254780673

254780673

pyruvate dehydrogenase subunit beta

GeneID in NCBI database:8209677Locus tag:CLIBASIA_02800
Protein GI in NCBI database:254780673Protein Accession:YP_003065086.1
Gene range:-(594446, 595849)Protein Length:467aa
Gene description:pyruvate dehydrogenase subunit beta
COG prediction:none
KEGG prediction:pyruvate dehydrogenase subunit beta (EC:1.2.4.1); K00162 pyruvate dehydrogenase E1 component subunit beta [EC:1.2.4.1]
SEED prediction:Pyruvate dehydrogenase E1 component beta subunit (EC 1.2.4.1)
Pathway involved in KEGG:Glycolysis / Gluconeogenesis [PATH:las00010]
Citrate cycle (TCA cycle) [PATH:las00020]
Pyruvate metabolism [PATH:las00620]
Butanoate metabolism [PATH:las00650]
Valine, leucine and isoleucine biosynthesis [PATH:las00290]
Subsystem involved in SEED:Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------
MPILVTMPSLSPTMTEGNIAKWKKNEGDLIKQGDIIYEVETDKAVMEVESIDEGILGKILCPNGTKNVKVNTPIAAILQEGETALDIDKMLLEKPDVAISPSSKNTTLVFSNEDNDKVDHQKSKNDIQDSSFAHAPTSSITVREALRDAIAEEMRRDKDVFIMGEEVAEYQGAYKVTQGLLQEFGCERVIDTPITEHGFAGIGIGASFAGLKPIVEFMTFNFAMQAIDQIINSAAKTRYMSGGQITTSIVFRGPNGAAARVAAQHSQCYAAWYSHVPGLKVVIPYTASDAKGLLKAAIRDPNPVIFLENEILYGSSFEVPMVDDLVIPIGRARIHRQGSDVTIISFGIGMTYATKAAIELEKNGIDAELIDLRTIRPMDWQTIFESVKKTGRLVTVEEGYPQSSVGSTIANQVQRKVFDYLDAPILTITGRDVPMPYAANLEKLALPNVDEIIESVESICYKRKAKS
ccEEEEccccccccEEEEEEEEEcccccEEccccEEEEEEccEEEEEEEcccccEEEEEEEcccccccccccEEEEEEccccccccccccccccccHHHHccccHHcccccccccHHHHHHHHHccccccccccccccccccHHHcccHHHHHHHcccccEEccccccccccccHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccccccccHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHccccEEEEEcHHHcccccccccccccEEEcccEEEEEccccEEEEEccHHHHHHHHHHHHHHHccccEEEEEcHHcccccHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHccccHHHHHHHHHHHHHHHcccc
ccHHEEccccccccccccHHHHHHHcccccccccEEEEEEccccEEEEEEcccccEEEEEcccccccccccccEEEEEcccccHHHHHHHcHHHcccccccccccHHHcccccccccccHccccccccccccccccHHHEcHHHHHHHHHHHHHHccccEEEEcHHHHHccccEEEcHHHHHHHccccEEcccccHcccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccHHccccccccHHHHHHcccccEEEccccHHHHHHHHHHHHHccccEEEEccHHHcccccccccccccEEEcccEEEEEccccEEEEEHHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHccccHHHHHHHHHHHHHHHHccc
mpilvtmpslsptmtegnIAKWKknegdlikqgdiiyevetdkavmevesidegilgkilcpngtknvkvnTPIAAILQEGETALDIDKMllekpdvaispssknttlvfsnedndkvdhqkskndiqdssfahaptssITVREALRDAIAEEMRRDKDVFIMGEEVAEYQGAYKVTQGLLqefgcervidtpitehgfagigigasfagLKPIVEFMTFNFAMQAIDQIINSAAKtrymsggqittsivfrgpngAAARVAAQHSQCYAAwyshvpglkvvIPYTASDAKGLLKAairdpnpvifleneilygssfevpmvddlvipigrarihrqgsdvtIISFGIGMTYATKAAIELEKNGidaelidlrtirpmDWQTIFESVKKTGRLvtveegypqssvgstIANQVQRKVfdyldapiltitgrdvpmpyaANLEKLALPNVDEIIESVESICYKRKAKS
mpilvtmpslsptmtegNIAKWKKNEGDLIKQGDIIYEVETDKAVMEVESIDEGILGKILCPNGTKNVKVNTPIAAILQEGETALDIDKMLLEKpdvaispssknttlvFSNEDNDKVDHQKskndiqdssfahaptssitvREALRDAIAEEMRRDKDVFIMGEEVAEYQGAYKVTQGLLQEFGCERVIDTPITEHGFAGIGIGASFAGLKPIVEFMTFNFAMQAIDQIINSAAKTRYMSGGQITTSIVFRGPNGAAARVAAQHSQCYAAWYSHVPGLKVVIPYTASDAKGLLKAAIRDPNPVIFLENEILYGSSFEVPMVDDLVIPIGrarihrqgsdVTIISFGIGMTYATKAAIELEKNGIDAELIDLRTIRPMDWQTIFESVKKTGRLVTVEegypqssvgstianqVQRKVFDYLDAPILTITGRDVPMPYAANLEKLALPNVDEIIESVesicykrkaks
MPILVTMPSLSPTMTEGNIAKWKKNEGDLIKQGDIIYEVETDKAVMEVESIDEGILGKILCPNGTKNVKVNTPIAAILQEGETALDIDKMLLEKPDVAISPSSKNTTLVFSNEDNDKVDHQKSKNDIQDSSFAHAPTSSITVREALRDAIAEEMRRDKDVFIMGEEVAEYQGAYKVTQGLLQEFGCERVIDTPITEHgfagigigasfagLKPIVEFMTFNFAMQAIDQIINSAAKTRYMSGGQITTSIVFRGPNGAAARVAAQHSQCYAAWYSHVPGLKVVIPYTASDAKGLLKAAIRDPNPVIFLENEILYGSSFEVPMVDDLVIPIGRARIHRQGSDVTIISFGIGMTYATKAAIELEKNGIDAELIDLRTIRPMDWQTIFESVKKTGRLVTVEEGYPQSSVGSTIANQVQRKVFDYLDAPILTITGRDVPMPYAANLEKLALPNVDEIIESVESICYKRKAKS
*PILVTMPSLSPTMTEGNIAKWKKNEGDLIKQGDIIYEVETDKAVMEVESIDEGILGKILCPNGTKNVKVNTPIAAILQEG**********************************************************ITVREALRDAIAEEMRRDKDVFIMGEEVAEYQGAYKVTQGLLQEFGCERVIDTPITEHGFAGIGIGASFAGLKPIVEFMTFNFAMQAIDQIINSAAKTRYMSGGQITTSIVFRGPNGAAARVAAQHSQCYAAWYSHVPGLKVVIPYTASDAKGLLKAAIRDPNPVIFLENEILYGSSFEVPMVDDLVIPIGRARIHRQGSDVTIISFGIGMTYATKAAIELEKNGIDAELIDLRTIRPMDWQTIFESVKKTGRLVTVEEGYPQSSVGSTIANQVQRKVFDYLDAPILTITGRDVPMPYAANLEKLALPNVDEIIESVESI*YK*****
MPILVTMPSLSPTMTEGNIAKWKKNEGDLIKQGDIIYEVETDKAVMEVESIDEGILGKILCPNGTKNVKVNTPIAAILQEGETALDIDKMLLEKPDVAISPSSKNTTLVFSNEDNDKVDHQKSKNDIQDSSFAHAPTSSITVREALRDAIAEEMRRDKDVFIMGEEVAEYQGAYKVTQGLLQEFGCERVIDTPITEHGFAGIGIGASFAGLKPIVEFMTFNFAMQAIDQIINSAAKTRYMSGGQITTSIVFRGPN*********HSQCYAAWYSHVPGLKVVIPYTASDAKGLLKAAIRDPNPVIFLENEILYGSSFEVPMVDDLVIPIGRARIHRQGSDVTIISFGIGMTYATKAAIELEKNGIDAELIDLRTIRPMDWQTIFESVKKTGRLVTVEEGYPQSSVGSTIANQVQRKVFDYLDAPILTITGRDVPMPYAANLEKLALPNVDEIIESVESICYKRKAKS
*PILVTMPSLSPTMTEGNIAKWKKNEGDLIKQGDIIYEVETDKAVMEVESIDEGILGKILCPNGTKNVKVNTPIAAILQEGETALDIDKMLLEKP********************************QDSSFAHAPTSSITVREALRDAIAEEMRRDKDVFIMGEEVAEYQGAYKVTQGLLQEFGCERVIDTPITEHGFAGIGIGASFAGLKPIVEFMTFNFAMQAIDQIINSAAKTRYMSGGQITTSIVFRGPNGAAARVAAQHSQCYAAWYSHVPGLKVVIPYTASDAKGLLKAAIRDPNPVIFLENEILYGSSFEVPMVDDLVIPIGRARIHRQGSDVTIISFGIGMTYATKAAIELEKNGIDAELIDLRTIRPMDWQTIFESVKKTGRLVTVEEGYPQSSVGSTIANQVQRKVFDYLDAPILTITGRDVPMPYAANLEKLALPNVDEIIESVESICYKRKA**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
hhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPILVTMPSLSPTMTEGNIAKWKKNEGDLIKQGDIIYEVETDKAVMEVESIDEGILGKILCPNGTKNVKVNTPIAAILQEGETALDIDKMLLEKPDVAISPSSKNTTLVFSNEDNDKVDHQKSKNDIQDSSFAHAPTSSITVREALRDAIAEEMRRDKDVFIMGEEVAEYQGAYKVTQGLLQEFGCERVIDTPITEHGFAGIGIGASFAGLKPIVEFMTFNFAMQAIDQIINSAAKTRYMSGGQITTSIVFRGPNGAAARVAAQHSQCYAAWYSHVPGLKVVIPYTASDAKGLLKAAIRDPNPVIFLENEILYGSSFEVPMVDDLVIPIGRARIHRQGSDVTIISFGIGMTYATKAAIELEKNGIDAELIDLRTIRPMDWQTIFESVKKTGRLVTVEEGYPQSSVGSTIANQVQRKVFDYLDAPILTITGRDVPMPYAANLEKLALPNVDEIIESVESICYKRKAKS
MPILVTMPSLSPTMTEGNIAKWKKNEGDLIKQGDIIYEVETDKAVMEVESIDEGILGKILCPNGTKNVKVNTPIAAILQEGETALDIDKMLLEKPDVAISPSSKNTTLVFSNEDNDKVDHQKSKNDIQDSSFAHAPTSSITVREALRDAIAEEMRRDKDVFIMGEEVAEYQGAYKVTQGLLQEFGCERVIDTPITEHGFAGIGIGASFAGLKPIVEFMTFNFAMQAIDQIINSAAKTRYMSGGQITTSIVFRGPNGAAARVAAQHSQCYAAWYSHVPGLKVVIPYTASDAKGLLKAAIRDPNPVIFLENEILYGSSFEVPMVDDLVIPIGRARIHRQGSDVTIISFGIGMTYATKAAIELEKNGIDAELIDLRTIRPMDWQTIFESVKKTGRLVTVEEGYPQSSVGSTIANQVQRKVFDYLDAPILTITGRDVPMPYAANLEKLALPNVDEIIESVESICYKRKAKS
MPILVTMPSLSPTMTEGNIAKWKKNEGDLIKQGDIIYEVETDKAVMEVESIDEGILGKILCPNGTKNVKVNTPIAAILQEGETALDIDKMLLEKPDVAISPSSKNTTLVFSNEDNDKVDHQKSKNDIQDSSFAHAPTSSITVREALRDAIAEEMRRDKDVFIMGEEVAEYQGAYKVTQGLLQEFGCERVIDTPITEHGFAGIGIGASFAGLKPIVEFMTFNFAMQAIDQIINSAAKTRYMSGGQITTSIVFRGPNGAAARVAAQHSQCYAAWYSHVPGLKVVIPYTASDAKGLLKAAIRDPNPVIFLENEILYGSSFEVPMVDDLVIPIGRARIHRQGSDVTIISFGIGMTYATKAAIELEKNGIDAELIDLRTIRPMDWQTIFESVKKTGRLVTVEEGYPQSSVGSTIANQVQRKVFDYLDAPILTITGRDVPMPYAANLEKLALPNVDEIIESVESICYKRKAKS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target467 pyruvate dehydrogenase subunit beta [Candidatus Liberib
254780674423 pyruvate dehydrogenase complex dihydrolipoamide ac 6e-25
254781052436 dihydrolipoamide succinyltransferase [Candidatus L 6e-05
>gi|254780674|ref|YP_003065087.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Back     alignment
 Score =  107 bits (266), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 61/77 (79%)

