254780669

254780669

2-dehydro-3-deoxyphosphooctonate aldolase

GeneID in NCBI database:8209673Locus tag:CLIBASIA_02780
Protein GI in NCBI database:254780669Protein Accession:YP_003065082.1
Gene range:-(598831, 599736)Protein Length:301aa
Gene description:2-dehydro-3-deoxyphosphooctonate aldolase
COG prediction:[M] 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
KEGG prediction:kdsA; 2-dehydro-3-deoxyphosphooctonate aldolase (EC:2.5.1.55); K01627 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC:2.5.1.55]
SEED prediction:2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase (EC 2.5.1.55)
Pathway involved in KEGG:Lipopolysaccharide biosynthesis [PATH:las00540]
Subsystem involved in SEED:KDO2-Lipid A biosynthesis;
Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate)
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-
MHILYPQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL
cccccHHHHHHHHHccccccccccccEEEccccccccEEccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHcccEEEcccccccccccccccccccHHHHHHHHHHHHHHHccEEEEEccccccHHHHHHHHcEEEEcccccccHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHHHccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEEcccHHHccccccccccHHHHHHHHHHHHHHHHHHHcc
ccEEcccccccEEEccccHHHHHHHHHEEcccccccEEcccccccEEEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccHHHHHHcHHHHHHHccccEEcEcccHHHHccccccccccEEcHHHHHHcHHHHHcccccccEEEEEcccccHHHcHHHHHHHHccccccEEEEEccEEcccccEEccccHHHHHHcccccEEEEccHHHEEccccccccEEcHHHHHHHHHHHHHHcccEEEEEEEccHHHccccccccEEHHHHHHHHHHHHHHHHHHccc
mhilypqnlEEKQRRIDKNHMIHtnaaihlgsgknqvtfsnEQRFVliagpcqieshDHAFMIAEKLYAICQSLNIGlvykssfdkanrsslagkrgvglKKGREIFRDLKKkygfpiltdvhTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGrvinvkkgqflspwEMHNILQKLHAHgakdvlfcergtsfgyntlvtdmrsipimtsmgvpvifdashsvqqpgihgncsggerqyiVPLAKAAVAIGIAGIFlethqdpdnapsdgpnminikDLPKLLSQLLAIDKIIKPL
MHILYPQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKanrsslagkrgvglkkgREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL
MHILYPQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLakaavaigiagiFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL
**ILYP************************GSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHS****************YIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL
MHILYPQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL
MHILYPQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHILYPQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL
MHILYPQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL
MHILYPQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target301 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus L
315122220281 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus L 1 1e-146
86357551281 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium et 1 1e-111
190891624281 3-deoxy-8-phosphooctulonate synthase [Rhizobium etli CI 1 1e-111
327189238281 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium et 1 1e-110
218660788281 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium et 1 1e-110
218462323281 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium et 1 1e-110
209549199281 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium le 1 1e-109
116251994281 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium le 1 1e-103
241204521281 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium le 1 1e-102
159184755281 2-dehydro-3-deoxyphosphooctonate aldolase [Agrobacteriu 1 2e-99
>gi|315122220|ref|YP_004062709.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 281 Back     alignment and organism information
 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 249/281 (88%), Positives = 262/281 (93%)

Query: 21  MIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVY 80
           M HTN  I LG GK QVTFSN++R VLIAGPCQIES +HAFM+AEKLYAICQSLNIGLVY
Sbjct: 1   MTHTNLEIQLGHGKKQVTFSNQKRLVLIAGPCQIESREHAFMMAEKLYAICQSLNIGLVY 60

Query: 81  KSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQI 140
           KSSFDKANRSSLAGKRG+GL+KGREIF DLKKKYGFPILTDVHTEQQC+AIADSVDILQI
Sbjct: 61  KSSFDKANRSSLAGKRGIGLEKGREIFLDLKKKYGFPILTDVHTEQQCKAIADSVDILQI 120

Query: 141 PALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGY 200
           PA LCRQTDLL AAAQTGRVINVKKGQFLSPWEMHN+LQKLHA+GA DVLFCERGTSFGY
Sbjct: 121 PAFLCRQTDLLIAAAQTGRVINVKKGQFLSPWEMHNVLQKLHANGAMDVLFCERGTSFGY 180

Query: 201 NTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           N LVTDMRS PIM SMGVPVIFDASHSVQQPGI GNCSGGER++I PLAKAAVAIGIAGI
Sbjct: 181 NNLVTDMRSFPIMASMGVPVIFDASHSVQQPGIRGNCSGGEREFIAPLAKAAVAIGIAGI 240

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           FLETHQDPDNAPSDGPNMINI DLPKLLSQLL+IDK+IK L
Sbjct: 241 FLETHQDPDNAPSDGPNMINIDDLPKLLSQLLSIDKVIKSL 281


