254780670

254780670

phosphopyruvate hydratase

GeneID in NCBI database:8209674Locus tag:CLIBASIA_02785
Protein GI in NCBI database:254780670Protein Accession:YP_003065083.1
Gene range:-(597494, 598768)Protein Length:424aa
Gene description:phosphopyruvate hydratase
COG prediction:[G] Enolase
KEGG prediction:eno; phosphopyruvate hydratase (EC:4.2.1.11); K01689 enolase [EC:4.2.1.11]
SEED prediction:Enolase (EC 4.2.1.11)
Pathway involved in KEGG:Glycolysis / Gluconeogenesis [PATH:las00010]
Methane metabolism [PATH:las00680]
RNA degradation [PATH:las03018]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420----
MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSILIHQ
cEEEEEEEEEEEEcccccEEEEEEEEccccEEEEEccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccccccHHHHcccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEEEHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHccEEEEEcccccccHHHHHHHHHHHcccEEEEEcccEEccHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccccccHHHHccc
cccHEEEEEEEEcccccEEEEEEEEEccccEEEEEccEccccccccccccccccccHHHcccHHHHHHHHcHHHHHHcccEcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcEcccEEcEEEEEcHHHccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHccccccEcccccEccccccccHHHHHHHHHHHHccccEcccEEEEEEccHHHHEccccEEEHHHcEEEcHHHHHHHHHHHHHHccEEEEEcccccccHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHcccccEEEEcHHHHccHHHHHHHHHHHHHHccEEEEEcccEcccccHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHHHHHccccHHHccccc
MFINDIIAREvidsrgsptievdvcledgstgramvpsgastgiheaFELRDQEKRYFGKGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMidldgtpnksrlganAILGVSLAVSKAAaqtsnlplykylggcsahilpvplmnilnggihadnaldfqefmimpvgAENIREAIRMGAEVFHTLKKELKskgystnvgdeggfspnlktaDSALDLIANSIEKAGYNAGKDLLIALDCAASAFFKKEKYILkgenlelqpNEMASYLANLvdqypiysiedgmseddwHGWKILTNKigsncqlvgddlfvtnperlhkGINEEVANAilikpnqigsvsETLNTIEKAQmagypsiishrsgetedhtIADLAVatncgqiktgslarSDRIAKYNQLIRIEESLGKQAKFAGRSILIHQ
mfindiiarevidsrgsptiEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIISHRSGETEDHTIADLAVATNCGqiktgslarsdrIAKYNQLIRIEeslgkqakfagrsilihq
MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSILIHQ
MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSILIH*
MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSILIHQ
MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL*HQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSILIHQ
MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSILIHQ
MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSILIHQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target424 phosphopyruvate hydratase [Candidatus Liberibacter asia
254780486 381 8-amino-7-oxononanoate synthase [Candidatus Liberi 0.040
>gi|254780486|ref|YP_003064899.1| 8-amino-7-oxononanoate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 381 Back     alignment
 Score = 30.8 bits (68), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 320 LHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           + +GIN   A AI I  N I S +E +N   K+   G+P I+
Sbjct: 127 IREGINSGKAQAIAIPHNNINSFAENINKWRKSGGKGFPWIV 168

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target424 phosphopyruvate hydratase [Candidatus Liberibacter asia
315122219424 phosphopyruvate hydratase [Candidatus Liberibacter sola 1 0.0
15888752424 enolase [Agrobacterium tumefaciens str. C58] Length = 4 1 1e-172
307321540424 enolase [Sinorhizobium meliloti AK83] Length = 424 1 1e-171
325292758424 Enolase [Agrobacterium sp. H13-3] Length = 424 1 1e-169
222148554424 phosphopyruvate hydratase [Agrobacterium vitis S4] Leng 1 1e-168
254500543432 phosphopyruvate hydratase [Labrenzia alexandrii DFL-11] 1 1e-167
15965196424 enolase protein [Sinorhizobium meliloti 1021] Length = 1 1e-167
150396293424 phosphopyruvate hydratase [Sinorhizobium medicae WSM419 1 1e-166
227821844424 phosphopyruvate hydratase [Sinorhizobium fredii NGR234] 1 1e-166
307947118424 phosphopyruvate hydratase [Roseibium sp. TrichSKD4] Len 1 1e-165
>gi|315122219|ref|YP_004062708.1| phosphopyruvate hydratase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 424 Back     alignment and organism information
 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/424 (86%), Positives = 398/424 (93%)

Query: 1   MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGK 60
           MFIN+IIAREVIDSRG+PT+EVDV LEDGS+G A+VPSGASTGIHEAFELRD+EKRYFGK
Sbjct: 1   MFINNIIAREVIDSRGNPTVEVDVYLEDGSSGHAIVPSGASTGIHEAFELRDKEKRYFGK 60

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+ FVN+EIR ALLG DAR+QLLID+IMIDLDGTPNKSRLGANAILGVSLAVSKAA
Sbjct: 61  GVLKAVEFVNNEIRAALLGYDARNQLLIDRIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           AQTSNLPLY+Y GGC+AH+LPVPLMNILNGG+HADN LDFQEFMI+PVGAENIREAIRMG
Sbjct: 121 AQTSNLPLYQYWGGCNAHVLPVPLMNILNGGLHADNTLDFQEFMILPVGAENIREAIRMG 180

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFHTLK+ELKS+GYST++GDEGGFSP LKTADSALDLI +SIEKAGY AGKDL IALD
Sbjct: 181 AEVFHTLKQELKSQGYSTDIGDEGGFSPKLKTADSALDLIVHSIEKAGYIAGKDLFIALD 240

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           CAA+ FFK  KYIL+GENLELQPNEM  YLANLV +YPIYSIEDGMSEDDWHGWKILT+K
Sbjct: 241 CAATTFFKDGKYILEGENLELQPNEMVDYLANLVKRYPIYSIEDGMSEDDWHGWKILTDK 300

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           IG++CQLVGDDLFVTNP RLHKGI   +AN+ILIKPNQIGSVSETLNTIEKA MAGYPSI
Sbjct: 301 IGTHCQLVGDDLFVTNPARLHKGIESGIANSILIKPNQIGSVSETLNTIEKAHMAGYPSI 360

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           ISHRSGETEDHTIADLAVATNCGQIK GSLARSDR+AKYNQLIRIEE+LGKQAKFAG SI
Sbjct: 361 ISHRSGETEDHTIADLAVATNCGQIKAGSLARSDRLAKYNQLIRIEENLGKQAKFAGYSI 420