Query: 5  VTMPSLSPTMTEGNIAKWKKNEGDLIKQGDIIYEVETDKAVMEVESIDEGILGKILCPNG 64
          +TMPSLSPTMTEG +AKW K EGD I  GDI+ E+ETDKA+ME ES+DEGI+ +IL P G
Sbjct: 6  ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65

Query: 65 TKNVKVNTPIAAILQEG 81
          T+N+ VN+PI  IL + 
Sbjct: 66 TENIAVNSPILNILMDS 82

>gi|254781052|ref|YP_003065465.1| dihydrolipoamide succinyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 436 Back     alignment
 Score = 40.4 bits (93), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%)

Query: 1  MPILVTMPSLSPTMTEGNIAKWKKNEGDLIKQGDIIYEVETDKAVMEVESIDEGILGKIL 60
          M   + +PSL  ++ E  +  W K  G+ ++ G+I+ E+ETDK  +EV S   G L ++ 
Sbjct: 19 MATKILVPSLGESVNEATVGTWLKEIGESVEIGEILVELETDKVTVEVPSPVSGKLHEMS 78

Query: 61 CPNG 64
             G
Sbjct: 79 VAKG 82

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target467 pyruvate dehydrogenase subunit beta [Candidatus Liberib
315122216473 pyruvate dehydrogenase subunit beta [Candidatus Liberib 1 0.0
15965199460 pyruvate dehydrogenase subunit beta [Sinorhizobium meli 1 0.0
6164935460 pyruvate dehydrogenase beta subunit [Sinorhizobium meli 1 0.0
307321956460 Transketolase central region [Sinorhizobium meliloti AK 1 0.0
325292761473 pyruvate dehydrogenase E1 component beta subunit [Agrob 1 0.0
15888755473 pyruvate dehydrogenase subunit beta [Agrobacterium tume 1 0.0
260459501465 Transketolase central region [Mesorhizobium opportunist 1 0.0
150396297465 pyruvate dehydrogenase subunit beta [Sinorhizobium medi 1 0.0
227821847455 pyruvate dehydrogenase subunit beta [Sinorhizobium fred 1 0.0
153009390465 pyruvate dehydrogenase subunit beta [Ochrobactrum anthr 1 0.0
>gi|315122216|ref|YP_004062705.1| pyruvate dehydrogenase subunit beta [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 473 Back     alignment and organism information
 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/472 (80%), Positives = 423/472 (89%), Gaps = 6/472 (1%)

Query: 1   MPILVTMPSLSPTMTEGNIAKWKKNEGDLIKQGDIIYEVETDKAVMEVESIDEGILGKIL 60
           MPIL+TMPSLSPTMTEGNIA+WKKNEGD IKQGDII EVETDKAVMEVESIDEG LGKI 
Sbjct: 1   MPILITMPSLSPTMTEGNIAEWKKNEGDPIKQGDIICEVETDKAVMEVESIDEGFLGKIF 60

Query: 61  CPNGTKNVKVNTPIAAILQEGETALDIDKMLLEKPD-VAISPSSKNTTLVFSNEDNDKVD 119
            P G++NVKVNTPIAAILQEGET  DI+K+L ++ D + IS   + +      + +D ++
Sbjct: 61  FPKGSQNVKVNTPIAAILQEGETVADIEKILSKQSDSITISKKIERSVPSVPIKKDDTIN 120

Query: 120 HQKSKNDIQDSS-----FAHAPTSSITVREALRDAIAEEMRRDKDVFIMGEEVAEYQGAY 174
           +Q S+ + +DSS     + + PT S+TVREALRDA+AEEMR DKDVF+MGEEVAEYQGAY
Sbjct: 121 YQVSQKNTKDSSNTLESYENIPTVSMTVREALRDAMAEEMRHDKDVFVMGEEVAEYQGAY 180

Query: 175 KVTQGLLQEFGCERVIDTPITEHGFAGIGIGASFAGLKPIVEFMTFNFAMQAIDQIINSA 234
           KVTQGLLQEFG ER+IDTPITEHGF GIGIGAS AGLKPIVEFMTFNFAMQAIDQIINSA
Sbjct: 181 KVTQGLLQEFGSERIIDTPITEHGFTGIGIGASLAGLKPIVEFMTFNFAMQAIDQIINSA 240

Query: 235 AKTRYMSGGQITTSIVFRGPNGAAARVAAQHSQCYAAWYSHVPGLKVVIPYTASDAKGLL 294
           AKTRYMSGGQITTSIVFRGPNGAAARV AQHSQCYAAWYSH+PGLKV++PYTASDAKGLL
Sbjct: 241 AKTRYMSGGQITTSIVFRGPNGAAARVGAQHSQCYAAWYSHIPGLKVIMPYTASDAKGLL 300

Query: 295 KAAIRDPNPVIFLENEILYGSSFEVPMVDDLVIPIGRARIHRQGSDVTIISFGIGMTYAT 354
           KAAIRDPNPVIFLENEILYGSSFEVP+ D+ +IPIG+ARIHR G+DVT++SFGIGMTYA 
Sbjct: 301 KAAIRDPNPVIFLENEILYGSSFEVPVADNFIIPIGKARIHRPGNDVTLVSFGIGMTYAL 360

Query: 355 KAAIELEKNGIDAELIDLRTIRPMDWQTIFESVKKTGRLVTVEEGYPQSSVGSTIANQVQ 414
           KA  EL++ GID ELIDLRT+RP+DWQTIFESVKKTGRLVTVEEGYPQSSVGS IAN+VQ
Sbjct: 361 KAMTELKEIGIDVELIDLRTLRPIDWQTIFESVKKTGRLVTVEEGYPQSSVGSEIANRVQ 420

Query: 415 RKVFDYLDAPILTITGRDVPMPYAANLEKLALPNVDEIIESVESICYKRKAK 466
           R+VFDYLDAPILTITG+DVPMPYA+NLEKLALPNVDEIIES+ES+CYKRKAK
Sbjct: 421 REVFDYLDAPILTITGKDVPMPYASNLEKLALPNVDEIIESIESVCYKRKAK 472


