254780663

254780663

carbonate dehydratase

GeneID in NCBI database:8209667Locus tag:CLIBASIA_02750
Protein GI in NCBI database:254780663Protein Accession:YP_003065076.1
Gene range:-(604985, 605608)Protein Length:207aa
Gene description:carbonate dehydratase
COG prediction:[P] Carbonic anhydrase
KEGG prediction:carbonate dehydratase; K01673 carbonic anhydrase [EC:4.2.1.1]
SEED prediction:Carbonic anhydrase (EC 4.2.1.1)
Pathway involved in KEGG:Nitrogen metabolism [PATH:las00910]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MTSFPNTLLERHREFIQDQYDKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQHHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVANNPTEKQTILEQLSIRNSLKNIRNFPFVNKLEKEHMLQIHGAWFDISSGKLWILDPTSNEFTCDTR
cHHHHHHHHHHHHHHHHccccHHHHHHHHccccccEEEEEEEcccccHHHHcccccccEEEEEEcccEEcccccccccccHHHHHHHHHHHccccEEEEEEcccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccEEEEEEEEccccEEEEEccccccEEEccc
cccHHHHHHHHHHHHHHccccccHHHHHcccccccEEEEEEccHHHcHHHHcccccccEEEEEEHHHcccccccccccHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccEEEEEEEEEccccEEEEcccccccEEEEcc
MTSFPNTLLERHREFIQDQYDKKLFQELAnqqkpkimiisccdsrvapetifnakpgelfVVRNvanivppyepdgqhhaTSAAIEFAVQGLNVEHIVVMGhgrcggiqavldsnnsstspgdfigkWMDIVRPIAQKIvannptekQTILEQLSIRNSlknirnfpfvnkLEKEHMLQIHGawfdissgklwildptsneftcdtr
mtsfpntllerhREFIQDQYDKKLFQELANQQKPKIMIISCCDSRVAPETifnakpgelfVVRNVANIVPPYEPDGQHHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVANNPTEKQTILEQLSIRNSLKNIRNFPFVNKLEKEHMLQIHGAWFDISSGKLWILdptsneftcdtr
MTSFPNTLLERHREFIQDQYDKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQHHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVANNPTEKQTILEQLSIRNSLKNIRNFPFVNKLEKEHMLQIHGAWFDISSGKLWILDPTSNEFTCDTR
***FPNTLLERHREFIQDQYDKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQHHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVANNPTEKQTILEQLSIRNSLKNIRNFPFVNKLEKEHMLQIHGAWFDISSGKLWILDPTSNEFTCD**
MTSFPNTLLERHREFIQDQYDKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQHHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVANNPTEKQTILEQLSIRNSLKNIRNFPFVNKLEKEHMLQIHGAWFDISSGKLWILDPTSNEFTCDTR
*TSFPNTLLERHREFIQDQYDKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQHHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVANNPTEKQTILEQLSIRNSLKNIRNFPFVNKLEKEHMLQIHGAWFDISSGKLWILDPTSNEFTCD**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSFPNTLLERHREFIQDQYDKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQHHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVANNPTEKQTILEQLSIRNSLKNIRNFPFVNKLEKEHMLQIHGAWFDISSGKLWILDPTSNEFTCDTR
MTSFPNTLLERHREFIQDQYDKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQHHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVANNPTEKQTILEQLSIRNSLKNIRNFPFVNKLEKEHMLQIHGAWFDISSGKLWILDPTSNEFTCDTR
MTSFPNTLLERHREFIQDQYDKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQHHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVANNPTEKQTILEQLSIRNSLKNIRNFPFVNKLEKEHMLQIHGAWFDISSGKLWILDPTSNEFTCDTR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target207 carbonate dehydratase [Candidatus Liberibacter asiaticu
315122153207 carbonate dehydratase [Candidatus Liberibacter solanace 1 3e-91
222150226213 carbonate dehydratase [Agrobacterium vitis S4] Length = 1 6e-69
15889755213 carbonate dehydratase [Agrobacterium tumefaciens str. C 1 1e-66
222087910213 carbonic anhydrase protein [Agrobacterium radiobacter K 1 2e-66
254703593213 Carbonic anhydrase [Brucella suis bv. 3 str. 686] Lengt 1 3e-66
218674206213 Carbonate dehydratase [Rhizobium etli GR56] Length = 21 1 6e-66
86359681213 carbonic anhydrase protein [Rhizobium etli CFN 42] Leng 1 6e-66
325293842213 Carbonic anhydrase [Agrobacterium sp. H13-3] Length = 2 1 7e-66
239832908214 Carbonic anhydrase [Ochrobactrum intermedium LMG 3301] 1 1e-65
15967071227 putative carbonic anhydrase protein [Sinorhizobium meli 1 1e-65
>gi|315122153|ref|YP_004062642.1| carbonate dehydratase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 207 Back     alignment and organism information
 Score =  338 bits (866), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 157/207 (75%), Positives = 178/207 (85%)

Query: 1   MTSFPNTLLERHREFIQDQYDKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELF 60
           M  FP  LL+ HR FI++ YD KLFQ LAN+QKPKIMIISCCDSRV PETIF+A+PG+LF
Sbjct: 1   MNEFPKKLLKSHRHFIKNHYDAKLFQTLANKQKPKIMIISCCDSRVTPETIFDAQPGDLF 60

Query: 61  VVRNVANIVPPYEPDGQHHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTS 120
           VVRNVANIVPPYEPDGQHHATSAAIEFAVQ L VEHIV+MGHGRCGGIQA+LD       
Sbjct: 61  VVRNVANIVPPYEPDGQHHATSAAIEFAVQALGVEHIVIMGHGRCGGIQAILDPITLPLC 120

Query: 121 PGDFIGKWMDIVRPIAQKIVANNPTEKQTILEQLSIRNSLKNIRNFPFVNKLEKEHMLQI 180
           PGDFIGKWMDIVRPIAQKI+ N+P EKQTILEQLSIRNSL NIR FPFV +LE++++L I
Sbjct: 121 PGDFIGKWMDIVRPIAQKIMTNDPVEKQTILEQLSIRNSLHNIRGFPFVRELEEQNLLHI 180

Query: 181 HGAWFDISSGKLWILDPTSNEFTCDTR 207
           HGAWFDI +G+LWIL+P SNEF  +T+
Sbjct: 181 HGAWFDIRTGELWILNPNSNEFILNTQ 207


