRRGILVVPDILANAGGVTVSYFEWV  205 (267)
T ss_dssp             -TSBCH---------HHHTTCCCSEEECCSSSCBCHHHHHHHHHTTCEEECHHHHTCHHHHHHHHHHH
T ss_pred             -CCCCH---------HHHHHHHHCCEEECCCCCCCHHHHHHHHHCCEEEECHHHHCCCCEEEEHHHHH
T ss_conf             -77688---------89987622618715888889889999974891897768855887565579875



>1bgv_A (A:202-449) Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} Back     alignment and structure
>1vl6_A (A:168-323) Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCSG, protein structure initiative, PSI; 2.61A {Thermotoga maritima MSB8} Back     alignment and structure
>1v9l_A (A:177-395) Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} Back     alignment and structure
>2bma_A (A:224-445) Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>1gtm_A (A:183-393) Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1leh_A (A:1-137) Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} Back     alignment and structure
>2bma_A (A:1-223,A:446-470) Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>1c1d_A (A:1-144) L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} Back     alignment and structure
>1bgv_A (A:1-201) Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} Back     alignment and structure
>2tmg_A (A:33-180) Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} Back     alignment and structure
>1gtm_A (A:1-182,A:394-419) Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1v9l_A (A:1-176,A:396-421) Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} Back     alignment and structure