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15965199|ref|NP_385552.1| pyruvate dehydrogenase subunit beta [Sinorhizobium meliloti 1021] Length = 460 Back     alignment and organism information
>gi|6164935|gb|AAF04588.1|AF190792_2 pyruvate dehydrogenase beta subunit [Sinorhizobium meliloti] Length = 460 Back     alignment and organism information
>gi|307321956|ref|ZP_07601337.1| Transketolase central region [Sinorhizobium meliloti AK83] Length = 460 Back     alignment and organism information
>gi|325292761|ref|YP_004278625.1| pyruvate dehydrogenase E1 component beta subunit [Agrobacterium sp. H13-3] Length = 473 Back     alignment and organism information
>gi|15888755|ref|NP_354436.1| pyruvate dehydrogenase subunit beta [Agrobacterium tumefaciens str. C58] Length = 473 Back     alignment and organism information
>gi|260459501|ref|ZP_05807756.1| Transketolase central region [Mesorhizobium opportunistum WSM2075] Length = 465 Back     alignment and organism information
>gi|150396297|ref|YP_001326764.1| pyruvate dehydrogenase subunit beta [Sinorhizobium medicae WSM419] Length = 465 Back     alignment and organism information
>gi|227821847|ref|YP_002825817.1| pyruvate dehydrogenase subunit beta [Sinorhizobium fredii NGR234] Length = 455 Back     alignment and organism information
>gi|153009390|ref|YP_001370605.1| pyruvate dehydrogenase subunit beta [Ochrobactrum anthropi ATCC 49188] Length = 465 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target467 pyruvate dehydrogenase subunit beta [Candidatus Liberib
PRK11892464 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta 0.0
PRK09212327 PRK09212, PRK09212, pyruvate dehydrogenase subunit beta 1e-161
PLN02683356 PLN02683, PLN02683, pyruvate dehydrogenase E1 component 1e-149
PTZ00182355 PTZ00182, PTZ00182, 3-methyl-2-oxobutanate dehydrogenas 1e-145
KOG0524359 KOG0524, KOG0524, KOG0524, Pyruvate dehydrogenase E1, b 1e-134
CHL00144327 CHL00144, odpB, pyruvate dehydrogenase E1 component bet 3e-84
KOG0525362 KOG0525, KOG0525, KOG0525, Branched chain alpha-keto ac 2e-64
PRK12571641 PRK12571, PRK12571, 1-deoxy-D-xylulose-5-phosphate synt 4e-10
COG0022324 COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase co 1e-138
cd07036167 cd07036, TPP_PYR_E1-PDHc-beta_like, Pyrimidine (PYR) bi 2e-85
pfam02779174 pfam02779, Transket_pyr, Transketolase, pyrimidine bind 3e-47
smart00861168 smart00861, Transket_pyr, Transketolase, pyrimidine bin 2e-34
cd06586154 cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding domai 3e-14
cd07033156 cd07033, TPP_PYR_DXS_TK_like, Pyrimidine (PYR) binding 1e-13
pfam02780124 pfam02780, Transketolase_C, Transketolase, C-terminal d 1e-37
TIGR01349435 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase compl 5e-30
PRK11856411 PRK11856, PRK11856, branched-chain alpha-keto acid dehy 6e-27
KOG0557470 KOG0557, KOG0557, KOG0557, Dihydrolipoamide acetyltrans 2e-25
PLN02744539 PLN02744, PLN02744, dihydrolipoyllysine-residue acetylt 3e-23
cd0684974 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolip 1e-21
COG0508404 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase co 7e-19
PRK14875371 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit di 3e-14
pfam0036473 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme 5e-12
TIGR01347403 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex d 8e-12
PRK05704407 PRK05704, PRK05704, dihydrolipoamide succinyltransferas 1e-11
PRK11855547 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; 7e-09
PRK11855547 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; 4e-08
KOG0559457 KOG0559, KOG0559, KOG0559, Dihydrolipoamide succinyltra 1e-07
TIGR02927 590 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E 5e-07
PRK11854 633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltra 3e-06
PLN02226463 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 com 3e-04
PRK11854633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltra 0.001
cd0685067 cd06850, biotinyl_domain, The biotinyl-domain or biotin 0.002
PRK11854633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltra 0.002
COG3958312 COG3958, COG3958, Transketolase, C-terminal subunit [Ca 3e-25
PLN02225701 PLN02225, PLN02225, 1-deoxy-D-xylulose-5-phosphate synt 9e-09
COG1154627 COG1154, Dxs, Deoxyxylulose-5-phosphate synthase [Coenz 4e-19
PRK05444580 PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synt 4e-16
TIGR00204617 TIGR00204, dxs, 1-deoxy-D-xylulose-5-phosphate synthase 2e-15
KOG0523632 KOG0523, KOG0523, KOG0523, Transketolase [Carbohydrate 4e-12
PRK12315581 PRK12315, PRK12315, 1-deoxy-D-xylulose-5-phosphate synt 1e-06
PLN02234641 PLN02234, PLN02234, 1-deoxy-D-xylulose-5-phosphate synt 2e-06
cd0666373 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domai 7e-08
PTZ00144418 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferas 2e-07
TIGR02927590 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E 6e-05
PLN02582677 PLN02582, PLN02582, 1-deoxy-D-xylulose-5-phosphate synt 8e-06
PRK09622407 PRK09622, porA, pyruvate flavodoxin oxidoreductase subu 0.002
>gnl|CDD|183363 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|169719 PRK09212, PRK09212, pyruvate dehydrogenase subunit beta; Validated Back     alignment and domain information
>gnl|CDD|178287 PLN02683, PLN02683, pyruvate dehydrogenase E1 component subunit beta Back     alignment and domain information
>gnl|CDD|185502 PTZ00182, PTZ00182, 3-methyl-2-oxobutanate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|35744 KOG0524, KOG0524, KOG0524, Pyruvate dehydrogenase E1, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|177066 CHL00144, odpB, pyruvate dehydrogenase E1 component beta subunit; Validated Back     alignment and domain information
>gnl|CDD|35745 KOG0525, KOG0525, KOG0525, Branched chain alpha-keto acid dehydrogenase E1, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183601 PRK12571, PRK12571, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|30372 COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|132919 cd07036, TPP_PYR_E1-PDHc-beta_like, Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins Back     alignment and domain information
>gnl|CDD|145763 pfam02779, Transket_pyr, Transketolase, pyrimidine binding domain Back     alignment and domain information
>gnl|CDD|129094 smart00861, Transket_pyr, Transketolase, pyrimidine binding domain Back     alignment and domain information
>gnl|CDD|132915 cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|132916 cd07033, TPP_PYR_DXS_TK_like, Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins Back     alignment and domain information
>gnl|CDD|145764 pfam02780, Transketolase_C, Transketolase, C-terminal domain Back     alignment and domain information
>gnl|CDD|162311 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|183339 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>gnl|CDD|35777 KOG0557, KOG0557, KOG0557, Dihydrolipoamide acetyltransferase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|178345 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>gnl|CDD|30854 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|144088 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme Back     alignment and domain information