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222150226|ref|YP_002551183.1| carbonate dehydratase [Agrobacterium vitis S4] Length = 213 Back     alignment and organism information
>gi|15889755|ref|NP_355436.1| carbonate dehydratase [Agrobacterium tumefaciens str. C58] Length = 213 Back     alignment and organism information
>gi|222087910|ref|YP_002546448.1| carbonic anhydrase protein [Agrobacterium radiobacter K84] Length = 213 Back     alignment and organism information
>gi|254703593|ref|ZP_05165421.1| Carbonic anhydrase [Brucella suis bv. 3 str. 686] Length = 213 Back     alignment and organism information
>gi|218674206|ref|ZP_03523875.1| Carbonate dehydratase [Rhizobium etli GR56] Length = 213 Back     alignment and organism information
>gi|86359681|ref|YP_471573.1| carbonic anhydrase protein [Rhizobium etli CFN 42] Length = 213 Back     alignment and organism information
>gi|325293842|ref|YP_004279706.1| Carbonic anhydrase [Agrobacterium sp. H13-3] Length = 213 Back     alignment and organism information
>gi|239832908|ref|ZP_04681237.1| Carbonic anhydrase [Ochrobactrum intermedium LMG 3301] Length = 214 Back     alignment and organism information
>gi|15967071|ref|NP_387424.1| putative carbonic anhydrase protein [Sinorhizobium meliloti 1021] Length = 227 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target207 carbonate dehydratase [Candidatus Liberibacter asiaticu
pfam00484146 pfam00484, Pro_CA, Carbonic anhydrase 9e-50
cd00382119 cd00382, beta_CA, Carbonic anhydrases (CA) are zinc-con 3e-36
PLN00416258 PLN00416, PLN00416, carbonate dehydratase 1e-32
cd00883182 cd00883, beta_CA_cladeA, Carbonic anhydrases (CA) are z 2e-32
PLN03014347 PLN03014, PLN03014, carbonic anhydrase 1e-30
PLN03019330 PLN03019, PLN03019, carbonic anhydrase 3e-30
PLN03006301 PLN03006, PLN03006, carbonate dehydratase 1e-28
KOG1578276 KOG1578, KOG1578, KOG1578, Predicted carbonic anhydrase 2e-26
PLN02154290 PLN02154, PLN02154, carbonic anhydrase 3e-26
cd03378154 cd03378, beta_CA_cladeC, Carbonic anhydrases (CA) are z 4e-22
PRK10437220 PRK10437, PRK10437, carbonic anhydrase; Provisional 3e-18
PRK15219245 PRK15219, PRK15219, carbonic anhydrase; Provisional 1e-12
cd03379142 cd03379, beta_CA_cladeD, Carbonic anhydrases (CA) are z 5e-10
cd00884190 cd00884, beta_CA_cladeB, Carbonic anhydrases (CA) are z 1e-63
COG0288207 COG0288, CynT, Carbonic anhydrase [Inorganic ion transp 9e-44
>gnl|CDD|144177 pfam00484, Pro_CA, Carbonic anhydrase Back     alignment and domain information
>gnl|CDD|73199 cd00382, beta_CA, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>gnl|CDD|177809 PLN00416, PLN00416, carbonate dehydratase Back     alignment and domain information
>gnl|CDD|48222 cd00883, beta_CA_cladeA, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>gnl|CDD|178588 PLN03014, PLN03014, carbonic anhydrase Back     alignment and domain information
>gnl|CDD|166660 PLN03019, PLN03019, carbonic anhydrase Back     alignment and domain information
>gnl|CDD|178583 PLN03006, PLN03006, carbonate dehydratase Back     alignment and domain information
>gnl|CDD|36791 KOG1578, KOG1578, KOG1578, Predicted carbonic anhydrase involved in protection against oxidative damage [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|177815 PLN02154, PLN02154, carbonic anhydrase Back     alignment and domain information
>gnl|CDD|73356 cd03378, beta_CA_cladeC, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>gnl|CDD|182460 PRK10437, PRK10437, carbonic anhydrase; Provisional Back     alignment and domain information
>gnl|CDD|185141 PRK15219, PRK15219, carbonic anhydrase; Provisional Back     alignment and domain information
>gnl|CDD|48225 cd03379, beta_CA_cladeD, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>gnl|CDD|48223 cd00884, beta_CA_cladeB, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>gnl|CDD|30636 COG0288, CynT, Carbonic anhydrase [Inorganic ion transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 207 carbonate dehydratase [Candidatus Liberibacter asiaticu
PRK10437220 carbonic anhydrase; Provisional 100.0
cd00884190 beta_CA_cladeB Carbonic anhydrases (CA) are zinc-contai 100.0
COG0288207 CynT Carbonic anhydrase [Inorganic ion transport and me 100.0
cd00883182 beta_CA_cladeA Carbonic anhydrases (CA) are zinc-contai 100.0
cd03378154 beta_CA_cladeC Carbonic anhydrases (CA) are zinc-contai 100.0
KOG1578276 consensus 100.0
KOG1578276 consensus 98.66
pfam00484146 Pro_CA Carbonic anhydrase. This family includes carboni 100.0
cd00382119 beta_CA Carbonic anhydrases (CA) are zinc-containing en 100.0
cd03379142 beta_CA_cladeD Carbonic anhydrases (CA) are zinc-contai 100.0
pfam10575159 consensus 99.91
>PRK10437 carbonic anhydrase; Provisional Back     alignment and domain information
>cd00884 beta_CA_cladeB Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>COG0288 CynT Carbonic anhydrase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00883 beta_CA_cladeA Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>cd03378 beta_CA_cladeC Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>KOG1578 consensus Back     alignment and domain information
>KOG1578 consensus Back     alignment and domain information
>pfam00484 Pro_CA Carbonic anhydrase Back     alignment and domain information
>cd00382 beta_CA Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>cd03379 beta_CA_cladeD Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>pfam10575 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target207 carbonate dehydratase [Candidatus Liberibacter asiaticu
3qy1_A223 1.54a Resolution Crystal Structure Of A Beta-Carbon 4e-37
1i6p_A220 Crystal Structure Of E. Coli Beta Carbonic Anhydras 8e-37
1i6o_A220 Crystal Structure Of E. Coli Beta Carbonic Anhydras 1e-36
3mf3_A221 Cobalt(Ii)-Substituted Haemophilus Influenzae B-Car 1e-35
2a8c_A229 Haemophilus Influenzae Beta-Carbonic Anhydrase Leng 2e-35
3e3g_A229 H. Influenzae Beta-Carbonic Anhydrase, Variant G41a 4e-35
3e2x_A229 H. Influenzae Beta-Carbonic Anhydrase, Variant V47a 5e-35
3e24_A229 H. Influenzae Beta-Carbonic Anhydrase, Variant W39f 6e-35
3e28_A229 H. Influenzae Beta-Carbonic Anhydrase, Variant Y181 6e-35
3e1v_A229 H. Influenzae Beta-Carbonic Anhydrase, Variant D44n 1e-34
1ddz_A 496 X-Ray Structure Of A Beta-Carbonic Anhydrase From T 5e-34
1ddz_A496 X-Ray Structure Of A Beta-Carbonic Anhydrase From T 1e-31
1ekj_A221 The X-Ray Crystallographic Structure Of Beta Carbon 8e-33
2w3q_A243 Structure And Inhibition Of The Co2-Sensing Carboni 2e-31
2w3n_A239 Structure And Inhibition Of The Co2-Sensing Carboni 4e-31
2a5v_A213 Crystal Structure Of M. Tuberculosis Beta Carbonic 6e-28
1ym3_A215 Crystal Structure Of Carbonic Anhydrase Rv3588c Fro 7e-28
3eyx_A216 Crystal Structure Of Carbonic Anhydrase Nce103 From 1e-24
3las_A166 Crystal Structure Of Carbonic Anhydrase From Strept 2e-17
1g5c_A170 Crystal Structure Of The 'cab' Type Beta Class Carb 4e-16
1ylk_A172 Crystal Structure Of Rv1284 From Mycobacterium Tube 3e-12
>gi|326328093|pdb|3QY1|A Chain A, 1.54a Resolution Crystal Structure Of A Beta-Carbonic Anhydrase From Salmonella Enterica Subsp. Enterica Serovar Typhimurium Str. Lt2 Length = 223 Back     alignment and structure
 Score =  158 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 61/206 (29%), Positives = 101/206 (49%), Gaps = 18/206 (8%)