Query: 421 LIHQ 424
           L  Q
Sbjct: 421 LTQQ 424


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15888752|ref|NP_354433.1| enolase [Agrobacterium tumefaciens str. C58] Length = 424 Back     alignment and organism information
>gi|307321540|ref|ZP_07600935.1| enolase [Sinorhizobium meliloti AK83] Length = 424 Back     alignment and organism information
>gi|325292758|ref|YP_004278622.1| Enolase [Agrobacterium sp. H13-3] Length = 424 Back     alignment and organism information
>gi|222148554|ref|YP_002549511.1| phosphopyruvate hydratase [Agrobacterium vitis S4] Length = 424 Back     alignment and organism information
>gi|254500543|ref|ZP_05112694.1| phosphopyruvate hydratase [Labrenzia alexandrii DFL-11] Length = 432 Back     alignment and organism information
>gi|15965196|ref|NP_385549.1| enolase protein [Sinorhizobium meliloti 1021] Length = 424 Back     alignment and organism information
>gi|150396293|ref|YP_001326760.1| phosphopyruvate hydratase [Sinorhizobium medicae WSM419] Length = 424 Back     alignment and organism information
>gi|227821844|ref|YP_002825814.1| phosphopyruvate hydratase [Sinorhizobium fredii NGR234] Length = 424 Back     alignment and organism information
>gi|307947118|ref|ZP_07662453.1| phosphopyruvate hydratase [Roseibium sp. TrichSKD4] Length = 424 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target424 phosphopyruvate hydratase [Candidatus Liberibacter asia
COG0148423 COG0148, Eno, Enolase [Carbohydrate transport and metab 0.0
PRK00077425 PRK00077, eno, enolase; Provisional 0.0
TIGR01060425 TIGR01060, eno, phosphopyruvate hydratase 0.0
PTZ00081439 PTZ00081, PTZ00081, enolase; Provisional 1e-150
PLN00191457 PLN00191, PLN00191, enolase 1e-142
KOG2670433 KOG2670, KOG2670, KOG2670, Enolase [Carbohydrate transp 1e-134
cd03313408 cd03313, enolase, Enolase: Enolases are homodimeric enz 0.0
pfam00113296 pfam00113, Enolase_C, Enolase, C-terminal TIM barrel do 1e-115
pfam03952132 pfam03952, Enolase_N, Enolase, N-terminal domain 3e-62
PRK08350341 PRK08350, PRK08350, hypothetical protein; Provisional 3e-18
cd00308229 cd00308, enolase_like, Enolase-superfamily, characteriz 2e-08
PRK08350341 PRK08350, PRK08350, hypothetical protein; Provisional 8e-06
PTZ00378518 PTZ00378, PTZ00378, hypothetical protein; Provisional 2e-04
cd03316357 cd03316, MR_like, Mandelate racemase (MR)-like subfamil 0.002
COG4948372 COG4948, COG4948, L-alanine-DL-glutamate epimerase and 0.003
>gnl|CDD|30497 COG0148, Eno, Enolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|178845 PRK00077, eno, enolase; Provisional Back     alignment and domain information
>gnl|CDD|162181 TIGR01060, eno, phosphopyruvate hydratase Back     alignment and domain information
>gnl|CDD|173375 PTZ00081, PTZ00081, enolase; Provisional Back     alignment and domain information
>gnl|CDD|177785 PLN00191, PLN00191, enolase Back     alignment and domain information
>gnl|CDD|37881 KOG2670, KOG2670, KOG2670, Enolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|48188 cd03313, enolase, Enolase: Enolases are homodimeric enzymes that catalyse the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways Back     alignment and domain information
>gnl|CDD|109180 pfam00113, Enolase_C, Enolase, C-terminal TIM barrel domain Back     alignment and domain information
>gnl|CDD|146535 pfam03952, Enolase_N, Enolase, N-terminal domain Back     alignment and domain information
>gnl|CDD|169397 PRK08350, PRK08350, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|73188 cd00308, enolase_like, Enolase-superfamily, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion Back     alignment and domain information
>gnl|CDD|169397 PRK08350, PRK08350, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173571 PTZ00378, PTZ00378, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|48191 cd03316, MR_like, Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>gnl|CDD|34556 COG4948, COG4948, L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily [Cell envelope biogenesis, outer membrane / General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 424 phosphopyruvate hydratase [Candidatus Liberibacter asia
TIGR01060430 eno phosphopyruvate hydratase; InterPro: IPR000941 Enol 100.0
PRK00077427 eno phosphopyruvate hydratase; Provisional 100.0
cd03313408 enolase Enolase: Enolases are homodimeric enzymes that 100.0
PTZ00081442 enolase (2-phospho-D-glycerate hydrolase); Provisional 100.0
COG0148423 Eno Enolase [Carbohydrate transport and metabolism] 100.0
KOG2670433 consensus 100.0
PRK08350341 hypothetical protein; Provisional 100.0
cd03314369 MAL Methylaspartate ammonia lyase (3-methylaspartase, M 99.21
pfam00113296 Enolase_C Enolase, C-terminal TIM barrel domain. 100.0
pfam03952132 Enolase_N Enolase, N-terminal domain. 100.0
pfam02746117 MR_MLE_N Mandelate racemase / muconate lactonizing enzy 97.77
pfam05034158 MAAL_N Methylaspartate ammonia-lyase N-terminus. Methyl 95.26
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of the e 99.79
cd03318365 MLE Muconate Lactonizing Enzyme (MLE), an homooctameric 99.75
cd03325352 D-galactonate_dehydratase D-galactonate dehydratase cat 99.7
cd03322361 rpsA The starvation sensing protein RpsA from E.coli an 99.67
cd03329368 MR_like_4 Mandelate racemase (MR)-like subfamily of the 99.65
cd03327341 MR_like_2 Mandelate racemase (MR)-like subfamily of the 99.62
cd03328352 MR_like_3 Mandelate racemase (MR)-like subfamily of the 99.61
cd03321355 mandelate_racemase Mandelate racemase (MR) catalyzes th 99.61
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyze 99.61
cd03317354 NAAAR N-acylamino acid racemase (NAAAR), an octameric e 99.59
COG4948372 L-alanine-DL-glutamate epimerase and related enzymes of 99.58
cd00308229 enolase_like Enolase-superfamily, characterized by the 99.56
cd03324415 rTSbeta_L-fuconate_dehydratase Human rTS beta is encode 99.46
cd03326385 MR_like_1 Mandelate racemase (MR)-like subfamily of the 99.37
cd03323395 D-glucarate_dehydratase D-Glucarate dehydratase (GlucD) 99.33
TIGR01502414 B_methylAsp_ase methylaspartate ammonia-lyase; InterPro 98.86
TIGR01928326 menC_lowGC/arch o-succinylbenzoic acid (OSB) synthetase 98.84
TIGR02534369 mucon_cyclo muconate and chloromuconate cycloisomerases 98.47
COG3799410 Mal Methylaspartate ammonia-lyase [Amino acid transport 98.19
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like subgrou 99.34
cd03320263 OSBS o-Succinylbenzoate synthase (OSBS) catalyzes the c 98.86
PRK02714320 O-succinylbenzoate synthase; Provisional 98.61
TIGR01927336 menC_gamma/gm+ o-succinylbenzoic acid (OSB) synthetase; 95.72
PRK05105326 O-succinylbenzoate synthase; Provisional 98.67
PRK02901327 O-succinylbenzoate synthase; Provisional 95.11
pfam07476249 MAAL_C Methylaspartate ammonia-lyase C-terminus. Methyl 97.97
TIGR03247441 glucar-dehydr glucarate dehydratase. Glucarate dehydrat 97.52
pfam0118898 MR_MLE Mandelate racemase / muconate lactonizing enzyme 94.96
KOG2367 560 consensus 94.67
>TIGR01060 eno phosphopyruvate hydratase; InterPro: IPR000941 Enolase (2-phospho-D-glycerate hydrolase) is an essential glycolytic enzyme that catalyses the interconversion of 2-phosphoglycerate and phosphoenolpyruvate , Back     alignment and domain information
>PRK00077 eno phosphopyruvate hydratase; Provisional Back     alignment and domain information
>cd03313 enolase Enolase: Enolases are homodimeric enzymes that catalyse the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways Back     alignment and domain information
>PTZ00081 enolase (2-phospho-D-glycerate hydrolase); Provisional Back     alignment and domain information
>COG0148 Eno Enolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2670 consensus Back     alignment and domain information
>PRK08350 hypothetical protein; Provisional Back     alignment and domain information
