254780673
pyruvate dehydrogenase subunit beta
| GeneID in NCBI database: | 8209677 | Locus tag: | CLIBASIA_02800 |
| Protein GI in NCBI database: | 254780673 | Protein Accession: | YP_003065086.1 |
| Gene range: | -(594446, 595849) | Protein Length: | 467aa |
| Gene description: | pyruvate dehydrogenase subunit beta | ||
| COG prediction: | none | ||
| KEGG prediction: | pyruvate dehydrogenase subunit beta (EC:1.2.4.1); K00162 pyruvate dehydrogenase E1 component subunit beta [EC:1.2.4.1] | ||
| SEED prediction: | Pyruvate dehydrogenase E1 component beta subunit (EC 1.2.4.1) | ||
| Pathway involved in KEGG: | Glycolysis / Gluconeogenesis [PATH:las00010]
Citrate cycle (TCA cycle) [PATH:las00020] Pyruvate metabolism [PATH:las00620] Butanoate metabolism [PATH:las00650] Valine, leucine and isoleucine biosynthesis [PATH:las00290] | ||
| Subsystem involved in SEED: | Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate | ||
| sequence | sequence profile | ||
Prediction of Local Sequence Properties
| Source | Summary | Result |
|---|
|
|
Close Homologs Detected by BLAST or PSI-BLAST
Homolog within the Genome Detected by BLAST
Original result of BLAST against C. L. asiaticus genome
| Identity | Alignment graph | Length | Definition | E-value | |
| Target | 467 | pyruvate dehydrogenase subunit beta [Candidatus Liberib | |||
| 254780674 | 423 | pyruvate dehydrogenase complex dihydrolipoamide ac | 6e-25 | ||
| 254781052 | 436 | dihydrolipoamide succinyltransferase [Candidatus L | 6e-05 |
| >gi|254780674|ref|YP_003065087.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 423 | Back alignment |
|---|
Score = 107 bits (266), Expect = 6e-25, Method: Compositional matrix adjust.
Identities = 49/77 (63%), Positives = 61/77 (79%)
Query: 5 VTMPSLSPTMTEGNIAKWKKNEGDLIKQGDIIYEVETDKAVMEVESIDEGILGKILCPNG 64
+TMPSLSPTMTEG +AKW K EGD I GDI+ E+ETDKA+ME ES+DEGI+ +IL P G
Sbjct: 6 ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
Query: 65 TKNVKVNTPIAAILQEG 81
T+N+ VN+PI IL +
Sbjct: 66 TENIAVNSPILNILMDS 82
|
| >gi|254781052|ref|YP_003065465.1| dihydrolipoamide succinyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 436 | Back alignment |
|---|
Score = 40.4 bits (93), Expect = 6e-05, Method: Compositional matrix adjust.
Identities = 21/64 (32%), Positives = 35/64 (54%)
Query: 1 MPILVTMPSLSPTMTEGNIAKWKKNEGDLIKQGDIIYEVETDKAVMEVESIDEGILGKIL 60
M + +PSL ++ E + W K G+ ++ G+I+ E+ETDK +EV S G L ++
Sbjct: 19 MATKILVPSLGESVNEATVGTWLKEIGESVEIGEILVELETDKVTVEVPSPVSGKLHEMS 78
Query: 61 CPNG 64
G
Sbjct: 79 VAKG 82
|
Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations
Original result of PSI-BLAST first 2 iterations
| Identity | Alignment graph | Length | Definition | Round | E-value |
| Target | 467 | pyruvate dehydrogenase subunit beta [Candidatus Liberib | |||
| 315122216 | 473 | pyruvate dehydrogenase subunit beta [Candidatus Liberib | 1 | 0.0 | |
| 15965199 | 460 | pyruvate dehydrogenase subunit beta [Sinorhizobium meli | 1 | 0.0 | |
| 6164935 | 460 | pyruvate dehydrogenase beta subunit [Sinorhizobium meli | 1 | 0.0 | |
| 307321956 | 460 | Transketolase central region [Sinorhizobium meliloti AK | 1 | 0.0 | |
| 325292761 | 473 | pyruvate dehydrogenase E1 component beta subunit [Agrob | 1 | 0.0 | |
| 15888755 | 473 | pyruvate dehydrogenase subunit beta [Agrobacterium tume | 1 | 0.0 | |
| 260459501 | 465 | Transketolase central region [Mesorhizobium opportunist | 1 | 0.0 | |
| 150396297 | 465 | pyruvate dehydrogenase subunit beta [Sinorhizobium medi | 1 | 0.0 | |
| 227821847 | 455 | pyruvate dehydrogenase subunit beta [Sinorhizobium fred | 1 | 0.0 | |
| 153009390 | 465 | pyruvate dehydrogenase subunit beta [Ochrobactrum anthr | 1 | 0.0 |
| >gi|315122216|ref|YP_004062705.1| pyruvate dehydrogenase subunit beta [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 473 | Back alignment and organism information |
|---|
Score = 784 bits (2024), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 378/472 (80%), Positives = 423/472 (89%), Gaps = 6/472 (1%)
Query: 1 MPILVTMPSLSPTMTEGNIAKWKKNEGDLIKQGDIIYEVETDKAVMEVESIDEGILGKIL 60
MPIL+TMPSLSPTMTEGNIA+WKKNEGD IKQGDII EVETDKAVMEVESIDEG LGKI
Sbjct: 1 MPILITMPSLSPTMTEGNIAEWKKNEGDPIKQGDIICEVETDKAVMEVESIDEGFLGKIF 60
Query: 61 CPNGTKNVKVNTPIAAILQEGETALDIDKMLLEKPD-VAISPSSKNTTLVFSNEDNDKVD 119
P G++NVKVNTPIAAILQEGET DI+K+L ++ D + IS + + + +D ++
Sbjct: 61 FPKGSQNVKVNTPIAAILQEGETVADIEKILSKQSDSITISKKIERSVPSVPIKKDDTIN 120
Query: 120 HQKSKNDIQDSS-----FAHAPTSSITVREALRDAIAEEMRRDKDVFIMGEEVAEYQGAY 174
+Q S+ + +DSS + + PT S+TVREALRDA+AEEMR DKDVF+MGEEVAEYQGAY
Sbjct: 121 YQVSQKNTKDSSNTLESYENIPTVSMTVREALRDAMAEEMRHDKDVFVMGEEVAEYQGAY 180
Query: 175 KVTQGLLQEFGCERVIDTPITEHGFAGIGIGASFAGLKPIVEFMTFNFAMQAIDQIINSA 234
KVTQGLLQEFG ER+IDTPITEHGF GIGIGAS AGLKPIVEFMTFNFAMQAIDQIINSA
Sbjct: 181 KVTQGLLQEFGSERIIDTPITEHGFTGIGIGASLAGLKPIVEFMTFNFAMQAIDQIINSA 240
Query: 235 AKTRYMSGGQITTSIVFRGPNGAAARVAAQHSQCYAAWYSHVPGLKVVIPYTASDAKGLL 294
AKTRYMSGGQITTSIVFRGPNGAAARV AQHSQCYAAWYSH+PGLKV++PYTASDAKGLL
Sbjct: 241 AKTRYMSGGQITTSIVFRGPNGAAARVGAQHSQCYAAWYSHIPGLKVIMPYTASDAKGLL 300
Query: 295 KAAIRDPNPVIFLENEILYGSSFEVPMVDDLVIPIGRARIHRQGSDVTIISFGIGMTYAT 354
KAAIRDPNPVIFLENEILYGSSFEVP+ D+ +IPIG+ARIHR G+DVT++SFGIGMTYA
Sbjct: 301 KAAIRDPNPVIFLENEILYGSSFEVPVADNFIIPIGKARIHRPGNDVTLVSFGIGMTYAL 360