Query: 1   MTSFPNTLLERHREFIQD--QYDKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGE 58
           M    +TL+  +  + +   + D   F++LA  QKP+ + I C DSRV  E +   +PGE
Sbjct: 4   MKDI-DTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGE 62

Query: 59  LFVVRNVANIVPPYEPDGQHHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSS 118
           LFV RNVAN+V   + +       + +++AV  L VEHI++ GH  CGGI+A +++    
Sbjct: 63  LFVHRNVANLVIHTDLN-----CLSVVQYAVDVLEVEHIIICGHSGCGGIKAAVENPEL- 116

Query: 119 TSPGDFIGKWMDIVRPIAQKIV----ANNPTEKQTILEQLSIRNSLKNIRNFPFVNKLEK 174
                 I  W+  +R I  K           ++   L +L++   + N+ +   +    K
Sbjct: 117 ----GLINNWLLHIRDIWLKHSSLLGKMPEEQRLDALYELNVMEQVYNLGHSTIMQSAWK 172

Query: 175 EHM-LQIHGAWFDISSGKLWILDPTS 199
               + IHG  + I+ G L  LD T+
Sbjct: 173 RGQNVTIHGWAYSINDGLLRDLDVTA 198


gi|14277938|pdb|1I6P|A Chain A, Crystal Structure Of E. Coli Beta Carbonic Anhydrase (Ecca) Length = 220 Back     alignment and structure
>gi|14277936|pdb|1I6O|A Chain A, Crystal Structure Of E. Coli Beta Carbonic Anhydrase (Ecca) Length = 220 Back     alignment and structure
>gi|329666096|pdb|3MF3|A Chain A, Cobalt(Ii)-Substituted Haemophilus Influenzae B-Carbonic Anhydrase Length = 221 Back     alignment and structure
gi|99031784|pdb|2A8C|A Chain A, Haemophilus Influenzae Beta-Carbonic Anhydrase Length = 229 Back     alignment and structure
>gi|256032486|pdb|3E3G|A Chain A, H. Influenzae Beta-Carbonic Anhydrase, Variant G41a Length = 229 Back     alignment and structure
>gi|256032480|pdb|3E2X|A Chain A, H. Influenzae Beta-Carbonic Anhydrase, Variant V47a Length = 229 Back     alignment and structure
>gi|238828148|pdb|3E24|A Chain A, H. Influenzae Beta-Carbonic Anhydrase, Variant W39f Length = 229 Back     alignment and structure
>gi|238828150|pdb|3E28|A Chain A, H. Influenzae Beta-Carbonic Anhydrase, Variant Y181f Length = 229 Back     alignment and structure
>gi|238828144|pdb|3E1V|A Chain A, H. Influenzae Beta-Carbonic Anhydrase, Variant D44n Length = 229 Back     alignment and structure
>gi|7245350|pdb|1DDZ|A Chain A, X-Ray Structure Of A Beta-Carbonic Anhydrase From The Red Alga, Porphyridium Purpureum R-1 Length = 496 Back     alignment and structure
>gi|7245350|pdb|1DDZ|A Chain A, X-Ray Structure Of A Beta-Carbonic Anhydrase From The Red Alga, Porphyridium Purpureum R-1 Length = 496 Back     alignment and structure
>gi|8569250|pdb|1EKJ|A Chain A, The X-Ray Crystallographic Structure Of Beta Carbonic Anhydrase From The C3 Dicot Pisum Sativum Length = 221 Back     alignment and structure
>gi|219109197|pdb|2W3Q|A Chain A, Structure And Inhibition Of The Co2-Sensing Carbonic Anhydrase Can2 From The Pathogenic Fungus Cryptococcus Neoformans Length = 243 Back     alignment and structure
>gi|219109194|pdb|2W3N|A Chain A, Structure And Inhibition Of The Co2-Sensing Carbonic Anhydrase Can2 From The Pathogenic Fungus Cryptococcus Neoformans Length = 239 Back     alignment and structure
>gi|78101214|pdb|2A5V|A Chain A, Crystal Structure Of M. Tuberculosis Beta Carbonic Anhydrase, Rv3588c, Tetrameric Form Length = 213 Back     alignment and structure
>gi|62738667|pdb|1YM3|A Chain A, Crystal Structure Of Carbonic Anhydrase Rv3588c From Mycobacterium Tuberculosis Length = 215 Back     alignment and structure
>gi|258588256|pdb|3EYX|A Chain A, Crystal Structure Of Carbonic Anhydrase Nce103 From Saccharomyces Cerevisiae Length = 216 Back     alignment and structure
gi|317455167|pdb|3LAS|A Chain A, Crystal Structure Of Carbonic Anhydrase From Streptococcus Mutans To 1.4 Angstrom Resolution Length = 166 Back     alignment and structure
>gi|13786684|pdb|1G5C|A Chain A, Crystal Structure Of The 'cab' Type Beta Class Carbonic Anhydrase From Methanobacterium Thermoautotrophicum Length = 170 Back     alignment and structure
>gi|62738656|pdb|1YLK|A Chain A, Crystal Structure Of Rv1284 From Mycobacterium Tuberculosis In Complex With Thiocyanate Length = 172 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target207 carbonate dehydratase [Candidatus Liberibacter asiaticu
1ddz_A 496 Carbonic anhydrase; alpha-beta-alpha; 2.20A {Porphyridi 1e-52
1ddz_A496 Carbonic anhydrase; alpha-beta-alpha; 2.20A {Porphyridi 9e-51
1ekj_A221 Beta-carbonic anhydrase; rossman fold domain, strand ex 1e-51
2w3q_A243 Carbonic anhydrase 2; lyase, inhibition, sulfonamide; 1 9e-48
1i6p_A220 Carbonic anhydrase; metalloenzyme, zinc coordination, P 3e-44
3e3i_A229 Carbonic anhydrase 2, beta carbonic anhydrase; alloster 9e-39
3eyx_A216 Carbonic anhydrase; rossmann fold, cytoplasm, lyase, me 1e-36
1ym3_A215 Carbonic anhydrase (carbonate dehydratase) (carbonic de 5e-36
1g5c_A170 Beta-carbonic anhydrase; zinc, hepes, lyase; HET: EPE; 7e-34
1ylk_A172 Hypothetical protein RV1284/MT1322; homodimer, alpha/be 1e-28
>1ddz_A Carbonic anhydrase; alpha-beta-alpha; 2.20A {Porphyridium cruentum} SCOP: c.53.2.1 c.53.2.1 Length = 496 Back     alignment and structure
 Score =  201 bits (512), Expect = 1e-52
 Identities = 52/205 (25%), Positives = 90/205 (43%), Gaps = 18/205 (8%)