>cd03314 MAL Methylaspartate ammonia lyase (3-methylaspartase, MAL) is a homodimeric enzyme, catalyzing the magnesium-dependent reversible alpha,beta-elimination of ammonia from L-threo-(2S,3S)-3-methylaspartic acid to mesaconic acid Back     alignment and domain information
>pfam00113 Enolase_C Enolase, C-terminal TIM barrel domain Back     alignment and domain information
>pfam03952 Enolase_N Enolase, N-terminal domain Back     alignment and domain information
>pfam02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain Back     alignment and domain information
>pfam05034 MAAL_N Methylaspartate ammonia-lyase N-terminus Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>cd03318 MLE Muconate Lactonizing Enzyme (MLE), an homooctameric enzyme, catalyses the conversion of cis,cis-muconate (CCM) to muconolactone (ML) in the catechol branch of the beta-ketoadipate pathway Back     alignment and domain information
>cd03325 D-galactonate_dehydratase D-galactonate dehydratase catalyses the dehydration of galactonate to 2-keto-3-deoxygalactnate (KDGal), as part of the D-galactonate nonphosphorolytic catabolic Entner-Doudoroff pathway Back     alignment and domain information
>cd03322 rpsA The starvation sensing protein RpsA from E Back     alignment and domain information
>cd03329 MR_like_4 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 4 Back     alignment and domain information
>cd03327 MR_like_2 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 2 Back     alignment and domain information
>cd03328 MR_like_3 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 3 Back     alignment and domain information
>cd03321 mandelate_racemase Mandelate racemase (MR) catalyzes the Mg2+-dependent 1,1-proton transfer reaction that interconverts the enantiomers of mandelic acid Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>cd03317 NAAAR N-acylamino acid racemase (NAAAR), an octameric enzyme that catalyzes the racemization of N-acylamino acids Back     alignment and domain information
>COG4948 L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily [Cell envelope biogenesis, outer membrane / General function prediction only] Back     alignment and domain information
>cd00308 enolase_like Enolase-superfamily, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion Back     alignment and domain information
>cd03324 rTSbeta_L-fuconate_dehydratase Human rTS beta is encoded by the rTS gene which, through alternative RNA splicing, also encodes rTS alpha whose mRNA is complementary to thymidylate synthase mRNA Back     alignment and domain information
>cd03326 MR_like_1 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 1 Back     alignment and domain information
>cd03323 D-glucarate_dehydratase D-Glucarate dehydratase (GlucD) catalyzes the dehydration of both D-glucarate and L-idarate to form 5-keto-4-deoxy-D-glucarate (5-KDG) , the initial reaction of the catabolic pathway for (D)-glucarate Back     alignment and domain information
>TIGR01502 B_methylAsp_ase methylaspartate ammonia-lyase; InterPro: IPR006395 These sequences describe methylaspartate ammonia-lyase, also called beta-methylaspartase Back     alignment and domain information
>TIGR01928 menC_lowGC/arch o-succinylbenzoic acid (OSB) synthetase; InterPro: IPR010197 This entry describes the enzyme o-succinylbenzoic acid synthetase (menC) that is involved in one of the steps of the menaquinone biosynthesis pathway Back     alignment and domain information
>TIGR02534 mucon_cyclo muconate and chloromuconate cycloisomerases; InterPro: IPR013370 This family consists of muconate cycloisomerase (5 Back     alignment and domain information
>COG3799 Mal Methylaspartate ammonia-lyase [Amino acid transport and metabolism] Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>cd03320 OSBS o-Succinylbenzoate synthase (OSBS) catalyzes the conversion of 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate (SHCHC) to 4-(2'-carboxyphenyl)-4-oxobutyrate (o-succinylbenzoate or OSB), a reaction in the menaquinone biosynthetic pathway Back     alignment and domain information
>PRK02714 O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>TIGR01927 menC_gamma/gm+ o-succinylbenzoic acid (OSB) synthetase; InterPro: IPR010196 This entry describes the enzyme o-succinylbenzoic acid synthetase (MenC) that is involved in one of the steps of the menaquinone biosynthesis pathway Back     alignment and domain information
>PRK05105 O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>PRK02901 O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>pfam07476 MAAL_C Methylaspartate ammonia-lyase C-terminus Back     alignment and domain information
>TIGR03247 glucar-dehydr glucarate dehydratase Back     alignment and domain information
>pfam01188 MR_MLE Mandelate racemase / muconate lactonizing enzyme, C-terminal domain Back     alignment and domain information
>KOG2367 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target424 phosphopyruvate hydratase [Candidatus Liberibacter asia
1iyx_A432 Crystal Structure Of Enolase From Enterococcus Hira 1e-143
1te6_A439 Crystal Structure Of Human Neuron Specific Enolase 1e-140
1w6t_A444 Crystal Structure Of Octameric Enolase From Strepto 1e-139
2psn_A434 Crystal Structure Of Enolase1 Length = 434 1e-139
3b97_A433 Crystal Structure Of Human Enolase 1 Length = 433 1e-138
2xsx_A435 Crystal Structure Of Human Beta Enolase Enob Length 1e-137
1e9i_A431 Enolase From E.Coli Length = 431 1e-135
3h8a_A432 Crystal Structure Of E. Coli Enolase Bound To Its C 1e-135
2pa6_A427 Crystal Structure Of Mj0232 From Methanococcus Jann 1e-133
1pdz_A433 X-Ray Structure And Catalytic Mechanism Of Lobster 1e-131
3qn3_A417 Phosphopyruvate Hydratase From Campylobacter Jejuni 1e-128
1oep_A432 Structure Of Trypanosoma Brucei Enolase Reveals The 1e-128
3otr_A452 2.75 Angstrom Crystal Structure Of Enolase 1 From T 1e-128
2ptw_A432 Crystal Structure Of The T. Brucei Enolase Complexe 1e-128
1els_A436 Catalytic Metal Ion Binding In Enolase: The Crystal 1e-123
1ebg_A436 Chelation Of Ser 39 To Mg2+ Latches A Gate At The A 1e-123
1p48_A436 Reverse Protonation Is The Key To General Acid-Base 1e-122
2xh7_A443 Engineering The Enolase Active Site Pocket: Crystal 1e-122
1p43_A436 Reverse Protonation Is The Key To General Acid-Base 1e-122
2al2_B436 Crystal Structure Analysis Of Enolase Mg Subunit Co 1e-122
2al2_A436 Crystal Structure Analysis Of Enolase Mg Subunit Co 1e-122
1l8p_A436 Mg-Phosphonoacetohydroxamate Complex Of S39a Yeast 1e-122
2xh4_A443 Engineering The Enolase Active Site Pocket: Crystal 1e-121
2xgz_A443 Engineering The Enolase Active Site Pocket: Crystal 1e-121
2xh2_A443 Engineering The Enolase Active Site Pocket: Crystal 1e-121
2xh0_A443 Engineering The Enolase Active Site Pocket: Crystal 1e-121
gi|34810921|pdb|1IYX|A Chain A, Crystal Structure Of Enolase From Enterococcus Hirae Length = 432 Back     alignment and structure
 Score =  513 bits (1322), Expect = e-143,   Method: Composition-based stats.
 Identities = 250/426 (58%), Positives = 323/426 (75%), Gaps = 4/426 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I D+ ARE++DSRG+PTIEV+V  E G+ GR MVPSGASTG +EA ELRD +K RY GK
Sbjct: 3   IITDVYAREILDSRGNPTIEVEVYTESGAFGRGMVPSGASTGEYEAVELRDGDKARYGGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV KA+  VN+ I  A++G D RDQ+ IDK MI LDGTPNK +LGANAILGVS+AV++AA
Sbjct: 63  GVTKAVDNVNNIIAEAIIGYDVRDQMAIDKAMIALDGTPNKGKLGANAILGVSIAVARAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    +PLY YLGG +  +LP P+MNI+NGG HADN++DFQEFMIMPVGA   +EA+RMG
Sbjct: 123 ADYLEVPLYHYLGGFNTKVLPTPMMNIINGGSHADNSIDFQEFMIMPVGAPTFKEALRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFH L   LKS+G +T+VGDEGGF+PNL + +   ++I  +IEKAGY  GKD+++A+D
Sbjct: 183 AEVFHALAAILKSRGLATSVGDEGGFAPNLGSNEEGFEVIIEAIEKAGYVPGKDVVLAMD 242