>gnl|CDD|162309 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>gnl|CDD|180214 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>gnl|CDD|183338 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|183338 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|35779 KOG0559, KOG0559, KOG0559, Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|131973 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|183337 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|183337 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>gnl|CDD|183337 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|33739 COG3958, COG3958, Transketolase, C-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|177870 PLN02225, PLN02225, 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>gnl|CDD|31348 COG1154, Dxs, Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>gnl|CDD|180086 PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|129308 TIGR00204, dxs, 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>gnl|CDD|35743 KOG0523, KOG0523, KOG0523, Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|183431 PRK12315, PRK12315, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|177878 PLN02234, PLN02234, 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>gnl|CDD|185477 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|131973 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|178194 PLN02582, PLN02582, 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>gnl|CDD|181999 PRK09622, porA, pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 467 pyruvate dehydrogenase subunit beta [Candidatus Liberib
PRK11892464 pyruvate dehydrogenase subunit beta; Provisional 100.0
COG0022324 AcoB Pyruvate/2-oxoglutarate dehydrogenase complex, deh 100.0
PTZ00182355 3-methyl-2-oxobutanate dehydrogenase; Provisional 100.0
PRK09212327 pyruvate dehydrogenase subunit beta; Validated 100.0
KOG0524359 consensus 100.0
CHL00144326 odpB pyruvate dehydrogenase E1 component beta subunit; 100.0
KOG0525362 consensus 100.0
COG3958312 Transketolase, C-terminal subunit [Carbohydrate transpo 100.0
COG1154627 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabo 100.0
PRK05444576 1-deoxy-D-xylulose-5-phosphate synthase; Provisional 100.0
PRK12315581 1-deoxy-D-xylulose-5-phosphate synthase; Provisional 100.0
PRK12571642 1-deoxy-D-xylulose-5-phosphate synthase; Provisional 100.0
PRK05899661 transketolase; Reviewed 100.0
KOG0523632 consensus 100.0
PRK12754663 transketolase; Reviewed 100.0
PRK12753662 transketolase; Reviewed 99.98
TIGR00204627 dxs 1-deoxy-D-xylulose-5-phosphate synthase; InterPro: 99.97
PTZ00089670 transketolase; Provisional 99.92
COG0021663 TktA Transketolase [Carbohydrate transport and metaboli 99.82
TIGR00232675 tktlase_bact transketolase; InterPro: IPR005478 Transke 99.64
PRK122701234 kgd alpha-ketoglutarate decarboxylase; Reviewed 99.47
PRK09404931 kgd alpha-ketoglutarate decarboxylase; Reviewed 99.43
KOG0451913 consensus 98.62
PRK09405886 aceE pyruvate dehydrogenase subunit E1; Reviewed 98.16
COG2609887 AceE Pyruvate dehydrogenase complex, dehydrogenase (E1) 97.32
PRK13030 1168 2-oxoacid ferredoxin oxidoreductase; Provisional 97.11
PRK09193 1155 indolepyruvate ferredoxin oxidoreductase; Validated 96.02
TIGR00239990 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component; 95.74
cd07036167 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding doma 100.0
pfam02779174 Transket_pyr Transketolase, pyrimidine binding domain. 100.0
cd07033156 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 100.0
smart00861168 Transket_pyr Transketolase, pyrimidine binding domain. 99.96
cd06586154 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiam 97.15
pfam03894179 XFP D-xylulose 5-phosphate/D-fructose 6-phosphate phosp 93.81
PRK05704406 dihydrolipoamide succinyltransferase; Validated 99.97
PTZ00144430 dihydrolipoamide succinyltransferase; Provisional 99.97
PRK11855549 dihydrolipoamide acetyltransferase; Reviewed 99.96
COG0508404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dih 99.95
TIGR02927607 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, 99.95
PRK11856324 branched-chain alpha-keto acid dehydrogenase subunit E2 99.94
TIGR02927 607 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, 99.94
KOG0557470 consensus 99.94
TIGR01347435 sucB 2-oxoglutarate dehydrogenase, E2 component, dihydr 99.93
PRK11855549 dihydrolipoamide acetyltransferase; Reviewed 99.93
PRK11854 630 aceF dihydrolipoamide acetyltransferase; Validated 99.92
KOG0559457 consensus 99.86
PRK11854630 aceF dihydrolipoamide acetyltransferase; Validated 99.85
TIGR01348 655 PDHac_trf_long pyruvate dehydrogenase complex dihydroli 99.83
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are pre 99.8
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltr 99.77
pfam0036473 Biotin_lipoyl Biotin-requiring enzyme. This family cove 99.73
KOG0558474 consensus 99.45
cd0685067 biotinyl_domain The biotinyl-domain or biotin carboxyl 99.3
PRK05641148 putative acetyl-CoA carboxylase biotin carboxyl carrier 99.09
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabolism] 99.03
PRK06549132 acetyl-CoA carboxylase biotin carboxyl carrier protein 99.02
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier protein 98.95
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl carrier 98.94
PRK0705180 hypothetical protein; Validated 98.78
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier protein 98.67
TIGR01108616 oadA oxaloacetate decarboxylase alpha subunit; InterPro 98.51
TIGR027121226 urea_carbox urea carboxylase; InterPro: IPR014084 Membe 98.44
KOG0368 2196 consensus 97.75
PRK09578385 periplasmic multidrug efflux lipoprotein precursor; Rev 97.22
TIGR03077110 not_gcvH glycine cleavage protein H homolog, Chlamydial 97.19
PRK00624113 glycine cleavage system protein H; Provisional 97.12
cd0684896 GCS_H Glycine cleavage H-protein. Glycine cleavage H-pr 97.09
PRK13380132 glycine cleavage system protein H; Provisional 96.9
PRK01202127 glycine cleavage system protein H; Provisional 96.83
pfam01597122 GCV_H Glycine cleavage H-protein. This is a family of g 96.81
TIGR00531159 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier pr 96.63
TIGR03309256 matur_yqeB selenium-dependent molybdenum hydroxylase sy 96.22
PRK05352448 Na(+)-translocating NADH-quinone reductase subunit A; P 96.02
pfam05896257 NQRA Na(+)-translocating NADH-quinone reductase subunit 95.03
PRK0674884 hypothetical protein; Validated 92.94
PRK1278484 hypothetical protein; Provisional 92.33
COG1726447 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, s 90.9
KOG3373172 consensus 90.72
pfam02780124 Transketolase_C Transketolase, C-terminal domain. The C 99.96
PRK12999 1147 pyruvate carboxylase; Reviewed 98.77
TIGR01235 1169 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 98.09
COG1038 1149 PycA Pyruvate carboxylase [Energy production and conver 98.01
TIGR02176 1194 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoredu 93.2
TIGR01349 584 PDHac_trf_mito pyruvate dehydrogenase complex dihydroli 99.96
TIGR01348655 PDHac_trf_long pyruvate dehydrogenase complex dihydroli 99.88
TIGR01349584 PDHac_trf_mito pyruvate dehydrogenase complex dihydroli 99.84
PRK08659377 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; 99.57
PRK07119350 2-ketoisovalerate ferredoxin reductase; Validated 99.55
PRK09627375 oorA 2-oxoglutarate-acceptor oxidoreductase subunit Oor 99.51
PRK09622407 porA pyruvate flavodoxin oxidoreductase subunit alpha; 99.28
PRK08366394 vorA 2-ketoisovalerate ferredoxin oxidoreductase subuni 99.25
TIGR03336 595 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alp 98.85
COG4231 640 Indolepyruvate ferredoxin oxidoreductase, alpha and bet 98.72
PRK13012898 2-oxoacid dehydrogenase subunit E1; Provisional 97.59
