254780664

254780664

bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase

GeneID in NCBI database:8209668Locus tag:CLIBASIA_02755
Protein GI in NCBI database:254780664Protein Accession:YP_003065077.1
Gene range:+(603340, 604950)Protein Length:536aa
Gene description:bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
COG prediction:[F] AICAR transformylase/IMP cyclohydrolase PurH (only IMP cyclohydrolase domain in Aful)
KEGG prediction:purH; bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase (EC:3.5.4.10); K00602 phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
SEED prediction:IMP cyclohydrolase (EC 3.5.4.10) / Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
One carbon pool by folate [PATH:las00670]
Subsystem involved in SEED:De Novo Purine Biosynthesis;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530------
MDCFHRKDGDHGEIAVKTALISVHNKTGVVEFASRLLSRGIKIISTGGTCQLLEEEGIPVTSVFDITKFPEIMGGRVKTLHPKIYGGILSIRDNPAHMKFMQDHELESIDLVVVNLYPFEESFCREDDYYTMVENIDIGGPSMIRAAAKNHDYVTILTNPQDYPLFLAEMDVNNGKIPYNFRKKMARQAFSRTASYDTAICRWLANAESENFPDYLNITAVKKQEMRYGENPHQKAALYSTPEKKSGIAHAVLVQGKPLSYNNINDLDAAFELVSEFRSQDCAACVIVKHMNPCGVATADTLVEAYRRALSCDPISAFGGIIAFNREVDQEVAKEVIKVFTEAIIAPTLSEEAADVLAKKPSMRFLKTSSLLDFHGEEIVLKTVSGGILVQTRDNVVDNKELTVVTKRSPTDQELRDMKFAFKVVKHVKSNAVVYAKDGRTVGIGSGQTSRVDSTRFAAIKAHNISAQADVKSMTNGSVIASEAFYPFPDGIVEAIKAGVTAVIQPGGSVRDSEAITVADQHGIAMVFTGIRHFRH
ccccccccccccccEEEEEEEEEcccccHHHHHHHHHHcccEEEEEcHHHHHHHHccccEEEHHHHcccccccccEEEEccHHHHHHHHHccccHHHHHHHHHcccccccEEEEEcccHHHHHcccccHHHHHHHccccHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEcccccccccccccEEEEccccccccEEEEEccccccccHHHHHHHHHHHHHHcccccccEEEEEEccccccccccccHHHHHHHHHHcccccccccEEEEcccccHHHHHHHHHcEEEEEEcccccHHHHHHHHccccEEEEEEccccccccccEEEEEEccEEEEEEccccccccccEEEccccccHHHHHHHHHHHHHHHHHcccEEEEEEccEEEEEccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccccccHHHHHHHcccEEEEcccccccHHHHHHHHHHcccEEEEcccccccc
ccHHHHcccHccccHHHHEEEEEcccccHHHHHHHHHccccEEEccHHHHHHHHcccccEEcHHHHccccccHHHccccccHHHHHHHHcccccHHHHHHHHHcccccccEEEEEcccHHHHHcccccHHHHHHccccHHHHHHHHHHHHHHccEEEccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEccccccccccccccEEEEcccccccHHHHHHHccccccHccHccHHHHHHHHHHHccccccEEEEEEccccccccccccHHHHHHHHHcccccccccEEEEEccHHcHHHHHHHHHHHHHHHEcccccHHHHHHHHHcccEEEEEEccccccccccccEEEEcccEEEEcccccccHHHcEccccccccHHHHHHHHHHHHHHHccccccEEEEEccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccccEEEcccccccccHHHHHHHcccEEEEEccccccHHHHHHHHHHcccEEEEcccccccc
mdcfhrkdgdhgeIAVKTALISVHNKTGVVEFASRLLSRGIKIistggtcqlleeegipvtsvfditkfpeimggrvktlhpkiyggilsirdnpahmkfmqdhelesIDLVVvnlypfeesfcreddyytMVENIDIGGPSMIRAAaknhdyvtiltnpqdyplFLAEmdvnngkipyNFRKKMARQAFSRTASYDTAICRWLAnaesenfpdylNITAVKKQemrygenphqkaalystpekksgIAHAVLVqgkplsynninDLDAAFELVSEFRSQDCAACVIVkhmnpcgvaTADTLVEAYRRALscdpisafggIIAFNREVDQEVAKEVIKVFTEAIIAPTLSEEAADVlakkpsmrflktsslldfhgEEIVLKTVSggilvqtrdnvvdnkeltvvtkrsptdqeLRDMKFAFKVVKHVKSNAVvyakdgrtvgigsgqtsrvdsTRFAAIKAhnisaqadvksmtngsviaseafypfpdGIVEAIKAGVTAviqpggsvrdseaitVADQHGIAMVFTGIRHFRH
mdcfhrkdgdhgeiAVKTALISVHNKTGVVEFASRLLSRGIKIISTGGTCQLLEEEGIPVTSVFDITKFPEIMGGRVKTLHPKIYGGILSIRDNPAHMKFMQDHELESIDLVVVNLYPFEESFCREDDYYTMVENIDIGGPSMIRAAAKNHDYVTILTNPQDYPLFLAEMDVNNGKIPYNFRKKMARQAFSRTASYDTAICRWLAnaesenfpdyLNITAVKKQEMRYGENPHQKAALYSTPEKKSGIAHAVLVQGKPLSYNNINDLDAAFELVSEFRSQDCAACVIVKHMNPCGVATADTLVEAYRRALSCDPISAFGGIIAFNREVDQEVAKEVIKVFTEaiiaptlseeAADVLAKKPSMRFLKTSSLLDFHGEEIVLKTvsggilvqtrdnvvdnkeltvvtkrsptdqelrDMKFAFKvvkhvksnavvyakdgrtvgigsgqtsrvdSTRFAAIKAhnisaqadvksmTNGSVIASEAFYPFPDGIVEAIKAGVTAVIQPGGSVRDSEAITVADQHGIAMVFTGIRHFRH
MDCFHRKDGDHGEIAVKTALISVHNKTGVVEFASRLLSRGIKIISTGGTCQLLEEEGIPVTSVFDITKFPEIMGGRVKTLHPKIYGGILSIRDNPAHMKFMQDHELESIDLVVVNLYPFEESFCREDDYYTMVENIDIGGPSMIRAAAKNHDYVTILTNPQDYPLFLAEMDVNNGKIPYNFRKKMARQAFSRTASYDTAICRWLANAESENFPDYLNITAVKKQEMRYGENPHQKAALYSTPEKKSGIAHAVLVQGKPLSYNNINDLDAAFELVSEFRSQDCAACVIVKHMNPCGVATADTLVEAYRRALSCDPISAFGGIIAFNREVDQEVAKEVIKVFTEAIIAPTLSEEAADVLAKKPSMRFLKTSSLLDFHGEEIVLKTVSGGILVQTRDNVVDNKELTVVTKRSPTDQELRDMKFAFKVVKHVKSNAVVYAKDGRTVGIGSGQTSRVDSTRFAAIKAHNISAQADVKSMTNGSVIASEAFYPFPDGIVEAIKAGVTAVIQPGGSVRDSEAITVADQHGIAMVFTGIRHFRH
**************AVKTALISVHNKTGVVEFASRLLSRGIKIISTGGTCQLLEEEGIPVTSVFDITKFPEIMGGRVKTLHPKIYGGILSIRDNPAHMKFMQDHELESIDLVVVNLYPFEESFCREDDYYTMVENIDIGGPSMIRAAAKNHDYVTILTNPQDYPLFLAEMDVNNGKIPYNFRKKMARQAFSRTASYDTAICRWLANAESENFPDYLNITAVKKQEMRYGENPHQKAALYSTPEKKSGIAHAVLVQGKPLSYNNINDLDAAFELVSEFRSQDCAACVIVKHMNPCGVATADTLVEAYRRALSCDPISAFGGIIAFNREVDQEVAKEVIKVFTEAIIAPTLSEEAADVLAKKPSMRFLKTSSLLDFHGEEIVLKTVSGGILVQTRDNVVDNKELTVVTKRSPTDQELRDMKFAFKVVKHVKSNAVVYAKDGRTVGIGSGQTSRVDSTRFAAIKAHNISAQADVKSMTNGSVIASEAFYPFPDGIVEAIKAGVTAVIQPGGSVRDSEAITVADQHGIAMVFTGIRHFR*
********GDHGEIAVKTALISVHNKTGVVEFASRLLSRGIKIISTGGTCQLLEEEGIPVTSVFDITKFPEIMGGRVKTLHPKIYGGILSIRDNPAHMKFMQDHELESIDLVVVNLYPFEESFCREDDYYTMVENIDIGGPSMIRAAAKNHDYVTILTNPQDYPLFLAEMDVNNGKIPYNFRKKMARQAFSRTASYDTAICRWLANAESENFPDYLNITAVKKQEMRYGENPHQKAALYSTPEKKSGIAHAVLVQGKPLSYNNINDLDAAFELVSEFRSQDCAACVIVKHMNPCGVATADTLVEAYRRALSCDPISAFGGIIAFNREVDQEVAKEVIKVFTEAIIAPTLSEEAADVLAKKPSMRFLKTSSLLDFHGEEIVLKTVSGGILVQTRDNVVDNKELTVVTKRSPTDQELRDMKFAFKVVKHVKSNAVVYAKDGRTVGIGSGQTSRVDSTRFAAIKAHNISAQADVKSMTNGSVIASEAFYPFPDGIVEAIKAGVTAVIQPGGSVRDSEAITVADQHGIAMVFTGIRHFRH
MDCFHRKDGDHGEIAVKTALISVHNKTGVVEFASRLLSRGIKIISTGGTCQLLEEEGIPVTSVFDITKFPEIMGGRVKTLHPKIYGGILSIRDNPAHMKFMQDHELESIDLVVVNLYPFEESFCREDDYYTMVENIDIGGPSMIRAAAKNHDYVTILTNPQDYPLFLAEMDVNNGKIPYNFRKKMARQAFSRTASYDTAICRWLANAESENFPDYLNITAVKKQEMRYGENPHQKAALYSTPEKKSGIAHAVLVQGKPLSYNNINDLDAAFELVSEFRSQDCAACVIVKHMNPCGVATADTLVEAYRRALSCDPISAFGGIIAFNREVDQEVAKEVIKVFTEAIIAPTLSEEAADVLAKKPSMRFLKTSSLLDFHGEEIVLKTVSGGILVQTRDNVVDNKELTVVTKRSPTDQELRDMKFAFKVVKHVKSNAVVYAKDGRTVGIGSGQTSRVDSTRFAAIKAHNISAQADVKSMTNGSVIASEAFYPFPDGIVEAIKAGVTAVIQPGGSVRDSEAITVADQHGIAMVFTGIRHF**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDCFHRKDGDHGEIAVKTALISVHNKTGVVEFASRLLSRGIKIISTGGTCQLLEEEGIPVTSVFDITKFPEIMGGRVKTLHPKIYGGILSIRDNPAHMKFMQDHELESIDLVVVNLYPFEESFCREDDYYTMVENIDIGGPSMIRAAAKNHDYVTILTNPQDYPLFLAEMDVNNGKIPYNFRKKMARQAFSRTASYDTAICRWLANAESENFPDYLNITAVKKQEMRYGENPHQKAALYSTPEKKSGIAHAVLVQGKPLSYNNINDLDAAFELVSEFRSQDCAACVIVKHMNPCGVATADTLVEAYRRALSCDPISAFGGIIAFNREVDQEVAKEVIKVFTEAIIAPTLSEEAADVLAKKPSMRFLKTSSLLDFHGEEIVLKTVSGGILVQTRDNVVDNKELTVVTKRSPTDQELRDMKFAFKVVKHVKSNAVVYAKDGRTVGIGSGQTSRVDSTRFAAIKAHNISAQADVKSMTNGSVIASEAFYPFPDGIVEAIKAGVTAVIQPGGSVRDSEAITVADQHGIAMVFTGIRHFRH
MDCFHRKDGDHGEIAVKTALISVHNKTGVVEFASRLLSRGIKIISTGGTCQLLEEEGIPVTSVFDITKFPEIMGGRVKTLHPKIYGGILSIRDNPAHMKFMQDHELESIDLVVVNLYPFEESFCREDDYYTMVENIDIGGPSMIRAAAKNHDYVTILTNPQDYPLFLAEMDVNNGKIPYNFRKKMARQAFSRTASYDTAICRWLANAESENFPDYLNITAVKKQEMRYGENPHQKAALYSTPEKKSGIAHAVLVQGKPLSYNNINDLDAAFELVSEFRSQDCAACVIVKHMNPCGVATADTLVEAYRRALSCDPISAFGGIIAFNREVDQEVAKEVIKVFTEAIIAPTLSEEAADVLAKKPSMRFLKTSSLLDFHGEEIVLKTVSGGILVQTRDNVVDNKELTVVTKRSPTDQELRDMKFAFKVVKHVKSNAVVYAKDGRTVGIGSGQTSRVDSTRFAAIKAHNISAQADVKSMTNGSVIASEAFYPFPDGIVEAIKAGVTAVIQPGGSVRDSEAITVADQHGIAMVFTGIRHFRH
MDCFHRKDGDHGEIAVKTALISVHNKTGVVEFASRLLSRGIKIISTGGTCQLLEEEGIPVTSVFDITKFPEIMGGRVKTLHPKIYGGILSIRDNPAHMKFMQDHELESIDLVVVNLYPFEESFCREDDYYTMVENIDIGGPSMIRAAAKNHDYVTILTNPQDYPLFLAEMDVNNGKIPYNFRKKMARQAFSRTASYDTAICRWLANAESENFPDYLNITAVKKQEMRYGENPHQKAALYSTPEKKSGIAHAVLVQGKPLSYNNINDLDAAFELVSEFRSQDCAACVIVKHMNPCGVATADTLVEAYRRALSCDPISAFGGIIAFNREVDQEVAKEVIKVFTEAIIAPTLSEEAADVLAKKPSMRFLKTSSLLDFHGEEIVLKTVSGGILVQTRDNVVDNKELTVVTKRSPTDQELRDMKFAFKVVKHVKSNAVVYAKDGRTVGIGSGQTSRVDSTRFAAIKAHNISAQADVKSMTNGSVIASEAFYPFPDGIVEAIKAGVTAVIQPGGSVRDSEAITVADQHGIAMVFTGIRHFRH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target536 bifunctional phosphoribosylaminoimidazolecarboxamide fo
315122152537 bifunctional phosphoribosylaminoimidazolecarboxamide fo 1 0.0
218674384538 bifunctional phosphoribosylaminoimidazolecarboxamide fo 1 1e-178
190893962538 IMP cyclohydrolase/phosphoribosylaminoimidazolecarboxam 1 1e-178
209551486538 bifunctional phosphoribosylaminoimidazolecarboxamide fo 1 1e-177
327191222538 bifunctional phosphoribosylaminoimidazolecarboxamide fo 1 1e-177
86359685538 bifunctional phosphoribosylaminoimidazolecarboxamide fo 1 1e-176
218682185538 bifunctional phosphoribosylaminoimidazolecarboxamide fo 1 1e-176
306841596538 bifunctional purine biosynthesis protein PurH [Brucella 1 1e-175
239832895538 bifunctional purine biosynthesis protein PurH [Ochrobac 1 1e-175
241206922538 bifunctional phosphoribosylaminoimidazolecarboxamide fo 1 1e-175
>gi|315122152|ref|YP_004062641.1| bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 537 Back     alignment and organism information
 Score =  870 bits (2247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/537 (77%), Positives = 475/537 (88%), Gaps = 1/537 (0%)