Query: 241 CAASAFFKKEKYIL---KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
            A+S F+ KEK +         E   +EM  +   LV +YPI SIEDG+ E+DW G+K L
Sbjct: 243 AASSEFYDKEKGVYVLADSGEGEKTTDEMIKFYEELVSKYPIISIEDGLDENDWDGFKKL 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T+ +G   QLVGDDLFVTN ++L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY
Sbjct: 303 TDVLGDKVQLVGDDLFVTNTQKLSEGIEKGIANSILIKVNQIGTLTETFEAIEMAKEAGY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +++SHRSGETED TI+D+AVATN GQIKTGSL+R+DRIAKYNQL+RIE+ LG+ A++ G
Sbjct: 363 TAVVSHRSGETEDSTISDIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGEVAEYKG 422

Query: 418 RSILIH 423
                +
Sbjct: 423 LKSFYN 428


>gi|55669906|pdb|1TE6|A Chain A, Crystal Structure Of Human Neuron Specific Enolase At 1.8 Angstrom Length = 439 Back     alignment and structure
>gi|75765317|pdb|1W6T|A Chain A, Crystal Structure Of Octameric Enolase From Streptococcus Pneumoniae Length = 444 Back     alignment and structure
gi|188595822|pdb|2PSN|A Chain A, Crystal Structure Of Enolase1 Length = 434 Back     alignment and structure
>gi|203282367|pdb|3B97|A Chain A, Crystal Structure Of Human Enolase 1 Length = 433 Back     alignment and structure
>gi|311771970|pdb|2XSX|A Chain A, Crystal Structure Of Human Beta Enolase Enob Length = 435 Back     alignment and structure
>gi|16975437|pdb|1E9I|A Chain A, Enolase From E.Coli Length = 431 Back     alignment and structure
gi|294662368|pdb|3H8A|A Chain A, Crystal Structure Of E. Coli Enolase Bound To Its Cognate Rnase E Recognition Domain Length = 432 Back     alignment and structure
gi|158429368|pdb|2PA6|A Chain A, Crystal Structure Of Mj0232 From Methanococcus Jannaschii Length = 427 Back     alignment and structure
>gi|323714708|pdb|3QN3|A Chain A, Phosphopyruvate Hydratase From Campylobacter Jejuni. Length = 417 Back     alignment and structure
>gi|30749888|pdb|1OEP|A Chain A, Structure Of Trypanosoma Brucei Enolase Reveals The Inhibitory Divalent Metal Site Length = 432 Back     alignment and structure
>gi|307568483|pdb|3OTR|A Chain A, 2.75 Angstrom Crystal Structure Of Enolase 1 From Toxoplasma Gondii Length = 452 Back     alignment and structure
>gi|160877726|pdb|2PTW|A Chain A, Crystal Structure Of The T. Brucei Enolase Complexed With Sulphate, Identification Of A Metal Binding Site Iv Length = 432 Back     alignment and structure
>gi|157830958|pdb|1ELS|A Chain A, Catalytic Metal Ion Binding In Enolase: The Crystal Structure Of Enolase-Mn2+-Phosphonoacetohydroxamate Complex At 2.4 Angstroms Resolution Length = 436 Back     alignment and structure
>gi|1065025|pdb|1EBG|A Chain A, Chelation Of Ser 39 To Mg2+ Latches A Gate At The Active Site Of Enolase: Structure Of The Bis(Mg2+) Complex Of Yeast Enolase And The Intermediate Analog Phosphonoacetohydroxamate At 2.1 Angstroms Resolution Length = 436 Back     alignment and structure
>gi|39654417|pdb|1P48|A Chain A, Reverse Protonation Is The Key To General Acid-Base Catalysis In Enolase Length = 436 Back     alignment and structure
>gi|304445691|pdb|2XH7|A Chain A, Engineering The Enolase Active Site Pocket: Crystal Structure Of The D321a Mutant Of Yeast Enolase 1 Length = 443 Back     alignment and structure
>gi|39654415|pdb|1P43|A Chain A, Reverse Protonation Is The Key To General Acid-Base Catalysis In Enolase Length = 436 Back     alignment and structure
>gi|88192082|pdb|2AL2|B Chain B, Crystal Structure Analysis Of Enolase Mg Subunit Complex At Ph 8.0 Length = 436 Back     alignment and structure
>gi|88192081|pdb|2AL2|A Chain A, Crystal Structure Analysis Of Enolase Mg Subunit Complex At Ph 8.0 Length = 436 Back     alignment and structure
>gi|20151217|pdb|1L8P|A Chain A, Mg-Phosphonoacetohydroxamate Complex Of S39a Yeast Enolase 1 Length = 436 Back     alignment and structure
>gi|304445687|pdb|2XH4|A Chain A, Engineering The Enolase Active Site Pocket: Crystal Structure Of The S39a D321a Mutant Of Yeast Enolase 1 Length = 443 Back     alignment and structure
>gi|304445677|pdb|2XGZ|A Chain A, Engineering The Enolase Active Site Pocket: Crystal Structure Of The S39n D321r Mutant Of Yeast Enolase 1 Length = 443 Back     alignment and structure
>gi|304445683|pdb|2XH2|A Chain A, Engineering The Enolase Active Site Pocket: Crystal Structure Of The S39n D321a Mutant Of Yeast Enolase 1 Length = 443 Back     alignment and structure
>gi|304445679|pdb|2XH0|A Chain A, Engineering The Enolase Active Site Pocket: Crystal Structure Of The S39n Q167k D321r Mutant Of Yeast Enolase 1 Length = 443 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target424 phosphopyruvate hydratase [Candidatus Liberibacter asia
3otr_A452 Enolase; structural genomics, center for structural gen 1e-154
2fym_A431 Enolase; RNA degradosome, enolase, lyase; 1.60A {Escher 1e-149
1w6t_A444 Enolase; bacterial infection, surface protein, moonligh 1e-145
2pa6_A427 Enolase; glycolysis, lyase, magnesium, metal-binding, s 1e-139
2al1_A436 Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: PEP 2 1e-137
2akz_A439 Gamma enolase, neural; fluoride inhibition, negative co 1e-136
2ptz_A432 Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypanosoma 1e-131
1kcz_A413 Beta-methylaspartase; beta zigzag, alpha/beta-barrel, l 8e-68
1kko_A413 3-methylaspartate ammonia-lyase; enolase superfamily, T 2e-65
1ec7_A446 Glucarate dehydratase; lyase; 1.90A {Escherichia coli} 9e-25
3mzn_A450 Glucarate dehydratase; lyase, structural genomics, prot 5e-09
3n6h_A455 Mandelate racemase/muconate lactonizing protein; struct 3e-07
3fxg_A455 Rhamnonate dehydratase; structural gemomics, enolase su 1e-06
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D- erythro 2e-05
3p0w_A470 Mandelate racemase/muconate lactonizing protein; struct 1e-04
3ddm_A392 Putative mandelate racemase/muconate lactonizing enzyme 8e-06
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, magne 0.004
>3otr_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel, TIM barrel; 2.75A {Toxoplasma gondii} Length = 452 Back     alignment and structure
 Score =  541 bits (1395), Expect = e-154
 Identities = 218/441 (49%), Positives = 288/441 (65%), Gaps = 25/441 (5%)

Query: 1   MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFG 59
           + I DI+ARE++DSRG+PTIEVDV  E G   RA VPSGASTGI+EA ELRD++  RY G
Sbjct: 2   VVIKDIVAREILDSRGNPTIEVDVSTEGG-VFRAAVPSGASTGIYEALELRDKDPKRYLG 60

Query: 60  KGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMID-LDGTPN-----KSRLGANAILGVS 113
           KGVL A+  V  EI+ ALLG D  DQ  ID +M++ LDGT N     KS+LGANAILGVS
Sbjct: 61  KGVLNAVEIVRQEIKPALLGKDPCDQKGIDMLMVEQLDGTKNEWGYSKSKLGANAILGVS 120

Query: 114 LAVSKAAAQTSNLPLYKYLGGCSAH-----ILPVPLMNILNGGIHADNALDFQEFMIMPV 168
           +A  +A A +  LPLYKY+   +       ++PVP  N++NGG HA N L  QEF+I PV
Sbjct: 121 IACCRAGAASKGLPLYKYIATLAGKTIDKMVMPVPFFNVINGGEHAGNGLALQEFLIAPV 180

Query: 169 GAENIREAIRMGAEVFHTLKKELKSK--GYSTNVGDEGGFSPNLKTADSALDLIANSIEK 226
           GA NIREAIR G+E +H LK  +K+K    +TNVGDEGGF+PN+ TA+ AL+L+  +I+ 
Sbjct: 181 GAPNIREAIRYGSETYHHLKNVIKNKYGLDATNVGDEGGFAPNVATAEEALNLLVEAIKA 240

Query: 227 AGYNAGKDLLIALDCAASAFFKKE--KYILKGENLELQPN------EMASYLANLVDQYP 278
           AGY     + IA D AAS F+K++  KY L  +      +      ++       + +YP
Sbjct: 241 AGYEG--KIKIAFDAAASEFYKQDEKKYDLDYKCKTKNASKHLTGEKLKEVYEGWLKKYP 298

Query: 279 IYSIEDGMSEDDWHGWKILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQ 338
           I S+ED   +DD+  +   T  +G   Q++GDD+ VTN  R+ K + ++  N +L+K NQ
Sbjct: 299 IISVEDPFDQDDFASFSAFTKDVGEKTQVIGDDILVTNILRIEKALKDKACNCLLLKVNQ 358

Query: 339 IGSVSETLNTIEKAQMAGYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAK 398
           IGSV+E +     AQ +G+   +SHRSGETED  IADL V   CGQIK+GS  RS+R+ K
Sbjct: 359 IGSVTEAIEACLLAQKSGWGVQVSHRSGETEDSFIADLVVGLRCGQIKSGSPCRSERLCK 418