TIGR03186889 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. Severa 97.31
PRK08367395 porA pyruvate ferredoxin oxidoreductase subunit alpha; 99.28
COG0674365 PorA Pyruvate:ferredoxin oxidoreductase and related 2-o 98.65
TIGR00759905 aceE 2-oxo-acid dehydrogenase E1 component, homodimeric 97.1
PRK09282 580 pyruvate carboxylase subunit B; Validated 98.78
COG4770 645 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid 98.28
KOG0238 670 consensus 97.04
COG0567906 SucA 2-oxoglutarate dehydrogenase complex, dehydrogenas 98.75
KOG04501017 consensus 98.58
PRK05261786 putative phosphoketolase; Provisional 97.34
COG3957793 Phosphoketolase [Carbohydrate transport and metabolism] 98.46
KOG0369 1176 consensus 97.72
cd06251287 M14_ASTE_ASPA_like_1 A functionally uncharacterized sub 95.97
PRK11578347 macrolide transporter subunit MacA; Provisional 97.7
PRK11556415 multidrug efflux system subunit MdtA; Provisional 97.62
PRK03598331 hypothetical protein; Provisional 97.45
PRK10476348 multidrug resistance protein MdtN; Provisional 97.28
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisional 97.12
PRK09859385 multidrug efflux system protein MdtE; Provisional 96.93
PRK09783407 copper/silver efflux system membrane fusion protein Cus 96.61
PRK11892464 pyruvate dehydrogenase subunit beta; Provisional 95.76
cd06250359 M14_PaAOTO_like An uncharacterized subgroup of the Succ 95.61
TIGR01843434 type_I_hlyD type I secretion membrane fusion protein, H 95.22
TIGR00527132 gcvH glycine cleavage system H protein; InterPro: IPR00 95.2
pfam00529304 HlyD HlyD family secretion protein. 95.13
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier protein 94.52
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl carrier 93.47
cd0685067 biotinyl_domain The biotinyl-domain or biotin carboxyl 93.34
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabolism] 93.29
PRK06549132 acetyl-CoA carboxylase biotin carboxyl carrier protein 91.83
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are pre 91.49
COG0508404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dih 91.48
PRK05641148 putative acetyl-CoA carboxylase biotin carboxyl carrier 91.36
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltr 90.47
TIGR00998379 8a0101 efflux pump membrane protein; InterPro: IPR00569 90.04
pfam01855230 POR_N domain. This family includes the N terminal struc 97.26
cd07034160 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding do 97.11
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR- 93.27
KOG0559457 consensus 97.13
PRK05704406 dihydrolipoamide succinyltransferase; Validated 96.98
COG0509131 GcvH Glycine cleavage system H protein (lipoate-binding 96.71
PTZ00144430 dihydrolipoamide succinyltransferase; Provisional 96.21
PRK0705180 hypothetical protein; Validated 94.65
PRK03598331 hypothetical protein; Provisional 93.49
pfam00529304 HlyD HlyD family secretion protein. 93.25
COG4656529 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit 92.39
PRK11556415 multidrug efflux system subunit MdtA; Provisional 91.58
PRK10476348 multidrug resistance protein MdtN; Provisional 91.47
PRK11578347 macrolide transporter subunit MacA; Provisional 91.12
cd06252316 M14_ASTE_ASPA_like_2 A functionally uncharacterized sub 96.69
COG3608331 Predicted deacylase [General function prediction only] 95.1
cd06254288 M14_ASTE_ASPA_like_4 A functionally uncharacterized sub 94.24
cd06255293 M14_ASTE_ASPA_like_5 A functionally uncharacterized sub 93.02
pfam04952289 AstE_AspA Succinylglutamate desuccinylase / Aspartoacyl 91.68
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. This fam 95.8
PRK09259572 putative oxalyl-CoA decarboxylase; Validated 94.16
TIGR01108 616 oadA oxaloacetate decarboxylase alpha subunit; InterPro 90.82
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number of ba 92.8
PRK11856324 branched-chain alpha-keto acid dehydrogenase subunit E2 90.89
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>COG0022 AcoB Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion] Back     alignment and domain information
>PTZ00182 3-methyl-2-oxobutanate dehydrogenase; Provisional Back     alignment and domain information
>PRK09212 pyruvate dehydrogenase subunit beta; Validated Back     alignment and domain information
>KOG0524 consensus Back     alignment and domain information
>CHL00144 odpB pyruvate dehydrogenase E1 component beta subunit; Validated Back     alignment and domain information
>KOG0525 consensus Back     alignment and domain information
>COG3958 Transketolase, C-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>KOG0523 consensus Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase; InterPro: IPR005477 DXP synthase is a thiamine diphosphate-dependent enzyme related to transketolase and the pyruvate dehydrogenase E1-beta subunit Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>COG0021 TktA Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase; InterPro: IPR005478 Transketolase (EC 2 Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>PRK09404 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>KOG0451 consensus Back     alignment and domain information
>PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed Back     alignment and domain information
>COG2609 AceE Pyruvate dehydrogenase complex, dehydrogenase (E1) component [Energy production and conversion] Back     alignment and domain information
>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated Back     alignment and domain information
>TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component; InterPro: IPR011603 2-oxoglutarate dehydrogenase is a key enzyme in the TCA cycle, converting 2-oxoglutarate, coenzyme A and NAD(+) to succinyl-CoA, NADH and carbon dioxide Back     alignment and domain information
>cd07036 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins Back     alignment and domain information
>pfam02779 Transket_pyr Transketolase, pyrimidine binding domain Back     alignment and domain information
>cd07033 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins Back     alignment and domain information
>smart00861 Transket_pyr Transketolase, pyrimidine binding domain Back     alignment and domain information
>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>pfam03894 XFP D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR014276 This entry represents the mainly actinobacterial clade of the E2 component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR014276 This entry represents the mainly actinobacterial clade of the E2 component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle Back     alignment and domain information
>KOG0557 consensus Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR006255 These sequences describe the TCA cycle 2-oxoglutarate system E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PRK11854 aceF dihydrolipoamide acetyltransferase; Validated Back     alignment and domain information
>KOG0559 consensus Back     alignment and domain information
>PRK11854 aceF dihydrolipoamide acetyltransferase; Validated Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006256 This group of sequences are a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and percent identity (UPGMA) trees Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>pfam00364 Biotin_lipoyl Biotin-requiring enzyme Back     alignment and domain information