Query: 355 KAAIELEKNGIDAELIDLRTIRPMDWQTIFESVKKTGRLVTVEEGYPQSSVGSTIANQVQ 414
KA EL++ GID ELIDLRT+RP+DWQTIFESVKKTGRLVTVEEGYPQSSVGS IAN+VQ
Sbjct: 361 KAMTELKEIGIDVELIDLRTLRPIDWQTIFESVKKTGRLVTVEEGYPQSSVGSEIANRVQ 420
Query: 415 RKVFDYLDAPILTITGRDVPMPYAANLEKLALPNVDEIIESVESICYKRKAK 466
R+VFDYLDAPILTITG+DVPMPYA+NLEKLALPNVDEIIES+ES+CYKRKAK
Sbjct: 421 REVFDYLDAPILTITGKDVPMPYASNLEKLALPNVDEIIESIESVCYKRKAK 472
|
Species: Candidatus Liberibacter solanacearum Genus: Candidatus Liberibacter Family: Rhizobiaceae Order: Rhizobiales Class: Alphaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
| >gi|15965199|ref|NP_385552.1| pyruvate dehydrogenase subunit beta [Sinorhizobium meliloti 1021] Length = 460 | Back alignment and organism information |
|---|
| >gi|6164935|gb|AAF04588.1|AF190792_2 pyruvate dehydrogenase beta subunit [Sinorhizobium meliloti] Length = 460 | Back alignment and organism information |
|---|
| >gi|307321956|ref|ZP_07601337.1| Transketolase central region [Sinorhizobium meliloti AK83] Length = 460 | Back alignment and organism information |
|---|
| >gi|325292761|ref|YP_004278625.1| pyruvate dehydrogenase E1 component beta subunit [Agrobacterium sp. H13-3] Length = 473 | Back alignment and organism information |
|---|
| >gi|15888755|ref|NP_354436.1| pyruvate dehydrogenase subunit beta [Agrobacterium tumefaciens str. C58] Length = 473 | Back alignment and organism information |
|---|
| >gi|260459501|ref|ZP_05807756.1| Transketolase central region [Mesorhizobium opportunistum WSM2075] Length = 465 | Back alignment and organism information |
|---|
| >gi|150396297|ref|YP_001326764.1| pyruvate dehydrogenase subunit beta [Sinorhizobium medicae WSM419] Length = 465 | Back alignment and organism information |
|---|
| >gi|227821847|ref|YP_002825817.1| pyruvate dehydrogenase subunit beta [Sinorhizobium fredii NGR234] Length = 455 | Back alignment and organism information |
|---|
| >gi|153009390|ref|YP_001370605.1| pyruvate dehydrogenase subunit beta [Ochrobactrum anthropi ATCC 49188] Length = 465 | Back alignment and organism information |
|---|
Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch
Conserved Domains in CDD Database Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
Original result of RPS-BLASTagainst CDD database part II
| Identity | Alignment graph | Length | Definition | E-value |
| Target | 467 | pyruvate dehydrogenase subunit beta [Candidatus Liberib | ||
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit beta | 0.0 | |
| PRK09212 | 327 | PRK09212, PRK09212, pyruvate dehydrogenase subunit beta | 1e-161 | |
| PLN02683 | 356 | PLN02683, PLN02683, pyruvate dehydrogenase E1 component | 1e-149 | |
| PTZ00182 | 355 | PTZ00182, PTZ00182, 3-methyl-2-oxobutanate dehydrogenas | 1e-145 | |
| KOG0524 | 359 | KOG0524, KOG0524, KOG0524, Pyruvate dehydrogenase E1, b | 1e-134 | |
| CHL00144 | 327 | CHL00144, odpB, pyruvate dehydrogenase E1 component bet | 3e-84 | |
| KOG0525 | 362 | KOG0525, KOG0525, KOG0525, Branched chain alpha-keto ac | 2e-64 | |
| PRK12571 | 641 | PRK12571, PRK12571, 1-deoxy-D-xylulose-5-phosphate synt | 4e-10 | |
| COG0022 | 324 | COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase co | 1e-138 | |
| cd07036 | 167 | cd07036, TPP_PYR_E1-PDHc-beta_like, Pyrimidine (PYR) bi | 2e-85 | |
| pfam02779 | 174 | pfam02779, Transket_pyr, Transketolase, pyrimidine bind | 3e-47 | |
| smart00861 | 168 | smart00861, Transket_pyr, Transketolase, pyrimidine bin | 2e-34 | |
| cd06586 | 154 | cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding domai | 3e-14 | |
| cd07033 | 156 | cd07033, TPP_PYR_DXS_TK_like, Pyrimidine (PYR) binding | 1e-13 | |
| pfam02780 | 124 | pfam02780, Transketolase_C, Transketolase, C-terminal d | 1e-37 | |
| TIGR01349 | 435 | TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase compl | 5e-30 | |
| PRK11856 | 411 | PRK11856, PRK11856, branched-chain alpha-keto acid dehy | 6e-27 | |
| KOG0557 | 470 | KOG0557, KOG0557, KOG0557, Dihydrolipoamide acetyltrans | 2e-25 | |
| PLN02744 | 539 | PLN02744, PLN02744, dihydrolipoyllysine-residue acetylt | 3e-23 | |
| cd06849 | 74 | cd06849, lipoyl_domain, Lipoyl domain of the dihydrolip | 1e-21 | |
| COG0508 | 404 | COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase co | 7e-19 | |
| PRK14875 | 371 | PRK14875, PRK14875, acetoin dehydrogenase E2 subunit di | 3e-14 | |
| pfam00364 | 73 | pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | 5e-12 | |
| TIGR01347 | 403 | TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex d | 8e-12 | |
| PRK05704 | 407 | PRK05704, PRK05704, dihydrolipoamide succinyltransferas | 1e-11 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransferase; | 7e-09 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransferase; | 4e-08 | |
| KOG0559 | 457 | KOG0559, KOG0559, KOG0559, Dihydrolipoamide succinyltra | 1e-07 | |
| TIGR02927 | 590 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E | 5e-07 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltra | 3e-06 | |
| PLN02226 | 463 | PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 com | 3e-04 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltra | 0.001 | |
| cd06850 | 67 | cd06850, biotinyl_domain, The biotinyl-domain or biotin | 0.002 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltra | 0.002 | |