Query: 399 YNQLIRIEESLGKQAKFAGRS 419
           YNQL+RIEESLG    +AG S
Sbjct: 419 YNQLMRIEESLGADCVYAGES 439


>2fym_A Enolase; RNA degradosome, enolase, lyase; 1.60A {Escherichia coli} SCOP: c.1.11.1 d.54.1.1 PDB: 1e9i_A Length = 431 Back     alignment and structure
>1w6t_A Enolase; bacterial infection, surface protein, moonlighting protein, glycolysis, phosphopyruvate hydratase, lyase; HET: 2PE; 2.10A {Streptococcus pneumoniae} SCOP: c.1.11.1 d.54.1.1 PDB: 1iyx_A Length = 444 Back     alignment and structure
>2pa6_A Enolase; glycolysis, lyase, magnesium, metal-binding, structural genomics, NPPSFA; 1.85A {Methanocaldococcus jannaschii} Length = 427 Back     alignment and structure
>2al1_A Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: PEP 2PG; 1.50A {Saccharomyces cerevisiae} SCOP: c.1.11.1 d.54.1.1 PDB: 1ebg_A 1ebh_A* 1one_A* 2one_A* 1p48_A* 1p43_A* 1l8p_A 4enl_A 1nel_A 1els_A 3enl_A 5enl_A* 6enl_A 7enl_A* 2al2_A* 2al2_B* Length = 436 Back     alignment and structure
>2akz_A Gamma enolase, neural; fluoride inhibition, negative cooperativity, glycolysis, , isothermal titration calorimetry, lyase; 1.36A {Homo sapiens} SCOP: c.1.11.1 d.54.1.1 PDB: 2akm_A 1te6_A 2psn_A 3b97_A 1pdz_A 1pdy_A Length = 439 Back     alignment and structure
>2ptz_A Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypanosoma brucei} SCOP: c.1.11.1 d.54.1.1 PDB: 2ptx_A 2pty_A* 2ptw_A 2pu0_A 2pu1_A* 1oep_A Length = 432 Back     alignment and structure
>1kcz_A Beta-methylaspartase; beta zigzag, alpha/beta-barrel, lyase; 1.90A {Clostridium tetanomorphum} SCOP: c.1.11.2 d.54.1.1 PDB: 1kd0_A* Length = 413 Back     alignment and structure
>1kko_A 3-methylaspartate ammonia-lyase; enolase superfamily, TIM barrel; 1.33A {Citrobacter amalonaticus} SCOP: c.1.11.2 d.54.1.1 PDB: 1kkr_A* Length = 413 Back     alignment and structure
>1ec7_A Glucarate dehydratase; lyase; 1.90A {Escherichia coli} SCOP: c.1.11.2 d.54.1.1 PDB: 1ec8_A* 1ec9_A* 1ecq_A* 1jdf_A* 1jct_A* 1bqg_A Length = 446 Back     alignment and structure
>3mzn_A Glucarate dehydratase; lyase, structural genomics, protein structure initiative, PS nysgrc; 1.85A {Chromohalobacter salexigens} PDB: 3nfu_A Length = 450 Back     alignment and structure
>3n6h_A Mandelate racemase/muconate lactonizing protein; structural genomics, protein structure initiative; 2.30A {Actinobacillus succinogenes} PDB: 3n6j_A Length = 455 Back     alignment and structure
>3fxg_A Rhamnonate dehydratase; structural gemomics, enolase superfamily, NYSGXRC, target 9265J, lyase, structural genomics, PSI-2; 1.90A {Gibberella zeae ph-1} PDB: 2p0i_A Length = 455 Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D- erythromohydroxamate, unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Length = 441 Back     alignment and structure
>3p0w_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, protein structure initiative; HET: GKR; 1.71A {Ralstonia pickettii} PDB: 3nxl_A Length = 470 Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Length = 392 Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Length = 359 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target424 phosphopyruvate hydratase [Candidatus Liberibacter asia
1w6t_A444 Enolase; bacterial infection, surface protein, moonligh 100.0
2fym_A431 Enolase; RNA degradosome, enolase, lyase; 1.60A {Escher 100.0
2ptz_A432 Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypanosoma 100.0
2pa6_A427 Enolase; glycolysis, lyase, magnesium, metal-binding, s 100.0
3otr_A452 Enolase; structural genomics, center for structural gen 100.0
2akz_A439 Gamma enolase, neural; fluoride inhibition, negative co 100.0
2al1_A436 Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: PEP 2 100.0
1kcz_A413 Beta-methylaspartase; beta zigzag, alpha/beta-barrel, l 100.0
1kko_A413 3-methylaspartate ammonia-lyase; enolase superfamily, T 100.0
3dip_A410 Enolase; structural genomics, isomerase, PSI-2, protein 99.9
2qjj_A402 Mandelate racemase/muconate lactonizing enzyme; mannona 99.86
2pod_A410 Mandelate racemase / muconate lactonizing enzyme; enola 99.86
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, stru 99.85
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, MR.G 99.83
2o56_A407 Putative mandelate racemase; dehydratase, structural ge 99.83
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octamer, 99.82
2poz_A392 Putative dehydratase; octamer, structural genomics, PSI 99.81
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSGXRC, 99.81
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzyme, m 99.81
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; 99.81
3gy1_A408 Mandelate racemase/muconate lactonizing protein; struct 99.8
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenation; 99.8
3bsm_A413 Mandelate racemase/muconate lactonizing enzyme; structu 99.79