>KOG0558 consensus Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776 This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084 Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>KOG0368 consensus Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>TIGR03077 not_gcvH glycine cleavage protein H homolog, Chlamydial Back     alignment and domain information
>PRK00624 glycine cleavage system protein H; Provisional Back     alignment and domain information
>cd06848 GCS_H Glycine cleavage H-protein Back     alignment and domain information
>PRK13380 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PRK01202 glycine cleavage system protein H; Provisional Back     alignment and domain information
>pfam01597 GCV_H Glycine cleavage H-protein Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein; InterPro: IPR001249 The proteins in this family are a component of the acetyl coenzyme A carboxylase complex (6 Back     alignment and domain information
>TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>pfam05896 NQRA Na(+)-translocating NADH-quinone reductase subunit A (NQRA) Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>PRK12784 hypothetical protein; Provisional Back     alignment and domain information
>COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] Back     alignment and domain information
>KOG3373 consensus Back     alignment and domain information
>pfam02780 Transketolase_C Transketolase, C-terminal domain Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 In the postabsorptive state, blood glucose concentration is kept constant by a combination of glycogenolysis and gluconeogenesis Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase; InterPro: IPR011895 The oxidative decarboxylation of pyruvate to acetyl-CoA, a central step in energy metabolism, can occur by two different mechanisms Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006257 This group of sequences represent one of several closely related clades of the dihydrolipoamide acetyltransferase subunit of the pyruvate dehydrogenase complex Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006256 This group of sequences are a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and percent identity (UPGMA) trees Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006257 This group of sequences represent one of several closely related clades of the dihydrolipoamide acetyltransferase subunit of the pyruvate dehydrogenase complex Back     alignment and domain information
>PRK08659 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; Validated Back     alignment and domain information
>PRK07119 2-ketoisovalerate ferredoxin reductase; Validated Back     alignment and domain information
>PRK09627 oorA 2-oxoglutarate-acceptor oxidoreductase subunit OorA; Reviewed Back     alignment and domain information
>PRK09622 porA pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PRK08366 vorA 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional Back     alignment and domain information
>TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase Back     alignment and domain information
>PRK08367 porA pyruvate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>COG0674 PorA Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, alpha subunit [Energy production and conversion] Back     alignment and domain information
>TIGR00759 aceE 2-oxo-acid dehydrogenase E1 component, homodimeric type; InterPro: IPR004660 Most members of this family are pyruvate dehydrogenase complex, E1 component Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>KOG0238 consensus Back     alignment and domain information
>COG0567 SucA 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>KOG0450 consensus Back     alignment and domain information
>PRK05261 putative phosphoketolase; Provisional Back     alignment and domain information
>COG3957 Phosphoketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0369 consensus Back     alignment and domain information
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PRK03598 hypothetical protein; Provisional Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family; InterPro: IPR010129 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR00527 gcvH glycine cleavage system H protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes Back     alignment and domain information
>pfam00529 HlyD HlyD family secretion protein Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein; InterPro: IPR005694 emrA and emrB confer resistance to carbonylcyanide m-chlorophenylhydrazone, nalidixic acid, and a number of other toxic compounds Back     alignment and domain information
>pfam01855 POR_N domain Back     alignment and domain information
>cd07034 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding domain of pyruvate ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin oxidoreductase alpha subunit (IOR-alpha), and related proteins Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>KOG0559 consensus Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>PRK03598 hypothetical protein; Provisional Back     alignment and domain information
>pfam00529 HlyD HlyD family secretion protein Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>COG3608 Predicted deacylase [General function prediction only] Back     alignment and domain information
>cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>pfam04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776 This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target467 pyruvate dehydrogenase subunit beta [Candidatus Liberib
2ozl_B341 Human Pyruvate Dehydrogenase S264e Variant Length = 2e-71
3exe_B329 Crystal Structure Of The Pyruvate Dehydrogenase (E1 3e-71
2bp7_B339 New Crystal Form Of The Pseudomonas Putida Branched 6e-63
1qs0_B338 Crystal Structure Of Pseudomonas Putida 2-Oxoisoval 1e-62
1ni4_B341 Human Pyruvate Dehydrogenase Length = 341 3e-62
1w85_B324 The Crystal Structure Of Pyruvate Dehydrogenase E1 7e-62
3duf_B325 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 9e-62
2j9f_B350 Human Branched-Chain Alpha-Ketoacid Dehydrogenase- 1e-61
1dtw_B342 Human Branched-Chain Alpha-Keto Acid Dehydrogenase 1e-61
1um9_B324 Branched-Chain 2-Oxo Acid Dehydrogenase (E1) From T 4e-61
1olx_B342 Roles Of His291-Alpha And His146-Beta' In The Reduc 2e-60
2o1x_A629 1-Deoxy-D-Xylulose 5-Phosphate Synthase (Dxs) From 5e-18
1ik6_A369 3d Structure Of The E1beta Subunit Of Pyruvate Dehy 1e-61
3mos_A616 The Structure Of Human Transketolase Length = 616 8e-22
3ooy_A616 Crystal Structure Of Human Transketolase (Tkt) Leng 8e-22
1zy8_L229 The Crystal Structure Of Dihydrolipoamide Dehydroge 6e-31
1y8n_B128 Crystal Structure Of The Pdk3-L2 Complex Length = 1 5e-26
1fyc_A106 Inner Lipoyl Domain From Human Pyruvate Dehydrogena 2e-25
2dnc_A98 Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain 1e-28
3duf_I428 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 2e-25
2dne_A108 Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain 6e-24
1lab_A80 Three-Dimensional Structure Of The Lipoyl Domain Fr 5e-23
3crk_C87 Crystal Structure Of The Pdhk2-L2 Complex. Length = 2e-22
1ghj_A79 Solution Structure Of The Lipoyl Domain Of The 2- O 1e-19
1pmr_A80 Lipoyl Domain From The Dihydrolipoyl Succinyltransf 4e-19
2o1s_A621 1-Deoxy-D-Xylulose 5-Phosphate Synthase (Dxs) From 2e-20
>gi|149242792|pdb|2OZL|B Chain B, Human Pyruvate Dehydrogenase S264e Variant Length = 341 Back     alignment and structure
 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 180/319 (56%), Positives = 240/319 (75%), Gaps = 4/319 (1%)