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86357551|ref|YP_469443.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium etli CFN 42] Length = 281 Back     alignment and organism information
>gi|190891624|ref|YP_001978166.1| 3-deoxy-8-phosphooctulonate synthase [Rhizobium etli CIAT 652] Length = 281 Back     alignment and organism information
>gi|327189238|gb|EGE56417.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium etli CNPAF512] Length = 281 Back     alignment and organism information
>gi|218660788|ref|ZP_03516718.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium etli IE4771] Length = 281 Back     alignment and organism information
>gi|218462323|ref|ZP_03502414.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium etli Kim 5] Length = 281 Back     alignment and organism information
>gi|209549199|ref|YP_002281116.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 281 Back     alignment and organism information
>gi|116251994|ref|YP_767832.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium leguminosarum bv. viciae 3841] Length = 281 Back     alignment and organism information
>gi|241204521|ref|YP_002975617.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 281 Back     alignment and organism information
>gi|159184755|ref|NP_354432.2| 2-dehydro-3-deoxyphosphooctonate aldolase [Agrobacterium tumefaciens str. C58] Length = 281 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target301 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus L
PRK05198264 PRK05198, PRK05198, 2-dehydro-3-deoxyphosphooctonate al 1e-134
TIGR01362258 TIGR01362, KDO8P_synth, 3-deoxy-8-phosphooctulonate syn 1e-111
PRK12457281 PRK12457, PRK12457, 2-dehydro-3-deoxyphosphooctonate al 2e-78
PLN03033290 PLN03033, PLN03033, 2-dehydro-3-deoxyphosphooctonate al 3e-76
pfam00793271 pfam00793, DAHP_synth_1, DAHP synthetase I family 5e-71
COG2876286 COG2876, AroA, 3-deoxy-D-arabino-heptulosonate 7-phosph 2e-31
PRK13398266 PRK13398, PRK13398, 3-deoxy-7-phosphoheptulonate syntha 5e-31
PRK08673335 PRK08673, PRK08673, 3-deoxy-7-phosphoheptulonate syntha 2e-30
TIGR01361260 TIGR01361, DAHP_synth_Bsub, phospho-2-dehydro-3-deoxyhe 2e-30
PRK13397250 PRK13397, PRK13397, 3-deoxy-7-phosphoheptulonate syntha 3e-24
PRK12595360 PRK12595, PRK12595, bifunctional 3-deoxy-7-phosphoheptu 2e-22
PRK13396352 PRK13396, PRK13396, 3-deoxy-7-phosphoheptulonate syntha 7e-17
COG2877279 COG2877, KdsA, 3-deoxy-D-manno-octulosonic acid (KDO) 8 1e-117
>gnl|CDD|179961 PRK05198, PRK05198, 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>gnl|CDD|130429 TIGR01362, KDO8P_synth, 3-deoxy-8-phosphooctulonate synthase Back     alignment and domain information
>gnl|CDD|171512 PRK12457, PRK12457, 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>gnl|CDD|178601 PLN03033, PLN03033, 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>gnl|CDD|144404 pfam00793, DAHP_synth_1, DAHP synthetase I family Back     alignment and domain information
>gnl|CDD|32703 COG2876, AroA, 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184028 PRK13398, PRK13398, 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>gnl|CDD|181535 PRK08673, PRK08673, 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|162318 TIGR01361, DAHP_synth_Bsub, phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>gnl|CDD|172030 PRK13397, PRK13397, 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>gnl|CDD|183614 PRK12595, PRK12595, bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>gnl|CDD|184027 PRK13396, PRK13396, 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>gnl|CDD|32704 COG2877, KdsA, 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 301 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus L
TIGR01362279 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase; Inter 100.0
PRK12457281 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional 100.0
PRK05198264 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional 100.0
COG2877279 KdsA 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate 100.0
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 100.0
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 100.0
COG2876286 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) 100.0
pfam00793271 DAHP_synth_1 DAHP synthetase I family. Members of this 100.0
PRK12756349 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisiona 99.84
PRK12755352 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisiona 99.84
PRK12822356 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisiona 99.84
PRK09261351 phospho-2-dehydro-3-deoxyheptonate aldolase; Validated 99.84
TIGR00034348 aroFGH phospho-2-dehydro-3-deoxyheptonate aldolase; Int 99.8
COG0722351 AroG 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) 99.72
TIGR03586327 PseI pseudaminic acid synthase. 99.37
TIGR03569329 NeuB_NnaB N-acetylneuraminate synthase. This family is 99.27
COG2089347 SpsE Sialic acid synthase [Cell envelope biogenesis, ou 99.26
pfam04481243 DUF561 Protein of unknown function (DUF561). Protein of 92.99
PRK02621254 consensus 91.97
PRK03220257 consensus 91.95
TIGR01361262 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldo 100.0
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 100.0
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 100.0
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chor 100.0
pfam03599 384 CdhD CO dehydrogenase/acetyl-CoA synthase delta subunit 96.89
pfam03102240 NeuB NeuB family. NeuB is the prokaryotic N-acetylneura 99.37
PRK09427 459 bifunctional indole-3-glycerol phosphate synthase/phosp 95.11
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and D 96.88
COG0673 342 MviM Predicted dehydrogenases and related proteins [Gen 94.78
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 94.76
KOG2741 351 consensus 94.7
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide transport 94.43
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 93.14
PRK07565333 dihydroorotate dehydrogenase 2; Reviewed 90.81
PRK11579 346 putative oxidoreductase; Provisional 90.14
cd00423258 Pterin_binding Pterin binding enzymes. This family incl 96.8
cd00739257 DHPS DHPS subgroup of Pterin binding enzymes. DHPS (dih 96.17
PRK11613282 folP dihydropteroate synthase; Provisional 94.72
PRK09331 386 Sep-tRNA:Cys-tRNA synthetase; Provisional 93.89
pfam05690246 ThiG Thiazole biosynthesis protein ThiG. This family co 93.18
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); an en 92.81
PRK01033253 imidazole glycerol phosphate synthase subunit HisF; Pro 92.34
pfam00218254 IGPS Indole-3-glycerol phosphate synthase. 92.34
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme 92.15
PRK01130222 N-acetylmannosamine-6-phosphate 2-epimerase; Provisiona 92.01