| COG3958 | 312 | COG3958, COG3958, Transketolase, C-terminal subunit [Ca | 3e-25 | |
| PLN02225 | 701 | PLN02225, PLN02225, 1-deoxy-D-xylulose-5-phosphate synt | 9e-09 | |
| COG1154 | 627 | COG1154, Dxs, Deoxyxylulose-5-phosphate synthase [Coenz | 4e-19 | |
| PRK05444 | 580 | PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synt | 4e-16 | |
| TIGR00204 | 617 | TIGR00204, dxs, 1-deoxy-D-xylulose-5-phosphate synthase | 2e-15 | |
| KOG0523 | 632 | KOG0523, KOG0523, KOG0523, Transketolase [Carbohydrate | 4e-12 | |
| PRK12315 | 581 | PRK12315, PRK12315, 1-deoxy-D-xylulose-5-phosphate synt | 1e-06 | |
| PLN02234 | 641 | PLN02234, PLN02234, 1-deoxy-D-xylulose-5-phosphate synt | 2e-06 | |
| cd06663 | 73 | cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domai | 7e-08 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltransferas | 2e-07 | |
| TIGR02927 | 590 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E | 6e-05 | |
| PLN02582 | 677 | PLN02582, PLN02582, 1-deoxy-D-xylulose-5-phosphate synt | 8e-06 | |
| PRK09622 | 407 | PRK09622, porA, pyruvate flavodoxin oxidoreductase subu | 0.002 |
| >gnl|CDD|183363 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|169719 PRK09212, PRK09212, pyruvate dehydrogenase subunit beta; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|178287 PLN02683, PLN02683, pyruvate dehydrogenase E1 component subunit beta | Back alignment and domain information |
|---|
| >gnl|CDD|185502 PTZ00182, PTZ00182, 3-methyl-2-oxobutanate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|35744 KOG0524, KOG0524, KOG0524, Pyruvate dehydrogenase E1, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|177066 CHL00144, odpB, pyruvate dehydrogenase E1 component beta subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|35745 KOG0525, KOG0525, KOG0525, Branched chain alpha-keto acid dehydrogenase E1, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|183601 PRK12571, PRK12571, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|30372 COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|132919 cd07036, TPP_PYR_E1-PDHc-beta_like, Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|145763 pfam02779, Transket_pyr, Transketolase, pyrimidine binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|129094 smart00861, Transket_pyr, Transketolase, pyrimidine binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|132915 cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|132916 cd07033, TPP_PYR_DXS_TK_like, Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|145764 pfam02780, Transketolase_C, Transketolase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|162311 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|183339 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|35777 KOG0557, KOG0557, KOG0557, Dihydrolipoamide acetyltransferase [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|178345 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|30854 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|144088 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|162309 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >gnl|CDD|180214 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|183338 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183338 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|35779 KOG0559, KOG0559, KOG0559, Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|131973 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|183337 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|183337 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >gnl|CDD|183337 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|33739 COG3958, COG3958, Transketolase, C-terminal subunit [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|177870 PLN02225, PLN02225, 1-deoxy-D-xylulose-5-phosphate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|31348 COG1154, Dxs, Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|180086 PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129308 TIGR00204, dxs, 1-deoxy-D-xylulose-5-phosphate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|35743 KOG0523, KOG0523, KOG0523, Transketolase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|183431 PRK12315, PRK12315, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177878 PLN02234, PLN02234, 1-deoxy-D-xylulose-5-phosphate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >gnl|CDD|185477 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131973 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|178194 PLN02582, PLN02582, 1-deoxy-D-xylulose-5-phosphate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|181999 PRK09622, porA, pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed | Back alignment and domain information |
|---|
Conserved Domains in CDD Database Detected by HHsearch
Original result of HHsearch against CDD database
| Identity | Alignment graph | Length | Definition | Probability |
| Target | 467 | pyruvate dehydrogenase subunit beta [Candidatus Liberib | ||
| PRK11892 | 464 | pyruvate dehydrogenase subunit beta; Provisional | 100.0 | |
| COG0022 | 324 | AcoB Pyruvate/2-oxoglutarate dehydrogenase complex, deh | 100.0 | |
| PTZ00182 | 355 | 3-methyl-2-oxobutanate dehydrogenase; Provisional | 100.0 | |