Query: 1   MDCFHRKDGDHGEIAVKTALISVHNKTGVVEFASRLLSRGIKIISTGGTCQLLEEEGIPV 60
           MD  HRK     EI VK ALISV++KTG+VEF+ RLLS GIK++STGGTCQLLE+E IPV
Sbjct: 1   MDFSHRKYCGSDEILVKNALISVYDKTGIVEFSRRLLSWGIKLVSTGGTCQLLEKENIPV 60

Query: 61  TSVFDITKFPEIMGGRVKTLHPKIYGGILSIRDNPAHMKFMQDHELESIDLVVVNLYPFE 120
           T++ DIT FPEIM GRVKTLHPKIYGG+L IRDNP HM  M++H LESIDLVVVNLYPFE
Sbjct: 61  TNISDITGFPEIMDGRVKTLHPKIYGGLLGIRDNPEHMMAMREHGLESIDLVVVNLYPFE 120

Query: 121 ESFCREDDYYTMVENIDIGGPSMIRAAAKNHDYVTILTNPQDYPLFLAEMDVNNGKIPYN 180
           ES  RED+Y+T+VENIDIGGPSMIRAAAKNHDYVT+LT+ +DYPLFL+EM+ NNGK+  N
Sbjct: 121 ESCLREDEYHTIVENIDIGGPSMIRAAAKNHDYVTVLTDSKDYPLFLSEMESNNGKVLLN 180

Query: 181 FRKKMARQAFSRTASYDTAICRWLANAESENFPDYLNITAVKKQEMRYGENPHQKAALYS 240
           FRKKMA QAF RTASYD AICRW ANA++E+FPDYLNIT  KKQEMRYGENPHQKAALYS
Sbjct: 181 FRKKMALQAFFRTASYDAAICRWFANAKNEDFPDYLNITGTKKQEMRYGENPHQKAALYS 240

Query: 241 TPEKKSGIAHAVLVQGKPLSYNNINDLDAAFELVSEFRSQDCAACVIVKHMNPCGVATAD 300
              KKSGIA+A LVQGKPLSYNNINDLDAA+ELVSEF S+DCAACVIVKH NPCGVA AD
Sbjct: 241 ILNKKSGIANATLVQGKPLSYNNINDLDAAYELVSEFSSEDCAACVIVKHTNPCGVAIAD 300

Query: 301 TLVEAYRRALSCDPISAFGGIIAFNREVDQEVAKEVIKVFTEAIIAPTLSEEAADVLAKK 360
           TL+EAYRRALSCDP+SAFGGI+AFN+ +DQEVA+EVIK+FTE I+AP +S+EA  V+++K
Sbjct: 301 TLLEAYRRALSCDPMSAFGGIVAFNQALDQEVAREVIKIFTEVIVAPNISKEAEVVISEK 360

Query: 361 PSMRFLKTSSLLDFHGEEIVLKTVSGGILVQTRD-NVVDNKELTVVTKRSPTDQELRDMK 419
           P+MRFLKT  L D   ++IV KTVSGGILVQTRD NVVD++ELTVVTKRSPT +EL DMK
Sbjct: 361 PNMRFLKTFELSDPRAQDIVFKTVSGGILVQTRDNNVVDDQELTVVTKRSPTPKELSDMK 420

Query: 420 FAFKVVKHVKSNAVVYAKDGRTVGIGSGQTSRVDSTRFAAIKAHNISAQADVKSMTNGSV 479
           FA K+VKHVKSNAVV+AK+GRT+GIGSGQTSRVDSTRFAAIK+  ISAQ  +KS+T+G+V
Sbjct: 421 FALKIVKHVKSNAVVFAKEGRTIGIGSGQTSRVDSTRFAAIKSQGISAQEGIKSVTSGAV 480