PRK00208256 thiG thiazole synthase; Reviewed 91.98
PRK00278261 trpC indole-3-glycerol-phosphate synthase; Reviewed 90.95
pfam01474437 DAHP_synth_2 Class-II DAHP synthetase family. Members o 96.04
KOG2335358 consensus 95.21
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 94.58
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FM 92.53
cd02911233 arch_FMN Archeal FMN-binding domain. This family of arc 91.75
PRK11840327 bifunctional sulfur carrier protein/thiazole synthase p 90.98
COG3200445 AroG 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) 90.13
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 95.68
pfam09370268 TIM-br_sig_trns TIM-barrel signal transduction protein. 94.6
PRK08318 413 dihydropyrimidine dehydrogenase; Validated 93.97
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-bin 91.99
pfam01207309 Dus Dihydrouridine synthase (Dus). Members of this fami 95.51
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 93.18
cd06452 361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family belongs 93.6
PRK05567486 inositol-5'-monophosphate dehydrogenase; Reviewed 92.03
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 92.4
PRK00694 606 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; V 91.64
>TIGR01362 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase; InterPro: IPR006269 These sequences describe 2-dehydro-3-deoxyphosphooctonate aldolase Back     alignment and domain information
>PRK12457 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>PRK05198 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>COG2877 KdsA 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam00793 DAHP_synth_1 DAHP synthetase I family Back     alignment and domain information
>PRK12756 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisional Back     alignment and domain information
>PRK12755 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisional Back     alignment and domain information
>PRK12822 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisional Back     alignment and domain information
>PRK09261 phospho-2-dehydro-3-deoxyheptonate aldolase; Validated Back     alignment and domain information
>TIGR00034 aroFGH phospho-2-dehydro-3-deoxyheptonate aldolase; InterPro: IPR006219 Members of this group catalyze the first enzymatic reaction of the shikimate pathway Back     alignment and domain information
>COG0722 AroG 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam04481 DUF561 Protein of unknown function (DUF561) Back     alignment and domain information
>PRK02621 consensus Back     alignment and domain information
>PRK03220 consensus Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase; InterPro: IPR006268 These sequences are one of at least three types of phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthase) Back     alignment and domain information
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>pfam03599 CdhD CO dehydrogenase/acetyl-CoA synthase delta subunit Back     alignment and domain information
>pfam03102 NeuB NeuB family Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>pfam01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold Back     alignment and domain information
>KOG2741 consensus Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>cd00423 Pterin_binding Pterin binding enzymes Back     alignment and domain information
>cd00739 DHPS DHPS subgroup of Pterin binding enzymes Back     alignment and domain information
>PRK11613 folP dihydropteroate synthase; Provisional Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>pfam05690 ThiG Thiazole biosynthesis protein ThiG Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>pfam00218 IGPS Indole-3-glycerol phosphate synthase Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>pfam01474 DAHP_synth_2 Class-II DAHP synthetase family Back     alignment and domain information
>KOG2335 consensus Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>COG3200 AroG 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>pfam09370 TIM-br_sig_trns TIM-barrel signal transduction protein Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase; Validated Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>pfam01207 Dus Dihydrouridine synthase (Dus) Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK05567 inositol-5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PRK00694 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target301 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus L
1d9e_A284 Structure Of E. Coli Kdo8p Synthase Length = 284 4e-72
1g7u_A284 Crystal Structures Of Kdo8p Synthase In Its Binary 4e-72
3e9a_A286 Crystal Structure Of 2-Dehydro-3-Deoxyphosphooctona 7e-72
1fwn_A267 Aquifex Aeolicus Kdo8p Synthase In Complex With Pep 3e-70
1t8x_A267 R106g Kdo8ps With Pep And A5p Length = 267 6e-70
2nx3_A267 Structural And Mechanistic Changes Along An Enginee 8e-70
2nxg_A263 Structural And Mechanistic Changes Along An Enginee 8e-70
2nwr_A267 Crystal Structure Of C11n Mutant Of Kdo8p Synthase 3e-69
1lrn_A267 Aquifex Aeolicus Kdo8p Synthase H185g Mutant In Com 5e-69
2ef9_A267 Structural And Mechanistic Changes Along An Enginee 7e-69
3fs2_A298 Crystal Structure Of 2-Dehydro-3-Deoxyphosphooctona 2e-68
2nxi_A263 Structural And Mechanistic Changes Along An Enginee 2e-68
1o60_A292 Crystal Structure Of Kdo-8-Phosphate Synthase Lengt 6e-68
2qkf_A280 Crystal Structure Of 3-Deoxy-D-Manno-Octulosonate 8 4e-66
3qpz_A280 Crystal Structure Of The N59a Mutant Of The 3-Deoxy 3e-65
3fyo_A280 Crystal Structure Of The Triple Mutant (N23cD247EP2 3e-65
3fyp_A280 Crystal Structure Of The Quadruple Mutant (N23cC246 3e-65
3qpy_A280 Crystal Structure Of A Mutant (K57a) Of 3-Deoxy-D-M 4e-65
3qq0_A279 Crystal Structure Of A Deletion Mutant (N59) Of 3-D 5e-64
3qq1_A279 Crystal Structure Of A Double Mutant [a58p, Del(N59 1e-63
1vr6_A350 Crystal Structure Of Phospho-2-Dehydro-3-Deoxyhepto 6e-62
1rzm_A338 Crystal Structure Of 3-Deoxy-D-Arabino-Heptulosonat 6e-62
1zco_A262 Crystal Structure Of Pyrococcus Furiosus 3-Deoxy-D- 8e-56
3pg8_A272 Truncated Form Of 3-Deoxy-D-Arabino-Heptulosonate 7 5e-55
3nvt_A385 1.95 Angstrom Crystal Structure Of A Bifunctional 3 3e-49
1vs1_A276 Crystal Structure Of 3-Deoxy-D-Arabino-Heptulosonat 2e-40
1n8f_A350 Crystal Structure Of E24q Mutant Of Phenylalanine-R 3e-05
1qr7_A350 Crystal Structure Of Phenylalanine-Regulated 3-Deox 4e-05
1og0_B370 Crystal Structure Of The Mutant G226s Of The Tyrosi 2e-04
1hfb_A370 Crystal Structure Of The Tyrosine-Regulated 3-Deoxy 2e-04
gi|8569593|pdb|1D9E|A Chain A, Structure Of E. Coli Kdo8p Synthase Length = 284 Back     alignment and structure
 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 174/280 (62%), Gaps = 6/280 (2%)