| PRK09212 | 327 | pyruvate dehydrogenase subunit beta; Validated | 100.0 | |
| KOG0524 | 359 | consensus | 100.0 | |
| CHL00144 | 326 | odpB pyruvate dehydrogenase E1 component beta subunit; | 100.0 | |
| KOG0525 | 362 | consensus | 100.0 | |
| COG3958 | 312 | Transketolase, C-terminal subunit [Carbohydrate transpo | 100.0 | |
| COG1154 | 627 | Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabo | 100.0 | |
| PRK05444 | 576 | 1-deoxy-D-xylulose-5-phosphate synthase; Provisional | 100.0 | |
| PRK12315 | 581 | 1-deoxy-D-xylulose-5-phosphate synthase; Provisional | 100.0 | |
| PRK12571 | 642 | 1-deoxy-D-xylulose-5-phosphate synthase; Provisional | 100.0 | |
| PRK05899 | 661 | transketolase; Reviewed | 100.0 | |
| KOG0523 | 632 | consensus | 100.0 | |
| PRK12754 | 663 | transketolase; Reviewed | 100.0 | |
| PRK12753 | 662 | transketolase; Reviewed | 99.98 | |
| TIGR00204 | 627 | dxs 1-deoxy-D-xylulose-5-phosphate synthase; InterPro: | 99.97 | |
| PTZ00089 | 670 | transketolase; Provisional | 99.92 | |
| COG0021 | 663 | TktA Transketolase [Carbohydrate transport and metaboli | 99.82 | |
| TIGR00232 | 675 | tktlase_bact transketolase; InterPro: IPR005478 Transke | 99.64 | |
| PRK12270 | 1234 | kgd alpha-ketoglutarate decarboxylase; Reviewed | 99.47 | |
| PRK09404 | 931 | kgd alpha-ketoglutarate decarboxylase; Reviewed | 99.43 | |
| KOG0451 | 913 | consensus | 98.62 | |
| PRK09405 | 886 | aceE pyruvate dehydrogenase subunit E1; Reviewed | 98.16 | |
| COG2609 | 887 | AceE Pyruvate dehydrogenase complex, dehydrogenase (E1) | 97.32 | |
| PRK13030 | 1168 | 2-oxoacid ferredoxin oxidoreductase; Provisional | 97.11 | |
| PRK09193 | 1155 | indolepyruvate ferredoxin oxidoreductase; Validated | 96.02 | |
| TIGR00239 | 990 | 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component; | 95.74 | |
| cd07036 | 167 | TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding doma | 100.0 | |
| pfam02779 | 174 | Transket_pyr Transketolase, pyrimidine binding domain. | 100.0 | |
| cd07033 | 156 | TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of | 100.0 | |
| smart00861 | 168 | Transket_pyr Transketolase, pyrimidine binding domain. | 99.96 | |
| cd06586 | 154 | TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiam | 97.15 | |
| pfam03894 | 179 | XFP D-xylulose 5-phosphate/D-fructose 6-phosphate phosp | 93.81 | |
| PRK05704 | 406 | dihydrolipoamide succinyltransferase; Validated | 99.97 | |
| PTZ00144 | 430 | dihydrolipoamide succinyltransferase; Provisional | 99.97 | |
| PRK11855 | 549 | dihydrolipoamide acetyltransferase; Reviewed | 99.96 | |
| COG0508 | 404 | AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dih | 99.95 | |
| TIGR02927 | 607 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, | 99.95 | |
| PRK11856 | 324 | branched-chain alpha-keto acid dehydrogenase subunit E2 | 99.94 | |
| TIGR02927 | 607 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, | 99.94 | |
| KOG0557 | 470 | consensus | 99.94 | |
| TIGR01347 | 435 | sucB 2-oxoglutarate dehydrogenase, E2 component, dihydr | 99.93 | |
| PRK11855 | 549 | dihydrolipoamide acetyltransferase; Reviewed | 99.93 | |
| PRK11854 | 630 | aceF dihydrolipoamide acetyltransferase; Validated | 99.92 | |
| KOG0559 | 457 | consensus | 99.86 | |
| PRK11854 | 630 | aceF dihydrolipoamide acetyltransferase; Validated | 99.85 | |
| TIGR01348 | 655 | PDHac_trf_long pyruvate dehydrogenase complex dihydroli | 99.83 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are pre | 99.8 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltr | 99.77 | |
| pfam00364 | 73 | Biotin_lipoyl Biotin-requiring enzyme. This family cove | 99.73 | |
| KOG0558 | 474 | consensus | 99.45 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carboxyl | 99.3 | |
| PRK05641 | 148 | putative acetyl-CoA carboxylase biotin carboxyl carrier | 99.09 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabolism] | 99.03 | |
| PRK06549 | 132 | acetyl-CoA carboxylase biotin carboxyl carrier protein | 99.02 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier protein | 98.95 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl carrier | 98.94 | |
| PRK07051 | 80 | hypothetical protein; Validated | 98.78 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier protein | 98.67 | |
| TIGR01108 | 616 | oadA oxaloacetate decarboxylase alpha subunit; InterPro | 98.51 | |
| TIGR02712 | 1226 | urea_carbox urea carboxylase; InterPro: IPR014084 Membe | 98.44 | |
| KOG0368 | 2196 | consensus | 97.75 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor; Rev | 97.22 | |
| TIGR03077 | 110 | not_gcvH glycine cleavage protein H homolog, Chlamydial | 97.19 | |
| PRK00624 | 113 | glycine cleavage system protein H; Provisional | 97.12 | |
| cd06848 | 96 | GCS_H Glycine cleavage H-protein. Glycine cleavage H-pr | 97.09 | |
| PRK13380 | 132 | glycine cleavage system protein H; Provisional | 96.9 | |
| PRK01202 | 127 | glycine cleavage system protein H; Provisional | 96.83 | |
| pfam01597 | 122 | GCV_H Glycine cleavage H-protein. This is a family of g | 96.81 | |
| TIGR00531 | 159 | BCCP acetyl-CoA carboxylase, biotin carboxyl carrier pr | 96.63 | |
| TIGR03309 | 256 | matur_yqeB selenium-dependent molybdenum hydroxylase sy | 96.22 | |