Query: 480 IASEAFYPFPDGIVEAIKAGVTAVIQPGGSVRDSEAITVADQHGIAMVFTGIRHFRH 536
           IASEAFYPFPDGI+EAIKAGVTAVIQPGGS+RD E I+VADQH IAMVFTGIRHFRH
Sbjct: 481 IASEAFYPFPDGILEAIKAGVTAVIQPGGSIRDLEIISVADQHNIAMVFTGIRHFRH 537


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218674384|ref|ZP_03524053.1| bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Rhizobium etli GR56] Length = 538 Back     alignment and organism information
>gi|190893962|ref|YP_001980504.1| IMP cyclohydrolase/phosphoribosylaminoimidazolecarboxamide formyltransferase [Rhizobium etli CIAT 652] Length = 538 Back     alignment and organism information
>gi|209551486|ref|YP_002283403.1| bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 538 Back     alignment and organism information
>gi|327191222|gb|EGE58265.1| bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Rhizobium etli CNPAF512] Length = 538 Back     alignment and organism information
>gi|86359685|ref|YP_471577.1| bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Rhizobium etli CFN 42] Length = 538 Back     alignment and organism information
>gi|218682185|ref|ZP_03529786.1| bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Rhizobium etli CIAT 894] Length = 538 Back     alignment and organism information
>gi|306841596|ref|ZP_07474293.1| bifunctional purine biosynthesis protein PurH [Brucella sp. BO2] Length = 538 Back     alignment and organism information
>gi|239832895|ref|ZP_04681224.1| bifunctional purine biosynthesis protein PurH [Ochrobactrum intermedium LMG 3301] Length = 538 Back     alignment and organism information
>gi|241206922|ref|YP_002978018.1| bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 538 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target536 bifunctional phosphoribosylaminoimidazolecarboxamide fo
PRK00881513 PRK00881, purH, bifunctional phosphoribosylaminoimidazo 0.0
TIGR00355511 TIGR00355, purH, phosphoribosylaminoimidazolecarboxamid 1e-175
PLN02891547 PLN02891, PLN02891, IMP cyclohydrolase 1e-146
COG0138515 COG0138, PurH, AICAR transformylase/IMP cyclohydrolase 0.0
smart00798311 smart00798, AICARFT_IMPCHas, AICARFT/IMPCHase bienzyme 1e-140
pfam01808315 pfam01808, AICARFT_IMPCHas, AICARFT/IMPCHase bienzyme 1e-102
KOG2555588 KOG2555, KOG2555, KOG2555, AICAR transformylase/IMP cyc 1e-100
cd01421187 cd01421, IMPCH, Inosine monophosphate cyclohydrolase do 1e-67
PRK07106390 PRK07106, PRK07106, 5-aminoimidazole-4-carboxamide ribo 1e-32
smart0085190 smart00851, MGS, MGS-like domain 1e-18
pfam0214292 pfam02142, MGS, MGS-like domain 4e-16
cd00532112 cd00532, MGS-like, MGS-like domain 3e-07
PRK07106390 PRK07106, PRK07106, 5-aminoimidazole-4-carboxamide ribo 4e-15
PRK052941066 PRK05294, carB, carbamoyl phosphate synthase large subu 9e-07
cd01424110 cd01424, MGS_CPS_II, Methylglyoxal synthase-like domain 6e-05
PLN027351102 PLN02735, PLN02735, carbamoyl-phosphate synthase 1e-04
TIGR013691050 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, 8e-04
>gnl|CDD|179152 PRK00881, purH, bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|161835 TIGR00355, purH, phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase Back     alignment and domain information
>gnl|CDD|178479 PLN02891, PLN02891, IMP cyclohydrolase Back     alignment and domain information
>gnl|CDD|30487 COG0138, PurH, AICAR transformylase/IMP cyclohydrolase PurH (only IMP cyclohydrolase domain in Aful) [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|129034 smart00798, AICARFT_IMPCHas, AICARFT/IMPCHase bienzyme Back     alignment and domain information
>gnl|CDD|145132 pfam01808, AICARFT_IMPCHas, AICARFT/IMPCHase bienzyme Back     alignment and domain information
>gnl|CDD|37766 KOG2555, KOG2555, KOG2555, AICAR transformylase/IMP cyclohydrolase/methylglyoxal synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|29633 cd01421, IMPCH, Inosine monophosphate cyclohydrolase domain Back     alignment and domain information
>gnl|CDD|180841 PRK07106, PRK07106, 5-aminoimidazole-4-carboxamide ribonucleotide transformylase; Provisional Back     alignment and domain information
>gnl|CDD|129084 smart00851, MGS, MGS-like domain Back     alignment and domain information
>gnl|CDD|145348 pfam02142, MGS, MGS-like domain Back     alignment and domain information
>gnl|CDD|29632 cd00532, MGS-like, MGS-like domain Back     alignment and domain information
>gnl|CDD|180841 PRK07106, PRK07106, 5-aminoimidazole-4-carboxamide ribonucleotide transformylase; Provisional Back     alignment and domain information
>gnl|CDD|179998 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|29636 cd01424, MGS_CPS_II, Methylglyoxal synthase-like domain from type II glutamine-dependent carbamoyl phosphate synthetase (CSP) Back     alignment and domain information
>gnl|CDD|178336 PLN02735, PLN02735, carbamoyl-phosphate synthase Back     alignment and domain information
>gnl|CDD|162321 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, large subunit Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 536 bifunctional phosphoribosylaminoimidazolecarboxamide fo
PRK00881514 purH bifunctional phosphoribosylaminoimidazolecarboxami 100.0
COG0138515 PurH AICAR transformylase/IMP cyclohydrolase PurH (only 100.0
KOG2555588 consensus 100.0
TIGR00355569 purH bifunctional purine biosynthesis protein PurH; Int 100.0
PRK07106391 5-aminoimidazole-4-carboxamide ribonucleotide transform 100.0
pfam01808315 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme. This is a fa 100.0
smart00798311 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme. This is a fa 100.0
cd01421187 IMPCH Inosine monophosphate cyclohydrolase domain. This 100.0
pfam0214292 MGS MGS-like domain. This domain composes the whole pro 99.52
smart0085190 MGS MGS-like domain. This domain composes the whole pro 99.44
cd00532112 MGS-like MGS-like domain. This domain composes the whol 99.05
cd01424110 MGS_CPS_II Methylglyoxal synthase-like domain from type 98.63
cd01423116 MGS_CPS_I_III Methylglyoxal synthase-like domain found 98.63
pfam06506169 PrpR_N Propionate catabolism activator. This domain is 92.78
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 98.44
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 98.41
TIGR013691089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 97.57
pfam06230212 DUF1009 Protein of unknown function (DUF1009). Family o 97.25
>PRK00881 purH bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; Provisional Back     alignment and domain information
>COG0138 PurH AICAR transformylase/IMP cyclohydrolase PurH (only IMP cyclohydrolase domain in Aful) [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2555 consensus Back     alignment and domain information
>TIGR00355 purH bifunctional purine biosynthesis protein PurH; InterPro: IPR002695 This is a family of bifunctional enzymes catalysing the last two steps in de novo purine biosynthesis Back     alignment and domain information
>PRK07106 5-aminoimidazole-4-carboxamide ribonucleotide transformylase; Provisional Back     alignment and domain information
>pfam01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme Back     alignment and domain information
>smart00798 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme Back     alignment and domain information
>cd01421 IMPCH Inosine monophosphate cyclohydrolase domain Back     alignment and domain information
>pfam02142 MGS MGS-like domain Back     alignment and domain information
>smart00851 MGS MGS-like domain Back     alignment and domain information
>cd00532 MGS-like MGS-like domain Back     alignment and domain information
>cd01424 MGS_CPS_II Methylglyoxal synthase-like domain from type II glutamine-dependent carbamoyl phosphate synthetase (CSP) Back     alignment and domain information
>cd01423 MGS_CPS_I_III Methylglyoxal synthase-like domain found in pyr1 and URA1-like carbamoyl phosphate synthetases (CPS), including ammonia-dependent CPS Type I, and glutamine-dependent CPS Type III Back     alignment and domain information
>pfam06506 PrpR_N Propionate catabolism activator Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>pfam06230 DUF1009 Protein of unknown function (DUF1009) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target536 bifunctional phosphoribosylaminoimidazolecarboxamide fo
1thz_A593 Crystal Structure Of Avian Aicar Transformylase In 1e-114
1m9n_A613 Crystal Structure Of The Homodimeric Bifunctional T 1e-114
1g8m_A593 Crystal Structure Of Avian Atic, A Bifunctional Tra 1e-111
1zcz_A464 Crystal Structure Of Phosphoribosylaminoimidazoleca 3e-94
1pkx_A592 Crystal Structure Of Human Atic In Complex With Xmp 2e-94
1pkx_A592 Crystal Structure Of Human Atic In Complex With Xmp 3e-21
1a9x_A1073 Carbamoyl Phosphate Synthetase: Caught In The Act O 1e-04
1ce8_A1073 Carbamoyl Phosphate Synthetase From Escherichis Col 1e-04
1jdb_B1073 Carbamoyl Phosphate Synthetase From Escherichia Col 1e-04
gi|55669929|pdb|1THZ|A Chain A, Crystal Structure Of Avian Aicar Transformylase In Complex With A Novel Inhibitor Identified By Virtual Ligand Screening Length = 593 Back     alignment and structure
 Score =  416 bits (1069), Expect = e-114,   Method: Composition-based stats.
 Identities = 181/600 (30%), Positives = 277/600 (46%), Gaps = 96/600 (16%)