Query: 23  HTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKS 82
                + +G     +  +N+  FVL  G   +ES D A  I E    + Q L I  V+K+
Sbjct: 1   MKQKVVSIGD----INVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKA 56

Query: 83  SFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPA 142
           SFDKANRSS+   RG GL++G +IF++LK+ +G  I+TDVH   Q + +AD VD++Q+PA
Sbjct: 57  SFDKANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPA 116

Query: 143 LLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNT 202
            L RQTDL+ A A+TG VINVKK QF+SP +M NI+ K    G + V+ C+RG +FGY+ 
Sbjct: 117 FLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNEKVILCDRGANFGYDN 176

Query: 203 LVTDMRSIPIMTSM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGI 260
           LV DM    IM  +    PVIFD +H++Q     G  SGG R  +  LA+A +A+G+AG+
Sbjct: 177 LVVDMLGFSIMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGL 236

Query: 261 FLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKP 300
           F+E H DP++A  DGP+ + +  L   L Q+ AID ++K 
Sbjct: 237 FIEAHPDPEHAKCDGPSALPLAKLEPFLKQMKAIDDLVKG 276


>gi|14277732|pdb|1G7U|A Chain A, Crystal Structures Of Kdo8p Synthase In Its Binary Complex With Substrate Phosphoenol Pyruvate Length = 284 Back     alignment and structure
>gi|203282532|pdb|3E9A|A Chain A, Crystal Structure Of 2-Dehydro-3-Deoxyphosphooctonate Aldolase From Vibrio Cholerae O1 Biovar Eltor Str. N16961 Length = 286 Back     alignment and structure
gi|14278397|pdb|1FWN|A Chain A, Aquifex Aeolicus Kdo8p Synthase In Complex With Pep Length = 267 Back     alignment and structure
>gi|71041554|pdb|1T8X|A Chain A, R106g Kdo8ps With Pep And A5p Length = 267 Back     alignment and structure
>gi|146386965|pdb|2NX3|A Chain A, Structural And Mechanistic Changes Along An Engineered Path From Metallo To Non-Metallo Kdo8p Synthase Length = 267 Back     alignment and structure
>gi|146386977|pdb|2NXG|A Chain A, Structural And Mechanistic Changes Along An Engineered Path From Metallo To Non-Metallo Kdo8p Synthase. Length = 263 Back     alignment and structure
>gi|146386957|pdb|2NWR|A Chain A, Crystal Structure Of C11n Mutant Of Kdo8p Synthase In Complex With Pep Length = 267 Back     alignment and structure
>gi|27065434|pdb|1LRN|A Chain A, Aquifex Aeolicus Kdo8p Synthase H185g Mutant In Complex With Cadmium Length = 267 Back     alignment and structure
>gi|146386784|pdb|2EF9|A Chain A, Structural And Mechanistic Changes Along An Engineered Path From Metallo To Non-Metallo Kdo8p Synthase Length = 267 Back     alignment and structure
>gi|221046939|pdb|3FS2|A Chain A, Crystal Structure Of 2-Dehydro-3-Deoxyphosphooctonate Aldolase From Bruciella Melitensis At 1.85a Resolution Length = 298 Back     alignment and structure
>gi|157835450|pdb|2NXI|A Chain A, Structural And Mechanistic Changes Along An Engineered Path From Metallo To Non-Metallo Kdo8p Synthase. Length = 263 Back     alignment and structure
>gi|39654294|pdb|1O60|A Chain A, Crystal Structure Of Kdo-8-Phosphate Synthase Length = 292 Back     alignment and structure
gi|193506536|pdb|2QKF|A Chain A, Crystal Structure Of 3-Deoxy-D-Manno-Octulosonate 8- Phosphate Synthase (Kdo8ps) From Neisseria Meningitidis Length = 280 Back     alignment and structure
>gi|328877340|pdb|3QPZ|A Chain A, Crystal Structure Of The N59a Mutant Of The 3-Deoxy-D-Manno- Octulosonate 8-Phosphate Synthase (Kdo8ps) From Neisseria Meningitidis Length = 280 Back     alignment and structure
>gi|225734171|pdb|3FYO|A Chain A, Crystal Structure Of The Triple Mutant (N23cD247EP249A) OF 3-Deoxy-D-Manno-Octulosonate 8-Phosphate Synthase (Kdo8ps) From Neisseria Meningitidis Length = 280 Back     alignment and structure
>gi|226192693|pdb|3FYP|A Chain A, Crystal Structure Of The Quadruple Mutant (N23cC246SD247EP249A) OF 3-Deoxy-D-Manno-Octulosonate 8- Phosphate Synthase (Kdo8ps) From Neisseria Meningitidis Length = 280 Back     alignment and structure