Query: 6   NTLLERHREFIQDQY--DKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFVVR 63
           + +   +  + Q+    D + F  LAN Q P+ + I C DSRV    + +   GE+FV R
Sbjct: 37  SNIFANNEAWRQEMLKQDPEFFNRLANGQSPEYLWIGCADSRVPANQLLDLPAGEVFVHR 96

Query: 64  NVANIVPPYEPDGQHHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGD 123
           N+AN     +      +  + +++AVQ L V+HI+V GH  CGG +A L  +        
Sbjct: 97  NIANQCIHSD-----ISFLSVLQYAVQYLKVKHILVCGHYGCGGAKAALGDSRL-----G 146

Query: 124 FIGKWMDIVRPIAQKIVAN-----NPTEKQTILEQLSIRNSLKNIRNFPFV-NKLEKEHM 177
            I  W+  +R + +          +  E+   L +L++   + N+     V +  +    
Sbjct: 147 LIDNWLRHIRDVRRMNAKYLDKCKDGDEELNRLIELNVLEQVHNVCATSIVQDAWDAGQE 206

Query: 178 LQIHGAWFDISSGKLWILDPTSNEF 202
           L + G  + +  GKL  L    N  
Sbjct: 207 LTVQGVVYGVGDGKLRDLGVVVNSS 231


>1ddz_A Carbonic anhydrase; alpha-beta-alpha; 2.20A {Porphyridium cruentum} SCOP: c.53.2.1 c.53.2.1 Length = 496 Back     alignment and structure
>1ekj_A Beta-carbonic anhydrase; rossman fold domain, strand exchange, lyase; HET: CIT; 1.93A {Pisum sativum} SCOP: c.53.2.1 Length = 221 Back     alignment and structure
>2w3q_A Carbonic anhydrase 2; lyase, inhibition, sulfonamide; 1.34A {Cryptococcus neoformans} PDB: 2w3n_A Length = 243 Back     alignment and structure
>1i6p_A Carbonic anhydrase; metalloenzyme, zinc coordination, PH- dependent activity, MAD phasing, lyase; 2.00A {Escherichia coli} SCOP: c.53.2.1 PDB: 1i6o_A 1t75_A 2esf_A Length = 220 Back     alignment and structure
>3e3i_A Carbonic anhydrase 2, beta carbonic anhydrase; allosteric site mutant, lyase, metal-binding, zinc; 2.00A {Haemophilus influenzae} PDB: 3e3g_A 2a8d_A 2a8c_A 3e3f_A 3e31_A 3e2x_A 3e2a_A 3e28_A 3e2w_A 3e1w_A 3e1v_A 3e24_A Length = 229 Back     alignment and structure
>3eyx_A Carbonic anhydrase; rossmann fold, cytoplasm, lyase, metal-binding, nucleus, zinc; 2.04A {Saccharomyces cerevisiae} Length = 216 Back     alignment and structure
>1ym3_A Carbonic anhydrase (carbonate dehydratase) (carbonic dehydratase); Zn protein, structural proteomics in europe, spine; 1.75A {Mycobacterium tuberculosis H37RV} PDB: 2a5v_A Length = 215 Back     alignment and structure
>1g5c_A Beta-carbonic anhydrase; zinc, hepes, lyase; HET: EPE; 2.10A {Methanothermobacterthermautotrophicus} SCOP: c.53.2.1 Length = 170 Back     alignment and structure
>1ylk_A Hypothetical protein RV1284/MT1322; homodimer, alpha/beta-fold, structural proteomics in europe, spine, structural genomics; 2.00A {Mycobacterium tuberculosis H37RV} Length = 172 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target207 carbonate dehydratase [Candidatus Liberibacter asiaticu
1ekj_A221 Beta-carbonic anhydrase; rossman fold domain, strand ex 100.0
2w3q_A243 Carbonic anhydrase 2; lyase, inhibition, sulfonamide; 1 100.0
1i6p_A220 Carbonic anhydrase; metalloenzyme, zinc coordination, P 100.0
1ym3_A215 Carbonic anhydrase (carbonate dehydratase) (carbonic de 100.0
1ddz_A 496 Carbonic anhydrase; alpha-beta-alpha, lyase; 2.20A {Por 100.0
3eyx_A216 Carbonic anhydrase; rossmann fold, cytoplasm, lyase, me 100.0
3e3i_A229 Carbonic anhydrase 2, beta carbonic anhydrase; alloster 100.0
1ddz_A496 Carbonic anhydrase; alpha-beta-alpha, lyase; 2.20A {Por 100.0
1ylk_A172 Hypothetical protein RV1284/MT1322; homodimer, alpha/be 100.0
1g5c_A170 Beta-carbonic anhydrase; zinc, hepes, lyase; HET: EPE; 100.0
>1ekj_A Beta-carbonic anhydrase; rossman fold domain, strand exchange, lyase; HET: CIT; 1.93A {Pisum sativum} SCOP: c.53.2.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=381.51  Aligned_cols=201  Identities=35%  Similarity=0.598  Sum_probs=180.6