Query: 144 EALRDAIAEEMRRDKDVFIMGEEVAEYQGAYKVTQGLLQEFGCERVIDTPITEHGFAGIG 203
           +A+   + EE+ RD+ VF++GEEVA+Y GAYKV++GL +++G +R+IDTPI+E GFAGI 
Sbjct: 19  DAINQGMDEELERDEKVFLLGEEVAQYDGAYKVSRGLWKKYGDKRIIDTPISEMGFAGIA 78

Query: 204 IGASFAGLKPIVEFMTFNFAMQAIDQIINSAAKTRYMSGGQITTSIVFRGPNGAAARVAA 263
           +GA+ AGL+PI EFMTFNF+MQAIDQ+INSAAKT YMSGG     IVFRGPNGA+A VAA
Sbjct: 79  VGAAMAGLRPICEFMTFNFSMQAIDQVINSAAKTYYMSGGLQPVPIVFRGPNGASAGVAA 138

Query: 264 QHSQCYAAWYSHVPGLKVVIPYTASDAKGLLKAAIRDPNPVIFLENEILYGSSFEVP--- 320
           QHSQC+AAWY H PGLKVV P+ + DAKGL+K+AIRD NPV+ LENE++YG  FE P   
Sbjct: 139 QHSQCFAAWYGHCPGLKVVSPWNSEDAKGLIKSAIRDNNPVVVLENELMYGVPFEFPPEA 198