>gi|328877336|pdb|3QPY|A Chain A, Crystal Structure Of A Mutant (K57a) Of 3-Deoxy-D-Manno-Octulosonate 8-Phosphate Synthase (Kdo8ps) From Neisseria Meningitidis Length = 280 Back     alignment and structure
>gi|328877344|pdb|3QQ0|A Chain A, Crystal Structure Of A Deletion Mutant (N59) Of 3-Deoxy-D-Manno- Octulosonate 8-Phosphate Synthase (Kdo8ps) From Neisseria Meningitidis Length = 279 Back     alignment and structure
>gi|328877348|pdb|3QQ1|A Chain A, Crystal Structure Of A Double Mutant [a58p, Del(N59)] Of 3-Deoxy-D- Manno-Octulosonate 8-Phosphate Synthase (Kdo8ps) From Neisseria Meningitidis Length = 279 Back     alignment and structure
>gi|62738137|pdb|1VR6|A Chain A, Crystal Structure Of Phospho-2-Dehydro-3-Deoxyheptonate Aldolase (Dahp Synthase) (Tm0343) From Thermotoga Maritima At 1.92 A Resolution Length = 350 Back     alignment and structure
gi|52695414|pdb|1RZM|A Chain A, Crystal Structure Of 3-Deoxy-D-Arabino-Heptulosonate-7- Phosphate Synthase (Dahps) From Thermotoga Maritima Complexed With Cd2+, Pep And E4p Length = 338 Back     alignment and structure
>gi|82407580|pdb|1ZCO|A Chain A, Crystal Structure Of Pyrococcus Furiosus 3-Deoxy-D-Arabino- Heptulosonate 7-Phosphate Synthase Length = 262 Back     alignment and structure
>gi|320089865|pdb|3PG8|A Chain A, Truncated Form Of 3-Deoxy-D-Arabino-Heptulosonate 7-Phosphate Synthase From Thermotoga Maritima Length = 272 Back     alignment and structure
>gi|301598824|pdb|3NVT|A Chain A, 1.95 Angstrom Crystal Structure Of A Bifunctional 3-Deoxy-7- Phosphoheptulonate SynthaseCHORISMATE MUTASE (AROA) FROM LISTERIA Monocytogenes Egd-E Length = 385 Back     alignment and structure
>gi|109156898|pdb|1VS1|A Chain A, Crystal Structure Of 3-Deoxy-D-Arabino-Heptulosonate-7- Phosphate Synthase (Dahp Synthase) From Aeropyrum Pernix In Complex With Mn2+ And Pep Length = 276 Back     alignment and structure
>gi|30749573|pdb|1N8F|A Chain A, Crystal Structure Of E24q Mutant Of Phenylalanine-Regulated 3-Deoxy-D-Arabino-Heptulosonate-7-Phosphate Synthase (Dahp Synthase) From Escherichia Coli In Complex With Mn2+ And Pep Length = 350 Back     alignment and structure
gi|6137700|pdb|1QR7|A Chain A, Crystal Structure Of Phenylalanine-Regulated 3-Deoxy-D- Arabino-Heptulosonate-7-Phosphate Synthase From Escherichia Coli Complexed With Pb2+ And Pep Length = 350 Back     alignment and structure
>gi|48425113|pdb|1OG0|B Chain B, Crystal Structure Of The Mutant G226s Of The Tyrosine-Regulated 3-Deoxy-D-Arabino-Heptulosonate-7-Phosphate Synthase From Saccharomyces Cerevisiae Complexed With Phenylalanine And Manganese Length = 370 Back     alignment and structure
gi|28373350|pdb|1HFB|A Chain A, Crystal Structure Of The Tyrosine-Regulated 3-Deoxy-D- Arabino-Heptulosonate-7-Phosphate Synthase From Saccharomyces Cerevisiae Complexed With Phosphoenolpyruvate Length = 370 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target301 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus L
3fs2_A298 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, bruc 1e-75
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifu 1e-69
1o60_A292 2-dehydro-3-deoxyphosphooctonate aldolase; structural g 2e-61
2nwr_A267 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KDO8P, 3e-57
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, st 6e-48
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-hep 1e-43
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 ba 2e-37
2qkf_A280 3-deoxy-D-manno-octulosonic acid 8- phosphate synthetas 9e-36
>3fs2_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, bruciellla melitensis, DAHP synthetase I, cytoplasm, lipopolysaccharide biosynthesis; HET: PG4; 1.85A {Brucella melitensis} Length = 298 Back     alignment and structure
 Score =  278 bits (711), Expect = 1e-75
 Identities = 173/285 (60%), Positives = 220/285 (77%), Gaps = 4/285 (1%)