| PRK05352 | 448 | Na(+)-translocating NADH-quinone reductase subunit A; P | 96.02 | |
| pfam05896 | 257 | NQRA Na(+)-translocating NADH-quinone reductase subunit | 95.03 | |
| PRK06748 | 84 | hypothetical protein; Validated | 92.94 | |
| PRK12784 | 84 | hypothetical protein; Provisional | 92.33 | |
| COG1726 | 447 | NqrA Na+-transporting NADH:ubiquinone oxidoreductase, s | 90.9 | |
| KOG3373 | 172 | consensus | 90.72 | |
| pfam02780 | 124 | Transketolase_C Transketolase, C-terminal domain. The C | 99.96 | |
| PRK12999 | 1147 | pyruvate carboxylase; Reviewed | 98.77 | |
| TIGR01235 | 1169 | pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 | 98.09 | |
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and conver | 98.01 | |
| TIGR02176 | 1194 | pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoredu | 93.2 | |
| TIGR01349 | 584 | PDHac_trf_mito pyruvate dehydrogenase complex dihydroli | 99.96 | |
| TIGR01348 | 655 | PDHac_trf_long pyruvate dehydrogenase complex dihydroli | 99.88 | |
| TIGR01349 | 584 | PDHac_trf_mito pyruvate dehydrogenase complex dihydroli | 99.84 | |
| PRK08659 | 377 | 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; | 99.57 | |
| PRK07119 | 350 | 2-ketoisovalerate ferredoxin reductase; Validated | 99.55 | |
| PRK09627 | 375 | oorA 2-oxoglutarate-acceptor oxidoreductase subunit Oor | 99.51 | |
| PRK09622 | 407 | porA pyruvate flavodoxin oxidoreductase subunit alpha; | 99.28 | |
| PRK08366 | 394 | vorA 2-ketoisovalerate ferredoxin oxidoreductase subuni | 99.25 | |
| TIGR03336 | 595 | IOR_alpha indolepyruvate ferredoxin oxidoreductase, alp | 98.85 | |
| COG4231 | 640 | Indolepyruvate ferredoxin oxidoreductase, alpha and bet | 98.72 | |
| PRK13012 | 898 | 2-oxoacid dehydrogenase subunit E1; Provisional | 97.59 | |
| TIGR03186 | 889 | AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. Severa | 97.31 | |
| PRK08367 | 395 | porA pyruvate ferredoxin oxidoreductase subunit alpha; | 99.28 | |
| COG0674 | 365 | PorA Pyruvate:ferredoxin oxidoreductase and related 2-o | 98.65 | |
| TIGR00759 | 905 | aceE 2-oxo-acid dehydrogenase E1 component, homodimeric | 97.1 | |
| PRK09282 | 580 | pyruvate carboxylase subunit B; Validated | 98.78 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid | 98.28 | |
| KOG0238 | 670 | consensus | 97.04 | |
| COG0567 | 906 | SucA 2-oxoglutarate dehydrogenase complex, dehydrogenas | 98.75 | |
| KOG0450 | 1017 | consensus | 98.58 | |
| PRK05261 | 786 | putative phosphoketolase; Provisional | 97.34 | |
| COG3957 | 793 | Phosphoketolase [Carbohydrate transport and metabolism] | 98.46 | |
| KOG0369 | 1176 | consensus | 97.72 | |
| cd06251 | 287 | M14_ASTE_ASPA_like_1 A functionally uncharacterized sub | 95.97 | |
| PRK11578 | 347 | macrolide transporter subunit MacA; Provisional | 97.7 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 97.62 | |
| PRK03598 | 331 | hypothetical protein; Provisional | 97.45 | |
| PRK10476 | 348 | multidrug resistance protein MdtN; Provisional | 97.28 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisional | 97.12 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 96.93 | |
| PRK09783 | 407 | copper/silver efflux system membrane fusion protein Cus | 96.61 | |
| PRK11892 | 464 | pyruvate dehydrogenase subunit beta; Provisional | 95.76 | |
| cd06250 | 359 | M14_PaAOTO_like An uncharacterized subgroup of the Succ | 95.61 | |
| TIGR01843 | 434 | type_I_hlyD type I secretion membrane fusion protein, H | 95.22 | |
| TIGR00527 | 132 | gcvH glycine cleavage system H protein; InterPro: IPR00 | 95.2 | |
| pfam00529 | 304 | HlyD HlyD family secretion protein. | 95.13 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier protein | 94.52 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl carrier | 93.47 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carboxyl | 93.34 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabolism] | 93.29 | |
| PRK06549 | 132 | acetyl-CoA carboxylase biotin carboxyl carrier protein | 91.83 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are pre | 91.49 | |
| COG0508 | 404 | AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dih | 91.48 | |
| PRK05641 | 148 | putative acetyl-CoA carboxylase biotin carboxyl carrier | 91.36 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltr | 90.47 | |
| TIGR00998 | 379 | 8a0101 efflux pump membrane protein; InterPro: IPR00569 | 90.04 | |
| pfam01855 | 230 | POR_N domain. This family includes the N terminal struc | 97.26 | |
| cd07034 | 160 | TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding do | 97.11 | |
| cd02008 | 178 | TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR- | 93.27 | |
| KOG0559 | 457 | consensus | 97.13 | |
| PRK05704 | 406 | dihydrolipoamide succinyltransferase; Validated | 96.98 | |
| COG0509 | 131 | GcvH Glycine cleavage system H protein (lipoate-binding | 96.71 | |
| PTZ00144 | 430 | dihydrolipoamide succinyltransferase; Provisional | 96.21 | |
| PRK07051 | 80 | hypothetical protein; Validated | 94.65 | |
| PRK03598 | 331 | hypothetical protein; Provisional | 93.49 | |
| pfam00529 | 304 | HlyD HlyD family secretion protein. | 93.25 | |
| COG4656 | 529 | RnfC Predicted NADH:ubiquinone oxidoreductase, subunit | 92.39 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 91.58 | |