Query: 321 MVDDLVIPIGRARIHRQGSDVTIISFGIGMTYATKAAIELEKNGIDAELIDLRTIRPMDW 380
              D +IPIG+A+I RQG+ +T++S    + +  +AA  L K G++ E+I++RTIRPMD 
Sbjct: 199 QSKDFLIPIGKAKIERQGTHITVVSHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDM 258

Query: 381 QTIFESVKKTGRLVTVEEGYPQSSVGSTIANQVQRK-VFDYLDAPILTITGRDVPMPYAA 439
           +TI  SV KT  LVTVE G+PQ  VG+ I  ++     F++LDAP + +TG DVPMPYA 
Sbjct: 259 ETIEASVMKTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAK 318

Query: 440 NLEKLALPNVDEIIESVES 458
            LE  ++P V +II +++ 
Sbjct: 319 ILEDNSIPQVKDIIFAIKK 337


>gi|215261327|pdb|3EXE|B Chain B, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 329 Back     alignment and structure
gi|75766369|pdb|2BP7|B Chain B, New Crystal Form Of The Pseudomonas Putida Branched-Chain Dehydrogenase (E1) Length = 339 Back     alignment and structure
>gi|5822331|pdb|1QS0|B Chain B, Crystal Structure Of Pseudomonas Putida 2-Oxoisovalerate Dehydrogenase (Branched-Chain Alpha-Keto Acid Dehydrogenase, E1b) Length = 338 Back     alignment and structure
>gi|33357460|pdb|1NI4|B Chain B, Human Pyruvate Dehydrogenase Length = 341 Back     alignment and structure
>gi|56966701|pdb|1W85|B Chain B, The Crystal Structure Of Pyruvate Dehydrogenase E1 Bound To The Peripheral Subunit Binding Domain Of E2 Length = 324 Back     alignment and structure
gi|219689225|pdb|3DUF|B Chain B, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 325 Back     alignment and structure
>gi|134104670|pdb|2J9F|B Chain B, Human Branched-Chain Alpha-Ketoacid Dehydrogenase- Decarboxylase E1b Length = 350 Back     alignment and structure
>gi|7546385|pdb|1DTW|B Chain B, Human Branched-Chain Alpha-Keto Acid Dehydrogenase Length = 342 Back     alignment and structure
>gi|47169248|pdb|1UM9|B Chain B, Branched-Chain 2-Oxo Acid Dehydrogenase (E1) From Thermus Thermophilus Hb8 In Apo-Form Length = 324 Back     alignment and structure