3mwc_A400 Mandelate racemase/muconate lactonizing protein; enolas 99.79
3go2_A409 Putative L-alanine-DL-glutamate epimerase; structural g 99.78
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eutroph 99.78
3i6e_A385 Muconate cycloisomerase I; structural GENOMICS,NYSGXRC, 99.78
3jva_A354 Dipeptide epimerase; enolase superfamily, isomerase; 1. 99.76
2gl5_A410 Putative dehydratase protein; structural genomics, prot 99.76
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzyme, m 99.75
1tkk_A366 Similar to chloromuconate cycloisomerase; epimerase, en 99.75
3n4e_A393 Mandelate racemase/muconate lactonizing enzyme, C domai 99.74
3i4k_A383 Muconate lactonizing enzyme; structural genomics, NYSGX 99.73
2oqh_A385 Putative isomerase; PSI-II, PSI-2, NYSGXRC, enolase, TI 99.73
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NYSGXRC 99.73
3my9_A377 Muconate cycloisomerase; structural genomics, PSI-2, pr 99.73
2qde_A397 Mandelate racemase/muconate lactonizing enzyme family p 99.73
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzyme (M 99.73
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D- erythro 99.72
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; enolase 99.71
3ekg_A404 Mandelate racemase/muconate lactonizing enzyme; structu 99.71
2ppg_A399 Putative isomerase; structural genomics, PSI-2, protein 99.71
3mqt_A394 Mandelate racemase/muconate lactonizing protein; PSI-II 99.71
2qgy_A391 Enolase from the environmental genome shotgun sequencin 99.7
3ik4_A365 Mandelate racemase/muconate lactonizing protein; struct 99.7
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme family p 99.7
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, structu gen 99.69
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- like pr 99.69
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: NPG; 99.69
2pp0_A398 L-talarate/galactarate dehydratase; enolase superfamily 99.68
3mzn_A450 Glucarate dehydratase; lyase, structural genomics, prot 99.68
3fxg_A455 Rhamnonate dehydratase; structural gemomics, enolase su 99.68
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzyme, T 99.68
3no1_A398 Isomerase, mandelate racemase/muconate lactonizing enzy 99.67
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deinococcu 99.66
3h12_A397 Mandelate racemase; structural genomics, protein struct 99.66
2ovl_A371 Putative racemase; structural genomics, PSI-2, protein 99.66
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, magne 99.65
3cyj_A372 Mandelate racemase/muconate lactonizing enzyme- like pr 99.65
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, st 99.65
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; structu 99.64
3n6h_A455 Mandelate racemase/muconate lactonizing protein; struct 99.64
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha-barr 99.62
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/enolase 99.61
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; enolase 99.61
2p3z_A415 L-rhamnonate dehydratase; enolase, structural genomics, 99.6
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, putativ 99.58
2ps2_A371 Putative mandelate racemase/muconate lactonizing enzyme 99.58
2oz8_A389 MLL7089 protein; structural genomics, unknown function, 99.58
3ddm_A392 Putative mandelate racemase/muconate lactonizing enzyme 99.55
3eez_A378 Putative mandelate racemase/muconate lactonizing enzyme 99.54
1ec7_A446 Glucarate dehydratase; lyase; 1.90A {Escherichia coli} 99.53
3n4f_A392 Mandelate racemase/muconate lactonizing protein; struct 99.51
3p0w_A470 Mandelate racemase/muconate lactonizing protein; struct 99.5
2pge_A377 MENC; OSBS, NYSGXRC, PSI-II, structural genomics, prote 99.47
2pmq_A377 Mandelate racemase/muconate lactonizing enzyme; structu 99.46
1jpd_X324 L-Ala-D/L-Glu epimerase; enolase superfamily, muconate 99.43
1tzz_A392 Hypothetical protein L1841; structural genomics, mandel 99.41
2okt_A342 OSB synthetase, O-succinylbenzoic acid synthetase; enol 99.32
3ijl_A338 Muconate cycloisomerase; enolase superfamily, dipeptide 99.24
3caw_A330 O-succinylbenzoate synthase; structural genomics, PSI-2 98.56
2ozt_A332 TLR1174 protein; structural genomics, O-succinylbenzoat 99.06
1r6w_A322 OSB synthase, O-succinylbenzoate synthase, OSBS; enolas 98.27
2opj_A327 O-succinylbenzoate-COA synthase; TIM barrel, structural 98.06
1wuf_A393 Hypothetical protein LIN2664; structural genomics, unkn 97.17
1wue_A386 Mandelate racemase/muconate lactonizing enzyme family p 95.04
>1w6t_A Enolase; bacterial infection, surface protein, moonlighting protein, glycolysis, phosphopyruvate hydratase, lyase; HET: 2PE; 2.10A {Streptococcus pneumoniae} SCOP: c.1.11.1 d.54.1.1 PDB: 1iyx_A Back     alignment and structure
Probab=100.00  E-value=0  Score=1242.71  Aligned_cols=423  Identities=57%  Similarity=0.939  Sum_probs=415.1