Q ss_pred             HHHHHHHHHHHHHCCC--CHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCHHHH
Q ss_conf             9999999999970687--98899986238997599996267899888851788662488862422345777775302578
Q gi|254780663|r    5 PNTLLERHREFIQDQY--DKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQHHATS   82 (207)
Q Consensus         5 ~~~Ll~~N~~f~~~~~--~~~~~~~l~~~q~P~~~vitC~DsRv~~~~i~~~~~Gd~fv~RnaGn~v~~~~~~~~~~~~~   82 (207)
                      +++|++||++|+++.+  +|++|++|++||+|+++||||||||++||.+||++|||+||+||+||+|+|++.. ...+++
T Consensus        14 ~e~L~~G~~~f~~~~~~~~~~~~~~la~gQ~P~~~vi~CsDSRv~pe~i~~~~~GdlfvvRNaGN~v~~~d~~-~~~~~~   92 (221)
T 1ekj_A           14 SERIKTGFLHFKKEKYDKNPALYGELAKGQSPPFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANLVPPYDQA-KYAGTG   92 (221)
T ss_dssp             HHHHHHHHHHHHHHTTTSCHHHHHHHTTCCCCSEEEEEECCGGGCHHHHSCCCTTSEEEEEEGGGCCCCSCTT-TCHHHH
T ss_pred             HHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHCCCCCCEEEEECCCCCCCCCCCC-CCCHHH
T ss_conf             9999999999985766328899999856899846999513658888997278997579986555567976655-431056


Q ss_pred             HHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHC----CCHHHHHHHHHHHHHH
Q ss_conf             887767220576689998158538988753000013463310146898888999986401----6324687999999999
Q gi|254780663|r   83 AAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVAN----NPTEKQTILEQLSIRN  158 (207)
Q Consensus        83 ~sle~av~~l~v~~iiV~GHt~CGav~aa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~l~~~nV~~  158 (207)
                      ++||||+.+||+++|||||||+||||+++++.........+++..|+..+++........    ...+..+.+++.||+.
T Consensus        93 asleyAv~~L~v~~IvV~GHs~CGav~aa~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~nV~~  172 (221)
T 1ekj_A           93 AAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTYSTDFIEEWVKIGLPAKAKVKAQHGDAPFAELCTHCEKEAVNA  172 (221)
T ss_dssp             HHHHHHHHTSCCSEEEEEEESSCHHHHHHHHCCCSSCCCSSSHHHHHGGGHHHHHHHHHHSTTSCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH
T ss_conf             88998886049507999658873478887754422676731578888851779999875415785788988999999999


Q ss_pred             HHHHHHCCHHHHHHHHCCCCEEEEEEEECCCCEEEEEECCCCEEEECC
Q ss_conf             999973097889999779967999999889876999846888258335
Q gi|254780663|r  159 SLKNIRNFPFVNKLEKEHMLQIHGAWFDISSGKLWILDPTSNEFTCDT  206 (207)
Q Consensus       159 ~v~~L~~~p~i~~~v~~g~l~I~G~~yDi~tG~v~~l~~~~~~F~~~~  206 (207)
                      |+++|++||+|++++++|+|.|||||||++||+|++|+.+.+.+...|
T Consensus       173 qv~~L~~~p~I~~~v~~g~l~I~G~~YDi~tG~V~~~~~e~g~~~~~~  220 (221)
T 1ekj_A          173 SLGNLLTYPFVREGLVNKTLALKGGYYDFVKGSFELWGLEFGLSSTFS  220 (221)
T ss_dssp             HHHHHTTSHHHHHHHHTTSCEEEEEEEETTTTEEEEEEECCCCCCCCC
T ss_pred             HHHHHHCCHHHHHHHHCCCCEEEEEEEECCCCEEEEEECCCCCCCCCC
T ss_conf             999997098999999869948999999878977999824568877876



>2w3q_A Carbonic anhydrase 2; lyase, inhibition, sulfonamide; 1.34A {Cryptococcus neoformans} PDB: 2w3n_A Back     alignment and structure
>1i6p_A Carbonic anhydrase; metalloenzyme, zinc coordination, PH- dependent activity, MAD phasing, lyase; 2.00A {Escherichia coli} SCOP: c.53.2.1 PDB: 1i6o_A 1t75_A 2esf_A Back     alignment and structure
>1ym3_A Carbonic anhydrase (carbonate dehydratase) (carbonic dehydratase); Zn protein, structural proteomics in europe, spine; 1.75A {Mycobacterium tuberculosis H37RV} PDB: 2a5v_A Back     alignment and structure
>1ddz_A Carbonic anhydrase; alpha-beta-alpha, lyase; 2.20A {Porphyridium purpureum} SCOP: c.53.2.1 c.53.2.1 Back     alignment and structure
>3eyx_A Carbonic anhydrase; rossmann fold, cytoplasm, lyase, metal-binding, nucleus, zinc; 2.04A {Saccharomyces cerevisiae} Back     alignment and structure
>3e3i_A Carbonic anhydrase 2, beta carbonic anhydrase; allosteric site mutant, lyase, META binding, zinc; 2.00A {Haemophilus influenzae} PDB: 3e3g_A 2a8d_A 2a8c_A 3e3f_A 3e31_A 3e2x_A 3e2a_A 3e28_A 3e2w_A 3e1w_A 3e1v_A 3e24_A Back     alignment and structure
>1ddz_A Carbonic anhydrase; alpha-beta-alpha, lyase; 2.20A {Porphyridium purpureum} SCOP: c.53.2.1 c.53.2.1 Back     alignment and structure
>1ylk_A Hypothetical protein RV1284/MT1322; homodimer, alpha/beta-fold, structural proteomics in europe, spine, structural genomics; 2.00A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>1g5c_A Beta-carbonic anhydrase; zinc, hepes, lyase; HET: EPE; 2.10A {Methanothermobacterthermautotrophicus} SCOP: c.53.2.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 207 carbonate dehydratase [Candidatus Liberibacter asiaticu
d1i6pa_214 c.53.2.1 (A:) beta-carbonic anhydrase {Escherichia coli 6e-43
d1ddza2239 c.53.2.1 (A:326-564) beta-carbonic anhydrase {Red alga 8e-43
d1ekja_210 c.53.2.1 (A:) beta-carbonic anhydrase {Pea (Pisum sativ 3e-41
d1ddza1242 c.53.2.1 (A:84-325) beta-carbonic anhydrase {Red alga ( 1e-40
d1g5ca_169 c.53.2.1 (A:) beta-carbonic anhydrase {Archaeon Methano 4e-31
>d1i6pa_ c.53.2.1 (A:) beta-carbonic anhydrase {Escherichia coli [TaxId: 562]} Length = 214 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Resolvase-like
superfamily: beta-carbonic anhydrase, cab
family: beta-carbonic anhydrase, cab
domain: beta-carbonic anhydrase
species: Escherichia coli [TaxId: 562]
 Score =  167 bits (424), Expect = 6e-43
 Identities = 55/198 (27%), Positives = 97/198 (48%), Gaps = 9/198 (4%)