| PRK10476 | 348 | multidrug resistance protein MdtN; Provisional | 91.47 | |
| PRK11578 | 347 | macrolide transporter subunit MacA; Provisional | 91.12 | |
| cd06252 | 316 | M14_ASTE_ASPA_like_2 A functionally uncharacterized sub | 96.69 | |
| COG3608 | 331 | Predicted deacylase [General function prediction only] | 95.1 | |
| cd06254 | 288 | M14_ASTE_ASPA_like_4 A functionally uncharacterized sub | 94.24 | |
| cd06255 | 293 | M14_ASTE_ASPA_like_5 A functionally uncharacterized sub | 93.02 | |
| pfam04952 | 289 | AstE_AspA Succinylglutamate desuccinylase / Aspartoacyl | 91.68 | |
| TIGR03297 | 361 | Ppyr-DeCO2ase phosphonopyruvate decarboxylase. This fam | 95.8 | |
| PRK09259 | 572 | putative oxalyl-CoA decarboxylase; Validated | 94.16 | |
| TIGR01108 | 616 | oadA oxaloacetate decarboxylase alpha subunit; InterPro | 90.82 | |
| TIGR03254 | 554 | oxalate_oxc oxalyl-CoA decarboxylase. In a number of ba | 92.8 | |
| PRK11856 | 324 | branched-chain alpha-keto acid dehydrogenase subunit E2 | 90.89 |
| >PRK11892 pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >COG0022 AcoB Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00182 3-methyl-2-oxobutanate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09212 pyruvate dehydrogenase subunit beta; Validated | Back alignment and domain information |
|---|
| >KOG0524 consensus | Back alignment and domain information |
|---|
| >CHL00144 odpB pyruvate dehydrogenase E1 component beta subunit; Validated | Back alignment and domain information |
|---|
| >KOG0525 consensus | Back alignment and domain information |
|---|
| >COG3958 Transketolase, C-terminal subunit [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK05899 transketolase; Reviewed | Back alignment and domain information |
|---|
| >KOG0523 consensus | Back alignment and domain information |
|---|
| >PRK12754 transketolase; Reviewed | Back alignment and domain information |
|---|
| >PRK12753 transketolase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase; InterPro: IPR005477 DXP synthase is a thiamine diphosphate-dependent enzyme related to transketolase and the pyruvate dehydrogenase E1-beta subunit | Back alignment and domain information |
|---|
| >PTZ00089 transketolase; Provisional | Back alignment and domain information |
|---|
| >COG0021 TktA Transketolase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00232 tktlase_bact transketolase; InterPro: IPR005478 Transketolase (EC 2 | Back alignment and domain information |
|---|
| >PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK09404 kgd alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >KOG0451 consensus | Back alignment and domain information |
|---|
| >PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed | Back alignment and domain information |
|---|
| >COG2609 AceE Pyruvate dehydrogenase complex, dehydrogenase (E1) component [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated | Back alignment and domain information |
|---|
| >TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component; InterPro: IPR011603 2-oxoglutarate dehydrogenase is a key enzyme in the TCA cycle, converting 2-oxoglutarate, coenzyme A and NAD(+) to succinyl-CoA, NADH and carbon dioxide | Back alignment and domain information |
|---|
| >cd07036 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins | Back alignment and domain information |
|---|
| >pfam02779 Transket_pyr Transketolase, pyrimidine binding domain | Back alignment and domain information |
|---|
| >cd07033 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins | Back alignment and domain information |
|---|
| >smart00861 Transket_pyr Transketolase, pyrimidine binding domain | Back alignment and domain information |
|---|
| >cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes | Back alignment and domain information |
|---|
| >pfam03894 XFP D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR014276 This entry represents the mainly actinobacterial clade of the E2 component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle | Back alignment and domain information |
|---|
| >PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR014276 This entry represents the mainly actinobacterial clade of the E2 component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle | Back alignment and domain information |
|---|
| >KOG0557 consensus | Back alignment and domain information |
|---|
| >TIGR01347 sucB 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR006255 These sequences describe the TCA cycle 2-oxoglutarate system E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11854 aceF dihydrolipoamide acetyltransferase; Validated | Back alignment and domain information |
|---|
| >KOG0559 consensus | Back alignment and domain information |
|---|
| >PRK11854 aceF dihydrolipoamide acetyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006256 This group of sequences are a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and percent identity (UPGMA) trees | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >pfam00364 Biotin_lipoyl Biotin-requiring enzyme | Back alignment and domain information |
|---|