Query: 19  ALISVHNKTGVVEFASRLLSRGIKIISTGGTCQLLEEEGIPVTSVFDITKFPEIMGGRVK 78
           AL+SV  K G+VEFA  L + G+ +I++GGT   L + G+PV  V D+T FPE++GGRVK
Sbjct: 8   ALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVK 67

Query: 79  TLHPKIYGGILSIRDNPAHMKFMQDHELESIDLVVVNLYPFEESFCREDDY-YTMVENID 137
           TLHP ++ GIL+ R+ P     M   +   + +VV NLYPF ++           VE ID
Sbjct: 68  TLHPAVHAGILA-RNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKID 126

Query: 138 IGGPSMIRAAAKNHDYVTILTNPQDYPLFLAEMD-VNNGKIPYNFRKKMARQAFSRTASY 196
           IGG +++RAAAKNH  VT++ +P DY     EM    +       R+ +A +AF+ TA Y
Sbjct: 127 IGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQY 186

Query: 197 DTAICRWLANAESENFPDYLNITAVKKQEMRYGENPHQKAALYSTPEKKSGIAHAVLVQG 256
           D AI  +     S+          V +  +RYG NPHQ  A   T   K  +     V  
Sbjct: 187 DAAISDYFRKEYSK---------GVSQLPLRYGMNPHQSPAQLYTTRPKLPLT----VVN 233

Query: 257 KPLSYNNINDLDAAFELVSEFRSQDC-AACVIVKHMNPCGVATADTLVE----------- 304
               + N+ D   A++LV E +      A    KH++P G A    L E           
Sbjct: 234 GSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDL 293

Query: 305 ---------AYRRALSCDPISAFGGIIAFNREVDQEVAKEVIKVFTEAIIAPTLSEEAAD 355
                    AY R+   D +S+FG  IA +   D   AK + +  ++ ++AP   EEA  
Sbjct: 294 HKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALK 353

Query: 356 VLAKKPSMRFLKTSSLLDFHGEEIVLKTVSGGILVQTRDNVVDNK--ELTVVTKRSPTDQ 413
           +L+KK +  +       ++  ++  ++T+ G  L+Q R+N V ++     +VTK     +
Sbjct: 354 ILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPE 413

Query: 414 -ELRDMKFAFKVVKHVKSNAVVYAKDGRTVGIGSGQTSRVDSTRFAAI------------ 460
             +RD+  A   VK+ +SN+V YAKDG+ +GIG+GQ SR+  TR A              
Sbjct: 414 SAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPR 473

Query: 461 ------KAH--------------------------------------NISAQADVKSMTN 476
                 KA                                         + +    +   
Sbjct: 474 VLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLT 533

Query: 477 GSVIASEAFYPFPDGIVEAIKAGVTAVIQPGGSVRDSEAITVADQHGIAMVFTGIRHFRH 536
              ++S+AF+PF D +  A + GV  ++ P GS  D   I   ++ GI ++ T +R F H
Sbjct: 534 AVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH 593


>gi|28373618|pdb|1M9N|A Chain A, Crystal Structure Of The Homodimeric Bifunctional Transformylase And Cyclohydrolase Enzyme Avian Atic In Complex With Aicar And Xmp At 1.93 Angstroms. Length = 613 Back     alignment and structure
>gi|14278285|pdb|1G8M|A Chain A, Crystal Structure Of Avian Atic, A Bifunctional Transformylase And Cyclohydrolase Enzyme In Purine Biosynthesis At 1.75 Ang. Resolution Length = 593 Back     alignment and structure
>gi|66361465|pdb|1ZCZ|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazolecarboxamide Formyltransferase IMP CYCLOHYDROLASE (TM1249) FROM THERMOTOGA MARITIMA AT 1.88 A Resolution Length = 464 Back     alignment and structure
gi|46015217|pdb|1PKX|A Chain A, Crystal Structure Of Human Atic In Complex With Xmp Length = 592 Back     alignment and structure
gi|46015217|pdb|1PKX|A Chain A, Crystal Structure Of Human Atic In Complex With Xmp Length = 592 Back     alignment and structure
>gi|157838095|pdb|1A9X|A Chain A, Carbamoyl Phosphate Synthetase: Caught In The Act Of Glutamine Hydrolysis Length = 1073 Back     alignment and structure
>gi|5821976|pdb|1CE8|A Chain A, Carbamoyl Phosphate Synthetase From Escherichis Coli With Complexed With The Allosteric Ligand Imp Length = 1073 Back     alignment and structure
gi|3318817|pdb|1JDB|B Chain B, Carbamoyl Phosphate Synthetase From Escherichia Coli Length = 1073 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target536 bifunctional phosphoribosylaminoimidazolecarboxamide fo
1g8m_A593 Aicar transformylase-IMP cyclohydrolase; homodimer, 2 f 1e-132
1zcz_A464 Bifunctional purine biosynthesis protein PURH; TM1249; 1e-114
1a9x_A1073 Carbamoyl phosphate synthetase (large chain); amidotran 3e-05
>1g8m_A Aicar transformylase-IMP cyclohydrolase; homodimer, 2 functional domains, IMPCH domain = alpha/beta/alpha; HET: G; 1.75A {Gallus gallus} SCOP: c.24.1.3 c.97.1.4 PDB: 1thz_A* 2b1g_A* 2b1i_A* 2iu0_A* 2iu3_A* 1m9n_A* 1oz0_A* 1pkx_A* 1p4r_A* 1pl0_A* Length = 593 Back     alignment and structure
 Score =  466 bits (1201), Expect = e-132
 Identities = 169/602 (28%), Positives = 268/602 (44%), Gaps = 96/602 (15%)

Query: 17  KTALISVHNKTGVVEFASRLLSRGIKIISTGGTCQLLEEEGIPVTSVFDITKFPEIMGGR 76
           + AL+SV  K G+VEFA  L + G+ +I++GGT   L + G+PV  V D+T FPE++GGR
Sbjct: 6   QLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGR 65

Query: 77  VKTLHPKIYGGILSIRDNPAHMKFMQDHELESIDLVVVNLYPFEESFCRED-DYYTMVEN 135
           VKTLHP ++ GIL+ R+ P     M   +   + +VV NLYPF ++           VE 
Sbjct: 66  VKTLHPAVHAGILA-RNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEK 124

Query: 136 IDIGGPSMIRAAAKNHDYVTILTNPQDYPLFLAEM-DVNNGKIPYNFRKKMARQAFSRTA 194
           IDIGG +++RAAAKNH  VT++ +P DY     EM    +       R+ +A +AF+ TA
Sbjct: 125 IDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTA 184

Query: 195 SYDTAICRWLANAESENFPDYLNITAVKKQEMRYGENPHQKAALYSTPEKKSGIAHAVLV 254
            YD AI  +     S+            +  +RYG NPHQ  A   T   K  +      
Sbjct: 185 QYDAAISDYFRKEYSKGV---------SQLPLRYGMNPHQSPAQLYTTRPKLPLTVVN-- 233

Query: 255 QGKPLSYNNINDLDAAFELVSEFRSQDC-AACVIVKHMNPCGVA---------------- 297
                 + N+ D   A++LV E +      A    KH++P G A                
Sbjct: 234 --GSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVH 291

Query: 298 ----TADTLVEAYRRALSCDPISAFGGIIAFNREVDQEVAKEVIKVFTEAIIAPTLSEEA 353
               T   L  AY R+   D +S+FG  IA +   D   AK + +  ++ ++AP   EEA
Sbjct: 292 DLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEA 351

Query: 354 ADVLAKKPSMRFLKTSSLLDFHGEEIVLKTVSGGILVQTRDN-VVDNKELTVV--TKRSP 410
             +L+KK +  +       ++  ++  ++T+ G  L+Q R+N V+D      +    ++ 
Sbjct: 352 LKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTL 411

Query: 411 TDQELRDMKFAFKVVKHVKSNAVVYAKDGRTVGIGSGQTSRVDSTRFAAIKAHNISAQAD 470
            +  +RD+  A   VK+ +SN+V YAKDG+ +GIG+GQ SR+  TR A  KA++   +  
Sbjct: 412 PESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHH 471

Query: 471 VKSMT------------NGSVIASEAFYPFPDGIVEAIKAGVTAVIQP------------ 506
            + ++            + ++          D  +   +A    V               
Sbjct: 472 PRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAK 531

Query: 507 -GGSVRDSEA-------ITVADQHG------------------------IAMVFTGIRHF 534
                  S+A       +  A + G                        I ++ T +R F
Sbjct: 532 LTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLF 591

Query: 535 RH 536
            H
Sbjct: 592 HH 593


>1zcz_A Bifunctional purine biosynthesis protein PURH; TM1249; HET: PG4; 1.88A {Thermotoga maritima} SCOP: c.24.1.3 c.97.1.4 Length = 464 Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Length = 1073 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target536 bifunctional phosphoribosylaminoimidazolecarboxamide fo
1g8m_A593 Aicar transformylase-IMP cyclohydrolase; homodimer, 2 f 100.0
1zcz_A464 Bifunctional purine biosynthesis protein PURH; TM1249; 100.0
2yvq_A143 Carbamoyl-phosphate synthase; conserved hypothetical pr 99.07
1vmd_A178 MGS, methylglyoxal synthase; TM1185, structural genomic 98.06
1wo8_A126 Methylglyoxal synthase; structural genomics, riken stru 98.06
1b93_A152 Protein (methylglyoxal synthase); glycolytic bypass, ly 97.72
2pju_A225 Propionate catabolism operon regulatory protein; struct 94.68
2q5c_A196 NTRC family transcriptional regulator; structural genom 91.78
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amidotran 98.72
2hvw_A184 Deoxycytidylate deaminase; 3-layer (alpha-beta)-sandwic 94.61
>1g8m_A Aicar transformylase-IMP cyclohydrolase; homodimer, 2 functional domains, IMPCH domain = alpha/beta/alpha; HET: G; 1.75A {Gallus gallus} SCOP: c.24.1.3 c.97.1.4 PDB: 1thz_A* 2b1g_A* 2b1i_A* 2iu0_A* 2iu3_A* 1m9n_A* 1oz0_A* 1pkx_A* 1p4r_A* 1pl0_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=1607.82  Aligned_cols=509  Identities=35%  Similarity=0.573  Sum_probs=470.2