Query: 8   LLERHREFIQDQY--DKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFVVRNV 65
           L+  +  + +     D   F++LA  QKP+ + I C DSRV  E +   +PGELFV RNV
Sbjct: 6   LISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNV 65

Query: 66  ANIVPPYEPDGQHHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFI 125
           AN+V   + +       + +++AV  L VEHI++ GH  CGG+QA +++        +++
Sbjct: 66  ANLVIHTDLN-----CLSVVQYAVDVLEVEHIIICGHYGCGGVQAAVENPELGLIN-NWL 119

Query: 126 GKWMDIVRPIAQKIVANNPTEKQTILEQLSIRNSLKNIRNFPFV-NKLEKEHMLQIHGAW 184
               DI    +  +       +   L +L++   + N+ +   + +  ++   + IHG  
Sbjct: 120 LHIRDIWFKHSSLLGEMPQERRLDTLCELNVMEQVYNLGHSTIMQSAWKRGQKVTIHGWA 179

Query: 185 FDISSGKLWILDPTSNEF 202
           + I  G L  LD T+   
Sbjct: 180 YGIHDGLLRDLDVTATNR 197


>d1ddza2 c.53.2.1 (A:326-564) beta-carbonic anhydrase {Red alga (Porphyridium purpureum) [TaxId: 35688]} Length = 239 Back     information, alignment and structure
>d1ekja_ c.53.2.1 (A:) beta-carbonic anhydrase {Pea (Pisum sativum) [TaxId: 3888]} Length = 210 Back     information, alignment and structure
>d1ddza1 c.53.2.1 (A:84-325) beta-carbonic anhydrase {Red alga (Porphyridium purpureum) [TaxId: 35688]} Length = 242 Back     information, alignment and structure
>d1g5ca_ c.53.2.1 (A:) beta-carbonic anhydrase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 169 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target207 carbonate dehydratase [Candidatus Liberibacter asiaticu
d1ekja_210 beta-carbonic anhydrase {Pea (Pisum sativum) [TaxId: 38 100.0
d1i6pa_214 beta-carbonic anhydrase {Escherichia coli [TaxId: 562]} 100.0
d1ddza2239 beta-carbonic anhydrase {Red alga (Porphyridium purpure 100.0
d1ddza1242 beta-carbonic anhydrase {Red alga (Porphyridium purpure 100.0
d1g5ca_169 beta-carbonic anhydrase {Archaeon Methanobacterium ther 100.0
>d1ekja_ c.53.2.1 (A:) beta-carbonic anhydrase {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Resolvase-like
superfamily: beta-carbonic anhydrase, cab
family: beta-carbonic anhydrase, cab
domain: beta-carbonic anhydrase
species: Pea (Pisum sativum) [TaxId: 3888]
Probab=100.00  E-value=0  Score=379.62  Aligned_cols=200  Identities=36%  Similarity=0.598  Sum_probs=180.9

Q ss_pred             HHHHHHHHHHHHHCCC--CHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCHHHH
Q ss_conf             9999999999970687--98899986238997599996267899888851788662488862422345777775302578
Q gi|254780663|r    5 PNTLLERHREFIQDQY--DKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQHHATS   82 (207)
Q Consensus         5 ~~~Ll~~N~~f~~~~~--~~~~~~~l~~~q~P~~~vitC~DsRv~~~~i~~~~~Gd~fv~RnaGn~v~~~~~~~~~~~~~   82 (207)
                      +++|++||+||+++.+  ++++|++|++||+|+++||||||||++||.+||++|||+||+||+||+|+|.+.. ...+++
T Consensus         3 ~e~l~~G~~~f~~~~~~~~~~~~~~l~~gQ~P~~~vi~C~DSRv~~e~if~~~~GdlfvvRnaGn~v~~~~~~-~~~~~~   81 (210)
T d1ekja_           3 SERIKTGFLHFKKEKYDKNPALYGELAKGQSPPFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANLVPPYDQA-KYAGTG   81 (210)
T ss_dssp             HHHHHHHHHHHHHHTTTSCHHHHHHHTTCCCCSEEEEEECCGGGCHHHHSCCCTTSEEEEEEGGGCCCCSCTT-TCHHHH
T ss_pred             HHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCEEEEECCCCCCCHHHHCCCCCCCEEEEECCCCCCCCCCCC-CCHHHH
T ss_conf             8999999999986755118899999846899965999013669885660347998689985367755765555-431067


Q ss_pred             HHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHC----CCHHHHHHHHHHHHHH
Q ss_conf             887767220576689998158538988753000013463310146898888999986401----6324687999999999
Q gi|254780663|r   83 AAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVAN----NPTEKQTILEQLSIRN  158 (207)
Q Consensus        83 ~sle~av~~l~v~~iiV~GHt~CGav~aa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~l~~~nV~~  158 (207)
                      +|||||+.+|++++|||||||+||||+|+++.........+++..|...++++.......    ...+..+.++++||+.
T Consensus        82 ~sleyav~~l~v~~IVVlGHt~CGav~Aa~~~~~~~~~~~~~~~~~~~~i~~a~~~~~~~~~~~~~~~~~~~~~~~nV~~  161 (210)
T d1ekja_          82 AAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTYSTDFIEEWVKIGLPAKAKVKAQHGDAPFAELCTHCEKEAVNA  161 (210)
T ss_dssp             HHHHHHHHTSCCSEEEEEEESSCHHHHHHHHCCCSSCCCSSSHHHHHGGGHHHHHHHHHHSTTSCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHH
T ss_conf             77776641379539999747545788776652212676675378899988999998742155320788877789989999


Q ss_pred             HHHHHHCCHHHHHHHHCCCCEEEEEEEECCCCEEEEEECCCCEEEEC
Q ss_conf             99997309788999977996799999988987699984688825833
Q gi|254780663|r  159 SLKNIRNFPFVNKLEKEHMLQIHGAWFDISSGKLWILDPTSNEFTCD  205 (207)
Q Consensus       159 ~v~~L~~~p~i~~~v~~g~l~I~G~~yDi~tG~v~~l~~~~~~F~~~  205 (207)
                      |+++|++||+|++++++|+|.|||||||++||+|++|+.+++.|..-
T Consensus       162 ~v~~L~~~p~I~~~v~~g~l~I~G~vYDi~tG~v~~~~~~~g~~~~~  208 (210)
T d1ekja_         162 SLGNLLTYPFVREGLVNKTLALKGGYYDFVKGSFELWGLEFGLSSTF  208 (210)
T ss_dssp             HHHHHTTSHHHHHHHHTTSCEEEEEEEETTTTEEEEEEECCCCCCCC
T ss_pred             HHHHHHCCHHHHHHHHCCCEEEEEEEEECCCCEEEEEECCCCCCCCC
T ss_conf             99999709889999986980899999988985799980567988777