Query: 17  DKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNI 76
               M+  N+ + +G+    VTFSN     LIAGPCQ+E+ DHAF +A +L  +   L I
Sbjct: 18  GPGSMVTANSTVKVGN----VTFSNSAPLALIAGPCQMETRDHAFEMAGRLKEMTDKLGI 73

Query: 77  GLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVD 136
           GLVYKSSFDKANR+SL   RG+GL+K  E+F DLKK+YGFP+LTD+HTE+QC A+A  VD
Sbjct: 74  GLVYKSSFDKANRTSLKAARGIGLEKALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVD 133

Query: 137 ILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGT 196
           +LQIPA LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L K+   G  +VL  ERG 
Sbjct: 134 VLQIPAFLCRQTDLLIAAARTGRVVNVKKGQFLAPWDMKNVLAKITESGNPNVLATERGV 193

Query: 197 SFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIG 256
           SFGYNTLV+DMR++PIM  +G PVIFDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G
Sbjct: 194 SFGYNTLVSDMRALPIMAGLGAPVIFDATHSVQQPGGQGGSTGGQREFVETLARAAVAVG 253

Query: 257 IAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           +AG F+ETH+DPDNAPSDGPNM+ I  +P LL +L+A D+I K L
Sbjct: 254 VAGFFIETHEDPDNAPSDGPNMVPIDKMPALLEKLMAFDRIAKAL 298


>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} Length = 385 Back     alignment and structure
>1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics, transferase; 1.80A {Haemophilus influenzae} SCOP: c.1.10.4 PDB: 3e9a_A Length = 292 Back     alignment and structure
>2nwr_A 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KDO8P, KDO8PS, PEP, A5P, transferase; HET: PEP; 1.50A {Aquifex aeolicus} PDB: 2nws_A* 2nx1_A* 3e0i_A* 1fwn_A* 1fwt_A* 1fws_A* 1fx6_A 1fww_A 1fxq_A* 1fy6_A* 1jcx_A* 1jcy_A* 1pck_A* 1pcw_A* 1fxp_A* 2a21_A* 2a2i_A* 1pe1_A* 3e12_A* 2nx3_A* ... Length = 267 Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for structural genomics, JCSG; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* Length = 350 Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, dahps, DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Length = 262 Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Length = 276 Back     alignment and structure
>2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate synthetase; manno-octulosonate, synthase, lipopolysaccharide, KDOP, KDO8 kdops; 1.75A {Neisseria meningitidis serogroup B} PDB: 3fyo_A* 3fyp_A* 1phw_A* 1g7v_A* 1gg0_A 1phq_A* 1d9e_A* 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A* Length = 280 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target301 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus L
2nwr_A267 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KDO8P, 100.0
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-hep 100.0
3fs2_A298 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, bruc 100.0
1o60_A292 2-dehydro-3-deoxyphosphooctonate aldolase; structural g 100.0
2qkf_A280 3-deoxy-D-manno-octulosonic acid 8- phosphate synthetas 100.0
1n8f_A350 DAHP synthetase; (beta/alpha)8 barrel, metal binding pr 99.84
1of8_A370 Phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-i 99.83
1vli_A385 Spore coat polysaccharide biosynthesis protein SPSE; 26 99.53
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; NEUB 99.46
3g8r_A350 Probable spore coat polysaccharide biosynthesis protein 99.25
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, st 100.0
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifu 100.0
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 ba 100.0
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesis, pt 95.64
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; energy m 94.98
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor 94.38
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resistance, 92.31
2vp8_A318 Dihydropteroate synthase 2; RV1207, transferase, folate 91.28
1tlt_A319 Putative oxidoreductase (virulence factor MVIM homolog) 95.61
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, P 95.6
3euw_A 344 MYO-inositol dehydrogenase; protein structure initiativ 95.24
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, MCSG 95.0
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural genomics 94.76
2nvw_A 479 Galactose/lactose metabolism regulatory protein GAL80; 94.44
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreducta 94.43
1ydw_A 362 AX110P-like protein; structural genomics, protein struc 94.13
3ezy_A 344 Dehydrogenase; structural genomics, unknown function, P 94.08
3oqb_A 383 Oxidoreductase; structural genomics, protein structure 94.07
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; reductive methylat 93.74
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI- 93.7
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural genomic 93.56
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural genomic 93.46
2o4u_X 334 Dimeric dihydrodiol dehydrogenase; NADP-binding rossman 93.14
1zh8_A340 Oxidoreductase; TM0312, structural genomics, joint cent 92.85
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, structural 92.73
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO- 92.42
3ip3_A 337 Oxidoreductase, putative; structural genomics, PSI-2, p 91.94
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural genomic 91.77
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxidoreduc 91.65
3kux_A 352 Putative oxidoreductase; oxidoreductase family, csgid, 91.38
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural genomics 90.87
3btv_A 438 Galactose/lactose metabolism regulatory protein GAL80; 90.71
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural genomic 90.66
1vhn_A318 Putative flavin oxidoreducatase; structural genomics, u 95.54
3kgf_A464 Probable 3-deoxy-D-arabino-heptulosonate 7-phosph synth 95.22
2dqw_A294 Dihydropteroate synthase; dimer, X-RAY diffraction, str 93.96
2h9a_B310 CO dehydrogenase/acetyl-COA synthase, iron- sulfur prot 93.5
3noy_A366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron 92.09
2h9a_A 445 Carbon monoxide dehydrogenase corrinoid/iron- sulfur pr 91.49
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunctiona 93.07
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependent red 91.99
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, tryptophan 91.89
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural genomi 90.56
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrrole, b 91.23
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruvate, p 91.2
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS domains 90.88
>2nwr_A 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KDO8P, KDO8PS, PEP, A5P, transferase; HET: PEP; 1.50A {Aquifex aeolicus} PDB: 2nws_A* 2nx1_A* 3e0i_A* 1fwn_A* 1fwt_A* 1fws_A* 1fx6_A 1fww_A 1fxq_A* 1fy6_A* 1jcx_A* 1jcy_A* 1pck_A* 1pcw_A* 1fxp_A* 2a21_A* 2a2i_A* 1pe1_A* 3e12_A* 2nx3_A* ... Back     alignment and structure
Probab=100.00  E-value=0  Score=672.97  Aligned_cols=257  Identities=48%  Similarity=0.843  Sum_probs=251.2