| >KOG0558 consensus | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776 This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084 Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >KOG0368 consensus | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >TIGR03077 not_gcvH glycine cleavage protein H homolog, Chlamydial | Back alignment and domain information |
|---|
| >PRK00624 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >cd06848 GCS_H Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >PRK13380 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >PRK01202 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >pfam01597 GCV_H Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein; InterPro: IPR001249 The proteins in this family are a component of the acetyl coenzyme A carboxylase complex (6 | Back alignment and domain information |
|---|
| >TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family | Back alignment and domain information |
|---|
| >PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >pfam05896 NQRA Na(+)-translocating NADH-quinone reductase subunit A (NQRA) | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK12784 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG3373 consensus | Back alignment and domain information |
|---|
| >pfam02780 Transketolase_C Transketolase, C-terminal domain | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 In the postabsorptive state, blood glucose concentration is kept constant by a combination of glycogenolysis and gluconeogenesis | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase; InterPro: IPR011895 The oxidative decarboxylation of pyruvate to acetyl-CoA, a central step in energy metabolism, can occur by two different mechanisms | Back alignment and domain information |
|---|
| >TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006257 This group of sequences represent one of several closely related clades of the dihydrolipoamide acetyltransferase subunit of the pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006256 This group of sequences are a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and percent identity (UPGMA) trees | Back alignment and domain information |
|---|
| >TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006257 This group of sequences represent one of several closely related clades of the dihydrolipoamide acetyltransferase subunit of the pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >PRK08659 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK07119 2-ketoisovalerate ferredoxin reductase; Validated | Back alignment and domain information |
|---|
| >PRK09627 oorA 2-oxoglutarate-acceptor oxidoreductase subunit OorA; Reviewed | Back alignment and domain information |
|---|
| >PRK09622 porA pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK08366 vorA 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit | Back alignment and domain information |
|---|
| >COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional | Back alignment and domain information |
|---|
| >TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase | Back alignment and domain information |
|---|
| >PRK08367 porA pyruvate ferredoxin oxidoreductase subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >COG0674 PorA Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00759 aceE 2-oxo-acid dehydrogenase E1 component, homodimeric type; InterPro: IPR004660 Most members of this family are pyruvate dehydrogenase complex, E1 component | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG0238 consensus | Back alignment and domain information |
|---|
| >COG0567 SucA 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0450 consensus | Back alignment and domain information |
|---|
| >PRK05261 putative phosphoketolase; Provisional | Back alignment and domain information |
|---|
| >COG3957 Phosphoketolase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0369 consensus | Back alignment and domain information |
|---|
| >cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >PRK03598 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >PRK11892 pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family; InterPro: IPR010129 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems | Back alignment and domain information |
|---|
| >TIGR00527 gcvH glycine cleavage system H protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes | Back alignment and domain information |
|---|
| >pfam00529 HlyD HlyD family secretion protein | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein; InterPro: IPR005694 emrA and emrB confer resistance to carbonylcyanide m-chlorophenylhydrazone, nalidixic acid, and a number of other toxic compounds | Back alignment and domain information |
|---|
| >pfam01855 POR_N domain | Back alignment and domain information |
|---|
| >cd07034 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding domain of pyruvate ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin oxidoreductase alpha subunit (IOR-alpha), and related proteins | Back alignment and domain information |
|---|
| >cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit | Back alignment and domain information |
|---|
| >KOG0559 consensus | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK03598 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >pfam00529 HlyD HlyD family secretion protein | Back alignment and domain information |