Q ss_pred             CCEEEEEEEEECCCCHHHHHHHHHHCCCEEEEEHHHHHHHHHCCCCEEEHHHHCCCCHHCCCCCCCCCCHHHHHHHHCCC
Q ss_conf             61369899875456869999999987999999427689999889951794653488165198553237155535533088
Q gi|254780664|r   14 IAVKTALISVHNKTGVVEFASRLLSRGIKIISTGGTCQLLEEEGIPVTSVFDITKFPEIMGGRVKTLHPKIYGGILSIRD   93 (536)
Q Consensus        14 ~~ikrALiSV~dKtgl~~la~~L~~~g~~iisTgGTa~~l~~~gi~v~~Vs~~TgfpEil~GRVKTLHP~I~ggIL~~r~   93 (536)
                      .++|+|||||||||||++||+.|+++||||||||||+++|+++||||++|||+||||||||||||||||+||||||+| +
T Consensus         3 ~~~k~ALiSVsDKtgl~~la~~L~~~g~eiiSTGGTa~~L~~~gi~v~~Vs~~TgfpEil~GRVKTLHP~IhgGILar-~   81 (593)
T 1g8m_A            3 ARQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILAR-N   81 (593)
T ss_dssp             -CCCEEEEEESCCTTHHHHHHHHHHTTCEEEECHHHHHHHHHTTCCCEEHHHHHSCCCBGGGTBSSCSHHHHHHHHCC-S
T ss_pred             CCCCEEEEEEECCCCHHHHHHHHHHCCCEEEECCHHHHHHHHCCCCEEEHHHCCCCHHHHCCCCCCCCCHHHHHHHCC-C
T ss_conf             656569999745469899999999889889977079999998799668877504981650980555883540777059-9


Q ss_pred             CHHHHHHHHHCCCCCEEEEEEECCCHHHHHCCCC-CHHHHHHCCCCCCHHHHHHHHCCCCCCEEEECHHHHHHHHHHHHC
Q ss_conf             9899999997799841499994888899731765-311232002334346999874015631353089998988987530
Q gi|254780664|r   94 NPAHMKFMQDHELESIDLVVVNLYPFEESFCRED-DYYTMVENIDIGGPSMIRAAAKNHDYVTILTNPQDYPLFLAEMDV  172 (536)
Q Consensus        94 ~~~~~~~l~~~~i~~IDlVvvNLYPF~~~v~~~~-~~~~~IEnIDIGGpsmiRAAAKN~~~V~Vi~dp~dY~~~~~el~~  172 (536)
                      +++|++++++|||++|||||||||||++|+++++ +++++|||||||||||||||||||++|+|||||+||+.++++|+.
T Consensus        82 ~~~~~~~l~~~~I~~IDlVvVNLYPF~~tv~~~~~~~~~~IEnIDIGGptmiRAAAKN~~~V~Vi~dp~dY~~vi~~l~~  161 (593)
T 1g8m_A           82 IPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAA  161 (593)
T ss_dssp             SHHHHHHHHHTTCCCEEEEEEECCCHHHHHTSTTCCHHHHHTTCCSHHHHHHHHHHHTTTTCEEECCGGGHHHHHHHHHT
T ss_pred             CHHHHHHHHHCCCCCCCEEEEECCCHHHHHHCCCCCHHHHHHHCCCCCHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHH
T ss_conf             87889999985999825799818885999736899989997751567888889987368875698133278999999987


Q ss_pred             C-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCH
Q ss_conf             2-345666788999999999874228999987533101211344321012333343678810065057604776682101
Q gi|254780664|r  173 N-NGKIPYNFRKKMARQAFSRTASYDTAICRWLANAESENFPDYLNITAVKKQEMRYGENPHQKAALYSTPEKKSGIAHA  251 (536)
Q Consensus       173 ~-~g~~~~~~R~~lA~kAF~~ta~YD~~Ia~~l~~~~~~~~p~~~~~~~~~~~~LRYGENPHQ~Aa~Y~~~~~~~~~~~~  251 (536)
                      + +|++++++|++||.|||+|||+||++|++||.+....         ..+.++|||||||||+|++|.......+   +
T Consensus       162 ~~~g~~s~~~R~~lA~kAF~~Ta~YD~~Ia~~~~~~~~~---------~~~~~~LRYGENPHQ~Aa~y~~~~~~~~---~  229 (593)
T 1g8m_A          162 SKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSK---------GVSQLPLRYGMNPHQSPAQLYTTRPKLP---L  229 (593)
T ss_dssp             STTSSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCB---------TTTEEEESCSSSTTSCCEEEECSSSSCS---E
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC---------CCCCCCCCCCCCHHHHHHHHCCCCCCHH---H
T ss_conf             268998899999999999999877389998510131036---------6655666378884455365215686427---8


Q ss_pred             HHCCCCCCCCCCCCCCCHHHHHHHHCCC-CCCCEEEEECCCCCCCCCCCC--------------------HHHHHHHHHH
Q ss_conf             2105898883122212001167764245-567279996156865654520--------------------1689999998
Q gi|254780664|r  252 VLVQGKPLSYNNINDLDAAFELVSEFRS-QDCAACVIVKHMNPCGVATAD--------------------TLVEAYRRAL  310 (536)
Q Consensus       252 ~ql~GKeLSYNNllD~daA~~lv~ef~~-~~~Pa~vIvKH~NPCGvA~~~--------------------~~~~Ay~~A~  310 (536)
                      ++++||+ |||||+|+|+||+||+||.+ ...||||||||+||||||+|.                    ++..||++|+
T Consensus       230 ~~~~g~~-SYNN~lD~daA~~lv~ef~~~~~~Pa~vIvKH~NPCGvAig~~l~E~~~~~~~~~~~~~~~~~l~~Ay~~A~  308 (593)
T 1g8m_A          230 TVVNGSP-GFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSR  308 (593)
T ss_dssp             EEEESCC-CHHHHHHHHHHHHHHHHHHHHHCSCEEEEEETTEEEEEEECCCCCHHHHHHTTCTTTGGGCCHHHHHHHHHH
T ss_pred             HHHHCCC-CCCCHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHCCCCCHHHHHHHHHCCCCCCCCCCHHHHHHHHH
T ss_conf             8863256-632356679999999976760599716773578872032064310333201101121124561999999987


Q ss_pred             HHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHEECCCCHHHHHHHHCCCCCEEEECCCCCCCCCCCCEECCCCHHHHH
Q ss_conf             53321320045554275421457878865431111268798999885124553156316766777666402032102231
Q gi|254780664|r  311 SCDPISAFGGIIAFNREVDQEVAKEVIKVFTEAIIAPTLSEEAADVLAKKPSMRFLKTSSLLDFHGEEIVLKTVSGGILV  390 (536)
Q Consensus       311 ~~DP~SAFGGIIa~N~~vd~~~A~~I~~~F~EvIiAP~f~~eAleiL~~KKnlRil~~~~~~~~~~~~~~~rsi~GG~Lv  390 (536)
                      +|||+||||||||||++||.++|+.|.+.|+||||||+|++|||+||++|||+|++++.....+.+..+++|++.||+|+
T Consensus       309 ~~DP~SAFGGIIA~N~~vd~~~A~~i~~~F~EvIIAP~f~~eALeiL~~KKNlR~l~~~~~~~~~~~~~~irsv~GG~Lv  388 (593)
T 1g8m_A          309 GADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLM  388 (593)
T ss_dssp             HSCTTTTTTEEEEESSCBCHHHHHHHHTSCEEEEEESCBCHHHHHHHHHGGGGTCEEEEECTTCCCCSEEEEEETTEEEE
T ss_pred             CCCCCHHCCCEEEEECCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHCCCCCHHHHCCCCCCCCCCCCEEEEEEEEEE
T ss_conf             05960001778998231037888875210110002678898999987514553213330475567776736898651567


Q ss_pred             CCCCCC-CCCCCCC--CCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCEEEEECCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             012334-5310001--2467778688988899999986005667799996893899729688889999999999876420
Q gi|254780664|r  391 QTRDNV-VDNKELT--VVTKRSPTDQELRDMKFAFKVVKHVKSNAVVYAKDGRTVGIGSGQTSRVDSTRFAAIKAHNISA  467 (536)
Q Consensus       391 Q~~D~~-~~~~~~~--vVT~~~pt~~e~~dL~FA~kv~K~vkSNAIv~ak~~~tiGiGaGQ~sRVda~~iA~~KA~~~~~  467 (536)
                      |++|.. ++..+|+  ++|+++|+++|++||+|||+|||||||||||++||++|||||+||||||||++||++||++++.
T Consensus       389 Q~~d~~~~~~~~~~~vv~~~~~p~~~e~~DL~FAw~vvK~vKSNAIv~ak~~~tvGIGaGQ~sRVdsv~iA~~KA~~~~~  468 (593)
T 1g8m_A          389 QKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWL  468 (593)
T ss_dssp             EECCCCCCSGGGGCCBCSSSCCCCHHHHHHHHHHHHHHHTSCSSCEEEEETTEEEEEECSCSCHHHHHHHHHHHHHHHHH
T ss_pred             EECCCCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCEEEEECCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             51455447978864222146898477899999999972547775799986997897678876657899999999755665