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEE
Q ss_conf             706999548634999999999999999655339-9706601557688666322245671248889998866528768852
Q gi|254780669|r   43 QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLN-IGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTD  121 (301)
Q Consensus        43 ~~l~iIAGPCsiES~e~~~~~A~~lk~~~~~~~-~~~ifK~sfdKanRtS~~sfrG~Gle~gL~il~e~k~~~glpv~Te  121 (301)
                      ++|++||||||+||+||++++|+.++++++++. ++++||+||||+|||||+||||+|+++||+||+++|++||+||+||
T Consensus         2 ~~~~iIAGPCsvEs~e~~~~~A~~lk~~~~~~~~~~~i~r~~~~K~nRTsp~sf~G~G~e~gL~~l~~ik~~~gl~v~TE   81 (267)
T 2nwr_A            2 EKFLVIAGPNAIESEELLLKVGEEIKRLSEKFKEVEFVFKSSFDKANRSSIHSFRGHGLEYGVKALRKVKEEFGLKITTD   81 (267)
T ss_dssp             CCEEEEEECSBCSCHHHHHHHHHHHHHHHHHCTTEEEEEECBSCCTTCSSTTSCCCSCHHHHHHHHHHHHHHHCCEEEEE
T ss_pred             CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEH
T ss_conf             87549950782049999999999999999860777647525777877898765567878999999999999839843103


Q ss_pred             CCCHHHHHHHHHHCCEEEECHHHCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCH
Q ss_conf             28899998765021578822576289999999850597799836777899999999999972587808995146544401
Q gi|254780669|r  122 VHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYN  201 (301)
Q Consensus       122 V~~~~~~e~~~~~vDilQIgA~~~rqtdLl~a~a~t~kpV~iKkgq~~s~~e~~~a~eki~~~Gn~~i~lcERG~~fgy~  201 (301)
                      ||+++|+|.+++++|+|||||||||||+||+++|+|+|||++|||||+|++||++|+||+.+.||++|++||||++|||+
T Consensus        82 V~~~~~ve~~~e~vDilQIgAr~~~n~~Ll~~~a~t~kpV~lKkg~~~s~~e~~~a~e~i~~~Gn~~v~lceRG~~~~y~  161 (267)
T 2nwr_A           82 IHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAKTGRAVNVKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYN  161 (267)
T ss_dssp             CSSGGGHHHHHTTCSEEEECGGGTTCHHHHHHHHTTTSEEEEECCTTCCGGGGHHHHHHHHHTTCSSEEEEECCEECSSS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCC
T ss_conf             32056688999760098876888059899999986398423334566898888749999996799879995376446764