Q ss_pred             CE-EEEEEEEEEEECCCCCEEEEEEEECCCCEEEEECCCCCCCCCCEEEEECCCC-CCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             91-0589986886079784299999984897676634478664775467626898-651680489999999875678975
Q gi|254780670|r    1 MF-INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKGVLKAIAFVNDEIRTALL   78 (424)
Q Consensus         1 m~-I~~i~~r~IlDSRG~PTvEvev~~~~g~~gra~~PSGaStG~~Ea~elrD~~-~~~~G~gV~~Av~~in~~i~~~L~   78 (424)
                      |. |++|++||||||||||||||||+|++|.+||++||||||||+|||+||||++ ++|+||||.+||++||++|+|+|+
T Consensus        11 M~~I~~i~ar~IlDSRG~PTVEvev~~~~g~~gra~~PSGAStG~~EA~elrD~~~~ry~GkgV~~Av~~in~~I~~~Li   90 (444)
T 1w6t_A           11 MSIITDVYAREVLDSRGNPTLEVEVYTESGAFGRGMVPSGASTGEHEAVELRDGDKSRYGGLGTQKAVDNVNNIIAEAII   90 (444)
T ss_dssp             TTBEEEEEEEEEECTTSCEEEEEEEEETTCCEEEEECCCC---CCSSCCCCCCCCTTSGGGTCCHHHHHHHHHTHHHHHT
T ss_pred             CCCCCEEEEEEEECCCCCEEEEEEEEECCCCEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             76513689999987999805999999899988999733787888765201147983103685599999999999899986


Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHCCCCCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             98855789888646530366432212322220244899875266349848882253245647543000003664556776
Q gi|254780670|r   79 GCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNAL  158 (424)
Q Consensus        79 g~~~~dQ~~iD~~Li~lDgT~nks~lGaNailAvSlA~akA~A~~~~~pLy~yl~~~~~~~lP~P~~NiinGG~HA~~~l  158 (424)
                      |+++.||.+||++|++||||+||+++|||+++|||||+|||+|+.+++|||+|+++...+.||+||+||||||+||+|++
T Consensus        91 G~~~~dQ~~ID~~LielDgT~nks~lGaNailAvSlA~a~AaA~~~~~pLy~yl~~~~~~~lP~P~~NIinGG~HA~n~l  170 (444)
T 1w6t_A           91 GYDVRDQQAIDRAMIALDGTPNKGKLGANAILGVSIAVARAAADYLEIPLYSYLGGFNTKVLPTPMMNIINGGSHSDAPI  170 (444)
T ss_dssp             TSBTTCHHHHHHHHHHHHCSTTCTTTCHHHHHHHHHHHHHHHHHHHTSCHHHHHHCTTCCEECEECEEEEECGGGCSSSC
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHCCCCCCCCCCCCEEEEECCCCCCCCCC
T ss_conf             99867688877999973599431125630367889999999886349875332068776548854489723613367665


Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCHHHH
Q ss_conf             61025651488774899989999999999987520000136765576448868468999999999975385311102343
Q gi|254780670|r  159 DFQEFMIMPVGAENIREAIRMGAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIA  238 (424)
Q Consensus       159 ~iQEfmIiP~g~~sf~eal~~~~ev~~~lk~~L~~~g~~t~vgDEGGfap~~~~~eeaL~ll~eAi~~aGy~~g~di~i~  238 (424)
                      |||||||+|.++.||+|+|+|++||||+||++|++++++|+|||||||+|++++++++|++|.+||+++||+||+||+||
T Consensus       171 diQEfmIiP~ga~sf~eal~~~~eV~~~lk~~L~~~g~~t~vgDEGGfaP~~~s~eeaL~li~eAI~~aGy~~G~di~ia  250 (444)
T 1w6t_A          171 AFQEFMILPVGAPTFKEALRYGAEIFHALKKILKSRGLETAVGDEGGFAPRFEGTEDGVETILAAIEAAGYVPGKDVFLG  250 (444)
T ss_dssp             CCSEEEEECTTCSSHHHHHHHHHHHHHHHHHHHHHTTCCCCBCTTSCBCCCCSSHHHHHHHHHHHHHHTTCCBTTTBEEE
T ss_pred             CHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEE
T ss_conf             64566328999998899999899999999999985699876487868599999989999999999998288878716886


Q ss_pred             HCHHHHHHCCCCCEEECC------CCCCCCHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHHHHHCCCCEEEECCCE
Q ss_conf             110465320278511114------68656878999999987654486997767631042379988642388368504300
Q gi|254780670|r  239 LDCAASAFFKKEKYILKG------ENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIGSNCQLVGDDL  312 (424)
Q Consensus       239 lD~AAsefy~~~kY~~~~------~~~~~t~~elid~y~~l~~~yPI~sIEDP~~e~D~~gw~~l~~~~g~~~~IvGDDL  312 (424)
                      |||||||||+++||.|.+      .+..+|++||+|||.+|+++|||+||||||+|+||+||++||+++|++||||||||
T Consensus       251 lD~AAsefy~~~k~~y~~~~~~~~~~~~~s~~elid~y~~l~~~yPIisIEDp~~e~D~~gw~~lt~~lg~~~~ivGDDL  330 (444)
T 1w6t_A          251 FDCASSEFYDKERKVYDYTKFEGEGAAVRTSAEQIDYLEELVNKYPIITIEDGMDENDWDGWKALTERLGKKVQLVGDDF  330 (444)
T ss_dssp             EECCGGGGBC--CCCEETHHHHCTTCCEECHHHHHHHHHHHHHHSCEEEEESCSCTTCHHHHHHHHHHHTTTSEEEESTT
T ss_pred             ECHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCCCCCCCHHHHHHHHHCCEEEEECCCC
T ss_conf             20426766426775110322367875402899999999999966887799768874340249999998588058866611


Q ss_pred             EECCHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHCCCHHEECCCCH
Q ss_conf             00214888521003865223425453003899999999999879869995078887235899899981998010075611
Q gi|254780670|r  313 FVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLAR  392 (424)
Q Consensus       313 ~vTn~~rl~~gi~~~~~NailiK~NQiGTvset~ea~~~a~~~g~~~ivShRSGETeD~~iaDLAVg~~a~~iK~G~~~R  392 (424)
                      ||||++||++||++++||++|||||||||||||+|++++|+++||.+|||||||||||+||||||||+||+|||+|+|+|
T Consensus       331 ~vTn~~rl~~gi~~~~~nailiK~NQiGTvset~eai~la~~~g~~~ivShRSGETeD~~iaDLAVg~ga~~iK~G~~~R  410 (444)
T 1w6t_A          331 FVTNTDYLARGIQEGAANSILIKVNQIGTLTETFEAIEMAKEAGYTAVVSHRSGETEDSTIADIAVATNAGQIKTGSLSR  410 (444)
T ss_dssp             TTTCHHHHHHHHHHTCCSEEEECHHHHCSHHHHHHHHHHHHHTTCEEEEECCSSCCSCCHHHHHHHHTTCCEEECCCSSS
T ss_pred             CCCCCHHHHHCCCCCCCHHHHCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCHHHHHHHHHCCCEEEECCCCC
T ss_conf             13571376601133554264023323222999999999999869879997898876510599999870898033079851


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCHHHHCC
Q ss_conf             4489999999999998311045576253047
Q gi|254780670|r  393 SDRIAKYNQLIRIEESLGKQAKFAGRSILIH  423 (424)
Q Consensus       393 ~ER~aKyNrLlrIee~Lg~~a~~~g~~~~~~  423 (424)
                      |||++||||||||||+||++++|+|+++|.+
T Consensus       411 ~ER~aKyNrLlrIee~L~~~~~~~g~~~f~~  441 (444)
T 1w6t_A          411 TDRIAKYNQLLRIEDQLGEVAEYRGLKSFYN  441 (444)
T ss_dssp             HHHHHHHHHHHHHHHHHGGGCEECGGGGCTT
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEECCHHHHCC
T ss_conf             7889999999999998563547576556236



>2fym_A Enolase; RNA degradosome, enolase, lyase; 1.60A {Escherichia coli} SCOP: c.1.11.1 d.54.1.1 PDB: 1e9i_A 3h8a_A Back     alignment and structure
>2ptz_A Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypanosoma brucei} SCOP: c.1.11.1 d.54.1.1 PDB: 2ptx_A 2pty_A* 2ptw_A 2pu0_A 2pu1_A* 1oep_A Back     alignment and structure
>2pa6_A Enolase; glycolysis, lyase, magnesium, metal-binding, structural genomics, NPPSFA; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>3otr_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel, TIM barrel; 2.75A {Toxoplasma gondii} Back     alignment and structure
>2akz_A Gamma enolase, neural; fluoride inhibition, negative cooperativity, glycolysis, , isothermal titration calorimetry, lyase; 1.36A {Homo sapiens} SCOP: c.1.11.1 d.54.1.1 PDB: 2akm_A 1te6_A 2psn_A 3b97_A 2xsx_A 1pdz_A 1pdy_A Back     alignment and structure
>2al1_A Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: PEP 2PG; 1.50A {Saccharomyces cerevisiae} SCOP: c.1.11.1 d.54.1.1 PDB: 1ebg_A 1ebh_A* 1one_A* 2one_A* 1p48_A* 1p43_A* 1l8p_A 4enl_A 1nel_A 1els_A 3enl_A 5enl_A* 6enl_A 7enl_A* 2al2_A* 2al2_B* 2xh7_A* 2xgz_A* 2xh2_A* 2xh4_A* ... Back     alignment and structure
>1kcz_A Beta-methylaspartase; beta zigzag, alpha/beta-barrel, lyase; 1.90A {Clostridium tetanomorphum} SCOP: c.1.11.2 d.54.1.1 PDB: 1kd0_A* Back     alignment and structure
>1kko_A 3-methylaspartate ammonia-lyase; enolase superfamily, TIM barrel; 1.33A {Citrobacter amalonaticus} SCOP: c.1.11.2 d.54.1.1 PDB: 1kkr_A* Back     alignment and structure