Q ss_pred             CCCC--------------------------------------------------------CCCCCCEEEEECCCCCCCCH
Q ss_conf             0122--------------------------------------------------------22348709997366868555
Q gi|254780664|r  468 QADV--------------------------------------------------------KSMTNGSVIASEAFYPFPDG  491 (536)
Q Consensus       468 ~~~~--------------------------------------------------------~~~~~g~vlaSDAFFPF~D~  491 (536)
                      +.++                                                        ..+++|+||||||||||+||
T Consensus       469 ~~~~~~l~~~~~~~~~r~~~~nai~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~g~vlASDAFFPF~D~  548 (593)
T 1g8m_A          469 RHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDN  548 (593)
T ss_dssp             TTCHHHHTCEECTTCCHHHHHHHHHHHHHTCSCSTHHHHHHHTTEEECCCCCCHHHHHHHHTTCCCEEEEESSCCSSTHH
T ss_pred             HCCCHHHCCCHHCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCCCEEEEECCCCCCHH
T ss_conf             30602320110012003444334565411443310244555543013543100788876650358838982158787658


Q ss_pred             HHHHHHCCCCEEEECCCCCCHHHHHHHHHHCCCEEEECCCCCCCC
Q ss_conf             899997199599938987798899999987597799747854479
Q gi|254780664|r  492 IVEAIKAGVTAVIQPGGSVRDSEAITVADQHGIAMVFTGIRHFRH  536 (536)
Q Consensus       492 ie~aa~~Gi~aIiqPGGSirD~evI~aan~~gi~m~fTg~RhF~H  536 (536)
                      ||.|+++||++||||||||||+|||++|||+||+|+|||.|||||
T Consensus       549 ie~a~~~GV~aIiQPGGSirD~evI~aan~~giaMvfTg~RhF~H  593 (593)
T 1g8m_A          549 VDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH  593 (593)
T ss_dssp             HHHHHTTTEEEEEEECCCTTHHHHHHHHHHHTCEEEEESCCCCCC
T ss_pred             HHHHHHCCCEEEECCCCCCCCHHHHHHHHHHCCEEEECCCCCCCC
T ss_conf             999998399199879864360999999997398899868766388



>1zcz_A Bifunctional purine biosynthesis protein PURH; TM1249; HET: PG4; 1.88A {Thermotoga maritima} SCOP: c.24.1.3 c.97.1.4 Back     alignment and structure
>2yvq_A Carbamoyl-phosphate synthase; conserved hypothetical protein, structural genomics, NPPSFA; 1.98A {Homo sapiens} Back     alignment and structure
>1vmd_A MGS, methylglyoxal synthase; TM1185, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 2.06A {Thermotoga maritima} SCOP: c.24.1.2 Back     alignment and structure
>1wo8_A Methylglyoxal synthase; structural genomics, riken structural genomics/proteomics initiative, RSGI, lyase; 1.70A {Thermus thermophilus HB8} SCOP: c.24.1.2 Back     alignment and structure
>1b93_A Protein (methylglyoxal synthase); glycolytic bypass, lyase; 1.90A {Escherichia coli} SCOP: c.24.1.2 PDB: 1egh_A 1ik4_A* 1s8a_A 1s89_A Back     alignment and structure
>2pju_A Propionate catabolism operon regulatory protein; structural genomics, PRPR, transcriptional regulation, PSI- 2, protein structure initiative; 2.10A {Escherichia coli} SCOP: c.92.3.1 Back     alignment and structure
>2q5c_A NTRC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>2hvw_A Deoxycytidylate deaminase; 3-layer (alpha-beta)-sandwich, protein-liand complex, hydrolase; HET: DCP DDN; 1.67A {Streptococcus mutans} PDB: 2hvv_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 536 bifunctional phosphoribosylaminoimidazolecarboxamide fo
d1zcza2295 c.97.1.4 (A:158-452) AICAR transformylase domain of bif 5e-71
d1g8ma2393 c.97.1.4 (A:201-593) AICAR transformylase domain of bif 4e-62
d1g8ma1197 c.24.1.3 (A:4-200) IMP cyclohydrolase domain of bifunct 2e-43
d1zcza1157 c.24.1.3 (A:1-157) IMP cyclohydrolase domain of bifunct 7e-32
d1a9xa2138 c.24.1.1 (A:936-1073) Carbamoyl phosphate synthetase, l 0.001
>d1zcza2 c.97.1.4 (A:158-452) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Thermotoga maritima [TaxId: 2336]} Length = 295 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Cytidine deaminase-like
superfamily: Cytidine deaminase-like
family: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC
domain: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC
species: Thermotoga maritima [TaxId: 2336]
 Score =  262 bits (670), Expect = 5e-71
 Identities = 116/322 (36%), Positives = 173/322 (53%), Gaps = 28/322 (8%)

Query: 216 LNITAVKKQ-EMRYGENPHQKAALYSTPEKKSGIAHAVLVQGKPLSYNNINDLDAAFELV 274
           +++   ++  ++RYGENPH+KA +Y  P      A  +L +GK +S+NNI D + A+ + 
Sbjct: 1   ISLAFKREDLQLRYGENPHEKAFVYGKP------AFEILHEGKTISFNNILDAENAWFMA 54

Query: 275 SEFRSQDCAACVIVKHMNPCGVATADTLVEAYRRALSCDPISAFGGIIAFNREVDQEVAK 334
                      V+VKH +PCG A  +  VE  ++A+  D  S+FGGI+A N E+D+EVAK
Sbjct: 55  KNL---PRMGAVVVKHQSPCGAAIGEDKVEIVKKAIEADDESSFGGILAVNFEMDEEVAK 111

Query: 335 EVIKVFTEAIIAPTLSEEAADVLAKKPSMRFLKTSSLLDFHGEEIVLKTVSGGILVQTRD 394
             +K + E I+AP+ ++EA +VL+KK               G+            +   +
Sbjct: 112 S-LKKYLEVIVAPSFTQEAIEVLSKKKVRLL--------KPGDYASWAGKMAFGSLVLSE 162

Query: 395 NVVDNKELTVVTKRSPTDQELRDMKFAFKVVKHVKSNAVVYAKDGRTVGIGSGQTSRVDS 454
                    +V     +++EL D++FA++VV+  KSNAV+ AKDG TVGIGSGQ SR  +
Sbjct: 163 RKYPEGNFELVVGEPLSEKELEDLEFAYRVVEGAKSNAVLIAKDGVTVGIGSGQPSRKRA 222

Query: 455 TRFAAIKAHNISAQADVKSMTNGSVIASEAFYPFPDGIVEAIKAGVTAVIQPGGSVRDSE 514
              A + A              G+V AS+AF+PFPD +    +AGV AV+ P GS+RD E
Sbjct: 223 AWIATVMA---------GEKAKGAVAASDAFFPFPDSLEILAQAGVKAVVAPLGSIRDEE 273

Query: 515 AITVADQHGIAMVFTGIRHFRH 536
            I  A + GI       R FRH
Sbjct: 274 VIEKARELGITFYKAPSRVFRH 295


>d1g8ma2 c.97.1.4 (A:201-593) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]} Length = 393 Back     information, alignment and structure
>d1g8ma1 c.24.1.3 (A:4-200) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]} Length = 197 Back     information, alignment and structure
>d1zcza1 c.24.1.3 (A:1-157) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Thermotoga maritima [TaxId: 2336]} Length = 157 Back     information, alignment and structure
>d1a9xa2 c.24.1.1 (A:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target536 bifunctional phosphoribosylaminoimidazolecarboxamide fo
d1g8ma2393 AICAR transformylase domain of bifunctional purine bios 100.0
d1zcza2295 AICAR transformylase domain of bifunctional purine bios 100.0
d1g8ma1197 IMP cyclohydrolase domain of bifunctional purine biosyn 100.0
d1zcza1157 IMP cyclohydrolase domain of bifunctional purine biosyn 100.0
d1a9xa2138 Carbamoyl phosphate synthetase, large subunit allosteri 98.83
d1b93a_148 Methylglyoxal synthase, MgsA {Escherichia coli [TaxId: 98.14
d1vmda_156 Methylglyoxal synthase, MgsA {Thermotoga maritima [TaxI 97.66
d1wo8a1126 Methylglyoxal synthase, MgsA {Thermus thermophilus [Tax 97.51
d2pjua1186 Propionate catabolism operon regulatory protein PrpR {E 93.09
>d1g8ma2 c.97.1.4 (A:201-593) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Cytidine deaminase-like
superfamily: Cytidine deaminase-like
family: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC
domain: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC
species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=100.00  E-value=0  Score=930.16  Aligned_cols=311  Identities=32%  Similarity=0.516  Sum_probs=279.3

Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCCCCCHHHCCCCCCCCCCCCCCCHHHHHHHHCCC-CCCCEEEEECCCCCCCCCCCC
Q ss_conf             3333436788100650576047766821012105898883122212001167764245-567279996156865654520
Q gi|254780664|r  222 KKQEMRYGENPHQKAALYSTPEKKSGIAHAVLVQGKPLSYNNINDLDAAFELVSEFRS-QDCAACVIVKHMNPCGVATAD  300 (536)
Q Consensus       222 ~~~~LRYGENPHQ~Aa~Y~~~~~~~~~~~~~ql~GKeLSYNNllD~daA~~lv~ef~~-~~~Pa~vIvKH~NPCGvA~~~  300 (536)
                      ..++|||||||||+||+|......   ..++|+|||+ |||||+|+|+||+||+||.+ .+.||||||||+||||||++.
T Consensus         3 ~~~~LRYGENPHQ~aA~~~~~~~~---~~~~~l~gk~-SyNN~lD~daA~~lv~ef~~~~~~Pa~vIiKH~NPCGvAi~~   78 (393)
T d1g8ma2           3 SQLPLRYGMNPHQSPAQLYTTRPK---LPLTVVNGSP-GFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGI   78 (393)
T ss_dssp             TEEEESCSSSTTSCCEEEECSSSS---CSEEEEESCC-CHHHHHHHHHHHHHHHHHHHHHCSCEEEEEETTEEEEEEECC
T ss_pred             CCCCCCCCCCCCCCCCEEECCCCC---CHHHHHCCCC-CHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHCCC
T ss_conf             879887976805411386216874---3168866870-276798899999999974650599769997688833665085


Q ss_pred             --------------------HHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHEECCCCHHHHHHHHCC
Q ss_conf             --------------------168999999853321320045554275421457878865431111268798999885124
Q gi|254780664|r  301 --------------------TLVEAYRRALSCDPISAFGGIIAFNREVDQEVAKEVIKVFTEAIIAPTLSEEAADVLAKK  360 (536)
Q Consensus       301 --------------------~~~~Ay~~A~~~DP~SAFGGIIa~N~~vd~~~A~~I~~~F~EvIiAP~f~~eAleiL~~K  360 (536)
                                          ++.+||++|++|||+||||||||||++||.++|+.|.+.|+||||||+|++|||+||++|
T Consensus        79 ~~~e~~~~~~~~~~~~~~~~~l~~Ay~~A~~~DP~SAFGGIIa~N~~vd~~~A~~i~~~F~EvIIAP~f~~eAleiL~~K  158 (393)
T d1g8ma2          79 PLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKK  158 (393)
T ss_dssp             CCCHHHHHHTTCTTTGGGCCHHHHHHHHHHHSCTTTTTTEEEEESSCBCHHHHHHHHTSCEEEEEESCBCHHHHHHHHHG
T ss_pred             CCHHHHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCHHCCEEEEECCCCCCCHHHHHHHCCCCHHCCCCCCHHHHHHHHHC
T ss_conf             51023320000122113466299999998714851000507886155332102432220201001134556778887425


Q ss_pred             CCCEEEECCCCCCCCCCCCEECCCCHHHHHCCCCCC-CCCCCCC-CC-CCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEE
Q ss_conf             553156316766777666402032102231012334-5310001-24-67778688988899999986005667799996
Q gi|254780664|r  361 PSMRFLKTSSLLDFHGEEIVLKTVSGGILVQTRDNV-VDNKELT-VV-TKRSPTDQELRDMKFAFKVVKHVKSNAVVYAK  437 (536)
Q Consensus       361 KnlRil~~~~~~~~~~~~~~~rsi~GG~LvQ~~D~~-~~~~~~~-vV-T~~~pt~~e~~dL~FA~kv~K~vkSNAIv~ak  437 (536)
                      ||+|+|.+....++.....++|++.||+|+|++|.. +...+|+ +| ++++|+++|++||+|||+|||||||||||++|
T Consensus       159 KNlRll~~~~~~~~~~~~~~~r~i~gg~L~Q~~d~~~~~~~~~~~v~~~~~~pt~~e~~dL~FAwkVvK~vKSNAIvlak  238 (393)
T d1g8ma2         159 KNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAK  238 (393)
T ss_dssp             GGGTCEEEEECTTCCCCSEEEEEETTEEEEEECCCCCCSGGGGCCBCSSSCCCCHHHHHHHHHHHHHHHTSCSSCEEEEE
T ss_pred             CCCCHHHHCCCCCCCCCCCCEEEEECCEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             45213430246445776663677505311101233324555513432023451688999999999998623664589962


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCC----------------------------------------------
Q ss_conf             8938997296888899999999998764200122----------------------------------------------
Q gi|254780664|r  438 DGRTVGIGSGQTSRVDSTRFAAIKAHNISAQADV----------------------------------------------  471 (536)
Q Consensus       438 ~~~tiGiGaGQ~sRVda~~iA~~KA~~~~~~~~~----------------------------------------------  471 (536)
                      |++|||||+||||||||++||++||++|+.+..+                                              
T Consensus       239 ~~~tvGIGaGQ~SRVdsv~iA~~KA~~~~~r~~p~v~~~~~k~~~~~~e~~na~~~~~~~~~~~~e~~~~~~~~f~~~~~  318 (393)
T d1g8ma2         239 DGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPA  318 (393)
T ss_dssp             TTEEEEEECSCSCHHHHHHHHHHHHHHHHHTTCHHHHTCEECTTCCHHHHHHHHHHHHHTCSCSTHHHHHHHTTEEECCC
T ss_pred             CCEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCC
T ss_conf             98688318997654789999999998877640630110000001345555416776513543320355666554201431


Q ss_pred             ----------CCCCCCEEEEECCCCCCCCHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHCCCEEEECCCCCCCC
Q ss_conf             ----------22348709997366868555899997199599938987798899999987597799747854479
Q gi|254780664|r  472 ----------KSMTNGSVIASEAFYPFPDGIVEAIKAGVTAVIQPGGSVRDSEAITVADQHGIAMVFTGIRHFRH  536 (536)
Q Consensus       472 ----------~~~~~g~vlaSDAFFPF~D~ie~aa~~Gi~aIiqPGGSirD~evI~aan~~gi~m~fTg~RhF~H  536 (536)
                                ...++|+||||||||||+||||.|+++||++||||||||||+|||++|||+||+|+|||.|||||
T Consensus       319 ~l~~~~~~~~~~~~~g~vlASDAFFPF~D~ie~aa~~Gv~aIiQPGGSirD~evI~aan~~~i~M~fTg~RhF~H  393 (393)
T d1g8ma2         319 QLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH  393 (393)
T ss_dssp             CCCHHHHHHHHTTCCCEEEEESSCCSSTHHHHHHHTTTEEEEEEECCCTTHHHHHHHHHHHTCEEEEESCCCCCC
T ss_pred             HHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHCCEEEECCCCCCCC
T ss_conf             123788764430357857980268687568999998599399879874251999999998598899878867288



>d1zcza2 c.97.1.4 (A:158-452) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g8ma1 c.24.1.3 (A:4-200) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1zcza1 c.24.1.3 (A:1-157) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a9xa2 c.24.1.1 (A:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b93a_ c.24.1.2 (A:) Methylglyoxal synthase, MgsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmda_ c.24.1.2 (A:) Methylglyoxal synthase, MgsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wo8a1 c.24.1.2 (A:1-126) Methylglyoxal synthase, MgsA {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 536 bifunctional phosphoribosylaminoimidazolecarboxami
1zcz_A_336-464129 (A:336-464) Bifunctional purine biosynthesis prote 2e-47
1zcz_A_183-315133 (A:183-315) Bifunctional purine biosynthesis prote 1e-45
1g8m_A_226-372147 (A:226-372) Aicar transformylase-IMP cyclohydrolas 2e-38
1g8m_A_1-200200 (A:1-200) Aicar transformylase-IMP cyclohydrolase; 4e-42
1zcz_A_1-182182 (A:1-182) Bifunctional purine biosynthesis protein 6e-35
1g8m_A_398-593196 (A:398-593) Aicar transformylase-IMP cyclohydrolas 3e-35
2yvq_A_143 (A:) Carbamoyl-phosphate synthase; conserved hypot 1e-17
1a9x_A_939-1058120 (A:939-1058) Carbamoyl phosphate synthetase (large 7e-17
1wo8_A_126 (A:) Methylglyoxal synthase; structural genomics, 1e-11
1vmd_A_28-147120 (A:28-147) MGS, methylglyoxal synthase; TM1185, st 0.001
>1zcz_A (A:336-464) Bifunctional purine biosynthesis protein PURH; TM1249; HET: PG4; 1.88A {Thermotoga maritima}Length = 129 Back     alignment and structure
 Score =  184 bits (469), Expect = 2e-47
 Identities = 58/137 (42%), Positives = 78/137 (56%), Gaps = 9/137 (6%)

Query: 400 KELTVVTKRSPTDQELRDMKFAFKVVKHVKSNAVVYAKDGRTVGIGSGQTSRVDSTRFAA 459
               +V     +++EL D++FA++VV+  KSNAV+ AKDG TVGIGSGQ SR  +   A 
Sbjct: 2   GNFELVVGEPLSEKELEDLEFAYRVVEGAKSNAVLIAKDGVTVGIGSGQPSRKRAAWIAT 61

Query: 460 IKAHNISAQADVKSMTNGSVIASEAFYPFPDGIVEAIKAGVTAVIQPGGSVRDSEAITVA 519
           + A              G+V AS+AF+PFPD +    +AGV AV+ P GS+RD E I  A
Sbjct: 62  VMA---------GEKAKGAVAASDAFFPFPDSLEILAQAGVKAVVAPLGSIRDEEVIEKA 112