Q ss_pred             HHCCCCCCCHHHHHHCCCEEECHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHCCCCCCCCCCH
Q ss_conf             00000001068885187168711777421223453212638899999999997189889998369833479782018688
Q gi|254780669|r  202 TLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI  281 (301)
Q Consensus       202 ~lvvD~~~i~~lk~~~~PVi~D~SHs~q~p~~~~~~~gG~r~~v~~la~aa~a~G~dGlfiE~Hp~P~~AlsD~~q~l~l  281 (301)
                      ++++|+|+++.||+.. |||+|||||+|+|++.++.++|+|+|++++|+||+++|+|||||||||||++|||||+|||+|
T Consensus       162 ~l~~d~~~~~~~k~~~-~vi~D~shs~q~p~~~~~~s~G~r~~v~~la~aA~a~G~dGl~iE~H~dP~~AlsD~~q~l~~  240 (267)
T 2nwr_A          162 NLVVDFRSLPIMKQWA-KVIYDATHSVQLPGGLGDKSGGMREFIFPLIRAAVAVGCDGVFMETHPEPEKALSDASTQLPL  240 (267)
T ss_dssp             CEECCTTHHHHHTTTS-EEEEETTGGGCCTTC------CCGGGHHHHHHHHHHHCCSEEEEEEESCGGGCSSCTTTCEEG
T ss_pred             CCCCCHHHHHHHHHCC-CCHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCH
T ss_conf             3243104469987357-520016745568888787310107669999999998399879998379834367860027799


Q ss_pred             HHHHHHHHHHHHHHHHHHC
Q ss_conf             9999999999999998851
Q gi|254780669|r  282 KDLPKLLSQLLAIDKIIKP  300 (301)
Q Consensus       282 ~~l~~ll~~l~~i~~~vk~  300 (301)
                      ++|++|++++++|++++++
T Consensus       241 ~~l~~ll~~l~~i~~~~~k  259 (267)
T 2nwr_A          241 SQLEGIIEAILEIREVASK  259 (267)
T ss_dssp             GGHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999984



>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, dahps, DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>3fs2_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, bruciellla melitensis, DAHP synthetase I, cytoplasm, lipopolysaccharide biosynthesis; HET: PG4; 1.85A {Brucella melitensis} Back     alignment and structure
>1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics, transferase; 1.80A {Haemophilus influenzae} SCOP: c.1.10.4 PDB: 3e9a_A Back     alignment and structure
>2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate synthetase; manno-octulosonate, synthase, lipopolysaccharide, KDOP, KDO8 kdops; 1.75A {Neisseria meningitidis serogroup B} PDB: 3fyo_A* 3fyp_A* 1phw_A 1g7v_A* 1gg0_A 1phq_A* 1d9e_A 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A* Back     alignment and structure
>1n8f_A DAHP synthetase; (beta/alpha)8 barrel, metal binding protein; HET: PEP; 1.75A {Escherichia coli} SCOP: c.1.10.4 PDB: 1gg1_A 1kfl_A* 1qr7_A* Back     alignment and structure
>1of8_A Phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited; beta-alpha-barrel, lyase, synthase, synthetase; HET: PEP G3P; 1.5A {Saccharomyces cerevisiae} SCOP: c.1.10.4 PDB: 1oab_A* 1of6_A* 1hfb_A* 1ofa_A* 1ofb_A 1ofo_A 1ofp_A 1ofq_A 1ofr_A* 1og0_A* Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SPSE; 2636322, structural genomics, JCSG, protein structure initiative, BSU37870, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transferase; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>3g8r_A Probable spore coat polysaccharide biosynthesis protein E; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for structural genomics, JCSG; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, manic, transferase; HET: 680; 1.83A {Bacillus anthracis str} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207, transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM homolog); structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium LT2} Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase family, NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>2ho3_A Oxidoreductase, GFO/IDH/MOCA family; reductive methylation, structural genomics, PSI 2, protein structure initiative; HET: MLY; 2.00A {Streptococcus pneumoniae} PDB: 2ho5_A Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2o4u_X Dimeric dihydrodiol dehydrogenase; NADP-binding rossmann-fold domain, predominantly anti- parallel beta sheet, oxidoreductase; 2.00A {Macaca fascicularis} PDB: 2o48_X 2poq_X* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: MSE NAP; 2.50A {Thermotoga maritima MSB8} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genomics, protein structure initiative, PSI; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center for structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3btu_A Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>3kgf_A Probable 3-deoxy-D-arabino-heptulosonate 7-phosph synthase AROG; DAH7P synthase, shikimate pathwa aromatic biosynthesis; HET: PHE TRP; 2.00A {Mycobacterium tuberculosis} PDB: 2b7o_A* 3nud_A* 3nue_A* 3nv8_A* 2w19_A 2w1a_A* Back     alignment and structure
>2dqw_A Dihydropteroate synthase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.65A {Thermus thermophilus HB8} PDB: 2dza_A* 2dzb_A* Back     alignment and structure
>2h9a_B CO dehydrogenase/acetyl-COA synthase, iron- sulfur protein; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>2h9a_A Carbon monoxide dehydrogenase corrinoid/iron- sulfur protein, gamma subunit; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* Back     alignment and structure