>d1i6pa_ c.53.2.1 (A:) beta-carbonic anhydrase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ddza2 c.53.2.1 (A:326-564) beta-carbonic anhydrase {Red alga (Porphyridium purpureum) [TaxId: 35688]} Back     information, alignment and structure
>d1ddza1 c.53.2.1 (A:84-325) beta-carbonic anhydrase {Red alga (Porphyridium purpureum) [TaxId: 35688]} Back     information, alignment and structure
>d1g5ca_ c.53.2.1 (A:) beta-carbonic anhydrase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 207 carbonate dehydratase [Candidatus Liberibacter asi
1ekj_A_44-221178 (A:44-221) Beta-carbonic anhydrase; rossman fold d 8e-44
1i6p_A_27-220194 (A:27-220) Carbonic anhydrase; metalloenzyme, zinc 2e-40
1ym3_A_215 (A:) Carbonic anhydrase (carbonate dehydratase) (c 2e-39
3eyx_A_39-216178 (A:39-216) Carbonic anhydrase; rossmann fold, cyto 1e-38
3e3i_A_29-229201 (A:29-229) Carbonic anhydrase 2, beta carbonic anh 3e-38
2w3q_A_64-243180 (A:64-243) Carbonic anhydrase 2; lyase, inhibition 4e-38
1ddz_A_67-320254 (A:67-320) Carbonic anhydrase; alpha-beta-alpha; 2 9e-38
1g5c_A_19-170152 (A:19-170) Beta-carbonic anhydrase; zinc, hepes, l 2e-31
1ylk_A_33-172140 (A:33-172) Hypothetical protein RV1284/MT1322; hom 3e-31
1ddz_A_1-66_321-496242 (A:1-66,A:321-496) Carbonic anhydrase; alpha-beta- 6e-17
>1ekj_A (A:44-221) Beta-carbonic anhydrase; rossman fold domain, strand exchange, lyase; HET: CIT; 1.93A {Pisum sativum}Length = 178 Back     alignment and structure
 Score =  171 bits (433), Expect = 8e-44
 Identities = 64/174 (36%), Positives = 92/174 (52%), Gaps = 5/174 (2%)

Query: 33  KPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQHHATSAAIEFAVQGL 92
            P  M+ +C DSRV P  + + +PGE FVVRNVAN+VPPY+   ++  T AAIE+AV  L
Sbjct: 1   SPPFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANLVPPYD-QAKYAGTGAAIEYAVLHL 59

Query: 93  NVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVANNPT----EKQ 148
            V +IVV+GH  CGGI+ +L      T   DFI +W+ I  P   K+ A +      E  
Sbjct: 60  KVSNIVVIGHSACGGIKGLLSFPFDGTYSTDFIEEWVKIGLPAKAKVKAQHGDAPFAELC 119

Query: 149 TILEQLSIRNSLKNIRNFPFVNKLEKEHMLQIHGAWFDISSGKLWILDPTSNEF 202
           T  E+ ++  SL N+  +PFV +      L + G ++D   G   +        
Sbjct: 120 THCEKEAVNASLGNLLTYPFVREGLVNKTLALKGGYYDFVKGSFELWGLEFGLS 173


>1i6p_A (A:27-220) Carbonic anhydrase; metalloenzyme, zinc coordination, PH- dependent activity, MAD phasing, lyase; 2.00A {Escherichia coli}Length = 194 Back     alignment and structure
>1ym3_A (A:) Carbonic anhydrase (carbonate dehydratase) (carbonic dehydratase); Zn protein, structural proteomics in europe, spine; 1.75A {Mycobacterium tuberculosis H37RV} PDB: 2a5v_ALength = 215 Back     alignment and structure
>3eyx_A (A:39-216) Carbonic anhydrase; rossmann fold, cytoplasm, lyase, metal-binding, nucleus, zinc; 2.04A {Saccharomyces cerevisiae}Length = 178 Back     alignment and structure
>3e3i_A (A:29-229) Carbonic anhydrase 2, beta carbonic anhydrase; allosteric site mutant, lyase, metal-binding, zinc; 2.00A {Haemophilus influenzae} PDB: 3e3g_A 2a8d_A 2a8c_A 3e3f_A 3e31_A 3e2x_A 3e2a_A 3e28_A 3e2w_A 3e1w_A 3e1v_A 3e24_ALength = 201 Back     alignment and structure
>2w3q_A (A:64-243) Carbonic anhydrase 2; lyase, inhibition, sulfonamide; 1.34A {Cryptococcus neoformans} PDB: 2w3n_ALength = 180 Back     alignment and structure
>1ddz_A (A:67-320) Carbonic anhydrase; alpha-beta-alpha; 2.20A {Porphyridium cruentum}Length = 254 Back     alignment and structure
>1g5c_A (A:19-170) Beta-carbonic anhydrase; zinc, hepes, lyase; HET: EPE; 2.10A {Methanothermobacterthermautotrophicus}Length = 152 Back     alignment and structure
>1ylk_A (A:33-172) Hypothetical protein RV1284/MT1322; homodimer, alpha/beta-fold, structural proteomics in europe, spine, structural genomics; 2.00A {Mycobacterium tuberculosis H37RV}Length = 140 Back     alignment and structure
>1ddz_A (A:1-66,A:321-496) Carbonic anhydrase; alpha-beta-alpha; 2.20A {Porphyridium cruentum}Length = 242 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target207 carbonate dehydratase [Candidatus Liberibacter asiaticu
1ym3_A_215 Carbonic anhydrase (carbonate dehydratase) (carbon 100.0
1i6p_A_27-220194 Carbonic anhydrase; metalloenzyme, zinc coordinati 100.0
3e3i_A_29-229201 Carbonic anhydrase 2, beta carbonic anhydrase; all 100.0
1ddz_A_1-66_321-496242 Carbonic anhydrase; alpha-beta-alpha; 2.20A {Porph 99.97
1ekj_A_44-221178 Beta-carbonic anhydrase; rossman fold domain, stra 100.0
3eyx_A_39-216178 Carbonic anhydrase; rossmann fold, cytoplasm, lyas 100.0
1ddz_A_67-320254 Carbonic anhydrase; alpha-beta-alpha; 2.20A {Porph 100.0
2w3q_A_64-243180 Carbonic anhydrase 2; lyase, inhibition, sulfonami 100.0
1ylk_A_33-172140 Hypothetical protein RV1284/MT1322; homodimer, alp 100.0
1g5c_A_19-170152 Beta-carbonic anhydrase; zinc, hepes, lyase; HET: 100.0
>1ym3_A (A:) Carbonic anhydrase (carbonate dehydratase) (carbonic dehydratase); Zn protein, structural proteomics in europe, spine; 1.75A {Mycobacterium tuberculosis H37RV} PDB: 2a5v_A Back     alignment and structure
Probab=100.00  E-value=0  Score=345.86  Aligned_cols=193  Identities=28%  Similarity=0.421  Sum_probs=170.2