Query: 520 DQHGIAMVFTGIRHFRH 536
            + GI       R FRH
Sbjct: 113 RELGITFYKAPSRVFRH 129


>1zcz_A (A:183-315) Bifunctional purine biosynthesis protein PURH; TM1249; HET: PG4; 1.88A {Thermotoga maritima}Length = 133 Back     alignment and structure
>1g8m_A (A:226-372) Aicar transformylase-IMP cyclohydrolase; homodimer, 2 functional domains, IMPCH domain = alpha/beta/alpha; HET: G; 1.75A {Gallus gallus}Length = 147 Back     alignment and structure
>1g8m_A (A:1-200) Aicar transformylase-IMP cyclohydrolase; homodimer, 2 functional domains, IMPCH domain = alpha/beta/alpha; HET: G; 1.75A {Gallus gallus}Length = 200 Back     alignment and structure
>1zcz_A (A:1-182) Bifunctional purine biosynthesis protein PURH; TM1249; HET: PG4; 1.88A {Thermotoga maritima}Length = 182 Back     alignment and structure
>1g8m_A (A:398-593) Aicar transformylase-IMP cyclohydrolase; homodimer, 2 functional domains, IMPCH domain = alpha/beta/alpha; HET: G; 1.75A {Gallus gallus}Length = 196 Back     alignment and structure
>2yvq_A (A:) Carbamoyl-phosphate synthase; conserved hypothetical protein, structural genomics, NPPSFA; 1.98A {Homo sapiens}Length = 143 Back     alignment and structure
>1a9x_A (A:939-1058) Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli}Length = 120 Back     alignment and structure
>1wo8_A (A:) Methylglyoxal synthase; structural genomics, riken structural genomics/proteomics initiative, RSGI, lyase; 1.70A {Thermus thermophilus HB8}Length = 126 Back     alignment and structure
>1vmd_A (A:28-147) MGS, methylglyoxal synthase; TM1185, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 2.06A {Thermotoga maritima}Length = 120 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target536 bifunctional phosphoribosylaminoimidazolecarboxamide fo
1g8m_A_1-200200 Aicar transformylase-IMP cyclohydrolase; homodimer 100.0
1zcz_A_1-182182 Bifunctional purine biosynthesis protein PURH; TM1 99.96
1zcz_A_336-464129 Bifunctional purine biosynthesis protein PURH; TM1 100.0
1g8m_A_398-593196 Aicar transformylase-IMP cyclohydrolase; homodimer 99.5
1g8m_A_398-593196 Aicar transformylase-IMP cyclohydrolase; homodimer 100.0
1zcz_A_183-315133 Bifunctional purine biosynthesis protein PURH; TM1 100.0
1g8m_A_226-372147 Aicar transformylase-IMP cyclohydrolase; homodimer 100.0
1a9x_A_939-1058120 Carbamoyl phosphate synthetase (large chain); amid 99.42
2yvq_A_143 Carbamoyl-phosphate synthase; conserved hypothetic 99.17
1wo8_A_126 Methylglyoxal synthase; structural genomics, riken 98.73
1b93_A_12-131120 Protein (methylglyoxal synthase); glycolytic bypas 98.45
1vmd_A_28-147120 MGS, methylglyoxal synthase; TM1185, structural ge 98.29
1itu_A_369 Renal dipeptidase; glycoprotein, membrane-bound, z 93.07
>1g8m_A (A:1-200) Aicar transformylase-IMP cyclohydrolase; homodimer, 2 functional domains, IMPCH domain = alpha/beta/alpha; HET: G; 1.75A {Gallus gallus} Back     alignment and structure
Probab=100.00  E-value=0  Score=418.83  Aligned_cols=196  Identities=39%  Similarity=0.642  Sum_probs=186.2

Q ss_pred             CCCEEEEEEEEECCCCHHHHHHHHHHCCCEEEEEHHHHHHHHHCCCCEEEHHHHCCCCHHCCCCCCCCCCHHHHHHHHCC
Q ss_conf             76136989987545686999999998799999942768999988995179465348816519855323715553553308
Q gi|254780664|r   13 EIAVKTALISVHNKTGVVEFASRLLSRGIKIISTGGTCQLLEEEGIPVTSVFDITKFPEIMGGRVKTLHPKIYGGILSIR   92 (536)
Q Consensus        13 ~~~ikrALiSV~dKtgl~~la~~L~~~g~~iisTgGTa~~l~~~gi~v~~Vs~~TgfpEil~GRVKTLHP~I~ggIL~~r   92 (536)
                      ..|.+++||||+||++++++|+.|+++||+|+||+||+++|+++||+|+.|+++|+|||+++||||||||.+||||++++
T Consensus         2 kp~~~~vLiSV~DK~~l~~~ak~L~~~G~~I~AT~GTa~~L~e~GI~v~~V~~~t~~~e~~~gr~~tl~~~~~g~I~~vi   81 (200)
T 1g8m_A            2 AARQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEXLGGRVKTLHPAVHAGILARN   81 (200)
T ss_dssp             --CCCEEEEEESCCTTHHHHHHHHHHTTCEEEECHHHHHHHHHTTCCCEEHHHHHSCCCBGGGTBSSCSHHHHHHHHCCS
T ss_pred             CCCCCEEEEEEECCCCHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCEEEHHHCCCCHHHHCCCCCCCCCHHHHHHHCCC
T ss_conf             85455799998644588999999998898899772799999987996788775049726529825657734417660599


Q ss_pred             CCHHHHHHHHHCCCCCEEEEEEECCCHHHHHCCCC-CHHHHHHCCCCCCHHHHHHHHCCCCCCEEEECHHHHHHHHHHHH
Q ss_conf             89899999997799841499994888899731765-31123200233434699987401563135308999898898753
Q gi|254780664|r   93 DNPAHMKFMQDHELESIDLVVVNLYPFEESFCRED-DYYTMVENIDIGGPSMIRAAAKNHDYVTILTNPQDYPLFLAEMD  171 (536)
Q Consensus        93 ~~~~~~~~l~~~~i~~IDlVvvNLYPF~~~v~~~~-~~~~~IEnIDIGGpsmiRAAAKN~~~V~Vi~dp~dY~~~~~el~  171 (536)
                      + ..|..++.++|+..+|+||+|+|||..++.... ..++++|+||||||+|+|++||||++|++++||.||..+++|+.
T Consensus        82 N-~~~~~~~~~~g~~irr~av~~~iP~~Tti~~a~a~~~~~~~~~di~~~s~~r~~akn~~~v~~~~dp~dy~~~~~e~~  160 (200)
T 1g8m_A           82 I-PEDNADXNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEXA  160 (200)
T ss_dssp             S-HHHHHHHHHTTCCCEEEEEEECCCHHHHHTSTTCCHHHHHTTCCSHHHHHHHHHHHTTTTCEEECCGGGHHHHHHHHH
T ss_pred             C-HHHHHHHHHCCCCCCCEEEEECCCHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHCCCCEEEEECHHHHHHHHHHHH
T ss_conf             8-778999997699983579981877699972689988999886246768999998754687089925889999998776


Q ss_pred             -CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             -02345666788999999999874228999987533101
Q gi|254780664|r  172 -VNNGKIPYNFRKKMARQAFSRTASYDTAICRWLANAES  209 (536)
Q Consensus       172 -~~~g~~~~~~R~~lA~kAF~~ta~YD~~Ia~~l~~~~~  209 (536)
                       .++|.+++++|++||.|||++||.||++|++||+++..
T Consensus       161 ~~~~~~~~~~~r~~lA~kaf~~t~~yd~~i~~~~~~~~~  199 (200)
T 1g8m_A          161 ASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYS  199 (200)
T ss_dssp             TSTTSSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             HCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             515677899999999999999999989999997554102



>1zcz_A (A:1-182) Bifunctional purine biosynthesis protein PURH; TM1249; HET: PG4; 1.88A {Thermotoga maritima} Back     alignment and structure
>1zcz_A (A:336-464) Bifunctional purine biosynthesis protein PURH; TM1249; HET: PG4; 1.88A {Thermotoga maritima} Back     alignment and structure
>1g8m_A (A:398-593) Aicar transformylase-IMP cyclohydrolase; homodimer, 2 functional domains, IMPCH domain = alpha/beta/alpha; HET: G; 1.75A {Gallus gallus} Back     alignment and structure
>1g8m_A (A:398-593) Aicar transformylase-IMP cyclohydrolase; homodimer, 2 functional domains, IMPCH domain = alpha/beta/alpha; HET: G; 1.75A {Gallus gallus} Back     alignment and structure
>1zcz_A (A:183-315) Bifunctional purine biosynthesis protein PURH; TM1249; HET: PG4; 1.88A {Thermotoga maritima} Back     alignment and structure
>1g8m_A (A:226-372) Aicar transformylase-IMP cyclohydrolase; homodimer, 2 functional domains, IMPCH domain = alpha/beta/alpha; HET: G; 1.75A {Gallus gallus} Back     alignment and structure
>1a9x_A (A:939-1058) Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} Back     alignment and structure
>2yvq_A (A:) Carbamoyl-phosphate synthase; conserved hypothetical protein, structural genomics, NPPSFA; 1.98A {Homo sapiens} Back     alignment and structure
>1wo8_A (A:) Methylglyoxal synthase; structural genomics, riken structural genomics/proteomics initiative, RSGI, lyase; 1.70A {Thermus thermophilus HB8} Back     alignment and structure
>1b93_A (A:12-131) Protein (methylglyoxal synthase); glycolytic bypass, lyase; 1.90A {Escherichia coli} Back     alignment and structure
>1vmd_A (A:28-147) MGS, methylglyoxal synthase; TM1185, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 2.06A {Thermotoga maritima} Back     alignment and structure
>1itu_A (A:) Renal dipeptidase; glycoprotein, membrane-bound, zinc protease beta-lactamase, cilastatin, complex (hydrolase/inhibitor); HET: NAG CIL; 2.00A {Homo sapiens} Back     alignment and structure