Q ss_pred             HHHHHHHHHHHHHHHCCC-----CHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHCCCCCCEEEEECCCCCCCCCCCCCC
Q ss_conf             469999999999970687-----988999862389975999962678998888517886624888624223457777753
Q gi|254780663|r    3 SFPNTLLERHREFIQDQY-----DKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELFVVRNVANIVPPYEPDGQ   77 (207)
Q Consensus         3 ~~~~~Ll~~N~~f~~~~~-----~~~~~~~l~~~q~P~~~vitC~DsRv~~~~i~~~~~Gd~fv~RnaGn~v~~~~~~~~   77 (207)
                      +-+++|++||++|++++.     .+++|+.|++||+|+++||||||||++||.+||++|||+||+||+||+|        
T Consensus        16 ~~l~~ll~gN~~f~~~~~~~~~~~~~~~~~l~~gq~P~~~vi~CsDsRv~pe~i~~~~~GdlfvvRn~Gn~v--------   87 (215)
T 1ym3_A           16 AAWKALKEGNERFVAGRPQHPSQSVDHRAGLAAGQKPTAVIFGCADSRVAAEIIFDQGLGDMFVVRTAGHVI--------   87 (215)
T ss_dssp             HHHHHHHHHHHHHHHTCCSSGGGC----------CCCSEEEEEETTCSSCHHHHTTCCTTSEEEEEEGGGCC--------
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHCCCCCCCEEEEECCCCCCCHHHHCCCCCCCEEEEEECCCCC--------
T ss_conf             999999999999983975685438899987415899836999405778787773389987468983043446--------


Q ss_pred             CHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             02578887767220576689998158538988753000013463310146898888999986401632468799999999
Q gi|254780663|r   78 HHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVANNPTEKQTILEQLSIR  157 (207)
Q Consensus        78 ~~~~~~sle~av~~l~v~~iiV~GHt~CGav~aa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~nV~  157 (207)
                      +.++++|||||+.+|+|++|||||||+||||+++++..........+...+....++... .....+.+..+.++++||+
T Consensus        88 ~~~~~asieyav~~L~v~~IvV~GHt~CGav~a~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~NV~  166 (215)
T 1ym3_A           88 DSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVRDVVERVAPSVL-LGRRDGLSRVDEFEQRHVH  166 (215)
T ss_dssp             CHHHHHHHHHHHHTSCCCEEEEEEESSCHHHHHHHHHHHHTSCCSTTHHHHHHHHHHHHH-HHHHTTCCSHHHHHHHHHH
T ss_pred             CHHHHEEEEEEEECCCCCEEEEECCCCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHH-HHHCCCHHHHHHHHHHHHH
T ss_conf             843401568864127867899976865068887651012456763226799998605555-3201432243279999999


Q ss_pred             HHHHHHHCC-HHHHHHHHCCCCEEEEEEEECCCCEEEEEECCCCEEEE
Q ss_conf             999997309-78899997799679999998898769998468882583
Q gi|254780663|r  158 NSLKNIRNF-PFVNKLEKEHMLQIHGAWFDISSGKLWILDPTSNEFTC  204 (207)
Q Consensus       158 ~~v~~L~~~-p~i~~~v~~g~l~I~G~~yDi~tG~v~~l~~~~~~F~~  204 (207)
                      .|+++|+++ |++++++++|+|.||||+||++||+|++|+.+++.|+.
T Consensus       167 ~~v~~l~~~~~~~~~~~~~g~l~I~G~~ydi~tG~v~~l~~~~~~~~~  214 (215)
T 1ym3_A          167 ETVAILMARSSAISERIAGGSLAIVGVTYQLDDGRAVLRDHIGNIGEE  214 (215)
T ss_dssp             HHHHHHHHHCHHHHHHHHHTSCEEEEEEECTTTCCCEEEEEESCCSCC
T ss_pred             HHHHHHHHCCHHHHHHHHCCCCEEEEEEEECCCEEEEEEECCCCCCCC
T ss_conf             999999746999999998898389999998787079999889865882



>1i6p_A (A:27-220) Carbonic anhydrase; metalloenzyme, zinc coordination, PH- dependent activity, MAD phasing, lyase; 2.00A {Escherichia coli} Back     alignment and structure
>3e3i_A (A:29-229) Carbonic anhydrase 2, beta carbonic anhydrase; allosteric site mutant, lyase, metal-binding, zinc; 2.00A {Haemophilus influenzae} PDB: 3e3g_A 2a8d_A 2a8c_A 3e3f_A 3e31_A 3e2x_A 3e2a_A 3e28_A 3e2w_A 3e1w_A 3e1v_A 3e24_A Back     alignment and structure
>1ddz_A (A:1-66,A:321-496) Carbonic anhydrase; alpha-beta-alpha; 2.20A {Porphyridium cruentum} Back     alignment and structure
>1ekj_A (A:44-221) Beta-carbonic anhydrase; rossman fold domain, strand exchange, lyase; HET: CIT; 1.93A {Pisum sativum} Back     alignment and structure
>3eyx_A (A:39-216) Carbonic anhydrase; rossmann fold, cytoplasm, lyase, metal-binding, nucleus, zinc; 2.04A {Saccharomyces cerevisiae} Back     alignment and structure
>1ddz_A (A:67-320) Carbonic anhydrase; alpha-beta-alpha; 2.20A {Porphyridium cruentum} Back     alignment and structure
>2w3q_A (A:64-243) Carbonic anhydrase 2; lyase, inhibition, sulfonamide; 1.34A {Cryptococcus neoformans} PDB: 2w3n_A Back     alignment and structure
>1ylk_A (A:33-172) Hypothetical protein RV1284/MT1322; homodimer, alpha/beta-fold, structural proteomics in europe, spine, structural genomics; 2.00A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>1g5c_A (A:19-170) Beta-carbonic anhydrase; zinc, hepes, lyase; HET: EPE; 2.10A {Methanothermobacterthermautotrophicus} Back     alignment and structure