|---|
| >COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >COG3608 Predicted deacylase [General function prediction only] | Back alignment and domain information |
|---|
| >cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >pfam04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family | Back alignment and domain information |
|---|
| >TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase | Back alignment and domain information |
|---|
| >PRK09259 putative oxalyl-CoA decarboxylase; Validated | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776 This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea | Back alignment and domain information |
|---|
| >TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase | Back alignment and domain information |
|---|
| >PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch
Homologous Structures Detected by PSI-BLAST against Nonredundant Database
| Identity | Alignment graph | Length | Definition | E-value |
| Target | 467 | pyruvate dehydrogenase subunit beta [Candidatus Liberib | ||
| 2ozl_B | 341 | Human Pyruvate Dehydrogenase S264e Variant Length = | 2e-71 | |
| 3exe_B | 329 | Crystal Structure Of The Pyruvate Dehydrogenase (E1 | 3e-71 | |
| 2bp7_B | 339 | New Crystal Form Of The Pseudomonas Putida Branched | 6e-63 | |
| 1qs0_B | 338 | Crystal Structure Of Pseudomonas Putida 2-Oxoisoval | 1e-62 | |
| 1ni4_B | 341 | Human Pyruvate Dehydrogenase Length = 341 | 3e-62 | |
| 1w85_B | 324 | The Crystal Structure Of Pyruvate Dehydrogenase E1 | 7e-62 | |
| 3duf_B | 325 | Snapshots Of Catalysis In The E1 Subunit Of The Pyr | 9e-62 | |
| 2j9f_B | 350 | Human Branched-Chain Alpha-Ketoacid Dehydrogenase- | 1e-61 | |
| 1dtw_B | 342 | Human Branched-Chain Alpha-Keto Acid Dehydrogenase | 1e-61 | |
| 1um9_B | 324 | Branched-Chain 2-Oxo Acid Dehydrogenase (E1) From T | 4e-61 | |
| 1olx_B | 342 | Roles Of His291-Alpha And His146-Beta' In The Reduc | 2e-60 | |
| 2o1x_A | 629 | 1-Deoxy-D-Xylulose 5-Phosphate Synthase (Dxs) From | 5e-18 | |
| 1ik6_A | 369 | 3d Structure Of The E1beta Subunit Of Pyruvate Dehy | 1e-61 | |
| 3mos_A | 616 | The Structure Of Human Transketolase Length = 616 | 8e-22 | |
| 3ooy_A | 616 | Crystal Structure Of Human Transketolase (Tkt) Leng | 8e-22 | |
| 1zy8_L | 229 | The Crystal Structure Of Dihydrolipoamide Dehydroge | 6e-31 | |
| 1y8n_B | 128 | Crystal Structure Of The Pdk3-L2 Complex Length = 1 | 5e-26 | |
| 1fyc_A | 106 | Inner Lipoyl Domain From Human Pyruvate Dehydrogena | 2e-25 | |
| 2dnc_A | 98 | Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain | 1e-28 | |
| 3duf_I | 428 | Snapshots Of Catalysis In The E1 Subunit Of The Pyr | 2e-25 | |
| 2dne_A | 108 | Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain | 6e-24 | |
| 1lab_A | 80 | Three-Dimensional Structure Of The Lipoyl Domain Fr | 5e-23 | |
| 3crk_C | 87 | Crystal Structure Of The Pdhk2-L2 Complex. Length = | 2e-22 | |
| 1ghj_A | 79 | Solution Structure Of The Lipoyl Domain Of The 2- O | 1e-19 | |
| 1pmr_A | 80 | Lipoyl Domain From The Dihydrolipoyl Succinyltransf | 4e-19 | |
| 2o1s_A | 621 | 1-Deoxy-D-Xylulose 5-Phosphate Synthase (Dxs) From | 2e-20 |
| >gi|149242792|pdb|2OZL|B Chain B, Human Pyruvate Dehydrogenase S264e Variant Length = 341 | Back alignment and structure |
Score = 274 bits (701), Expect = 2e-71, Method: Composition-based stats.
Identities = 180/319 (56%), Positives = 240/319 (75%), Gaps = 4/319 (1%)
Query: 144 EALRDAIAEEMRRDKDVFIMGEEVAEYQGAYKVTQGLLQEFGCERVIDTPITEHGFAGIG 203
+A+ + EE+ RD+ VF++GEEVA+Y GAYKV++GL +++G +R+IDTPI+E GFAGI
Sbjct: 19 DAINQGMDEELERDEKVFLLGEEVAQYDGAYKVSRGLWKKYGDKRIIDTPISEMGFAGIA 78
Query: 204 IGASFAGLKPIVEFMTFNFAMQAIDQIINSAAKTRYMSGGQITTSIVFRGPNGAAARVAA 263
+GA+ AGL+PI EFMTFNF+MQAIDQ+INSAAKT YMSGG IVFRGPNGA+A VAA
Sbjct: 79 VGAAMAGLRPICEFMTFNFSMQAIDQVINSAAKTYYMSGGLQPVPIVFRGPNGASAGVAA 138
Query: 264 QHSQCYAAWYSHVPGLKVVIPYTASDAKGLLKAAIRDPNPVIFLENEILYGSSFEVP--- 320
QHSQC+AAWY H PGLKVV P+ + DAKGL+K+AIRD NPV+ LENE++YG FE P
Sbjct: 139 QHSQCFAAWYGHCPGLKVVSPWNSEDAKGLIKSAIRDNNPVVVLENELMYGVPFEFPPEA 198
Query: 321 MVDDLVIPIGRARIHRQGSDVTIISFGIGMTYATKAAIELEKNGIDAELIDLRTIRPMDW 380
D +IPIG+A+I RQG+ +T++S + + +AA L K G++ E+I++RTIRPMD
Sbjct: 199 QSKDFLIPIGKAKIERQGTHITVVSHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDM 258
Query: 381 QTIFESVKKTGRLVTVEEGYPQSSVGSTIANQVQRK-VFDYLDAPILTITGRDVPMPYAA 439
+TI SV KT LVTVE G+PQ VG+ I ++ F++LDAP + +TG DVPMPYA
Sbjct: 259 ETIEASVMKTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAK 318
Query: 440 NLEKLALPNVDEIIESVES 458
LE ++P V +II +++
Sbjct: 319 ILEDNSIPQVKDIIFAIKK 337
|
| >gi|215261327|pdb|3EXE|B Chain B, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 329 | Back alignment and structure |
| gi|75766369|pdb|2BP7|B Chain B, New Crystal Form Of The Pseudomonas Putida Branched-Chain Dehydrogenase (E1) Length = 339 | Back alignment and structure |
| >gi|5822331|pdb|1QS0|B Chain B, Crystal Structure Of Pseudomonas Putida 2-Oxoisovalerate Dehydrogenase (Branched-Chain Alpha-Keto Acid Dehydrogenase, E1b) Length = 338 | Back alignment and structure |
| >gi|33357460|pdb|1NI4|B Chain B, Human Pyruvate Dehydrogenase Length = 341 | Back alignment and structure |
| >gi|56966701|pdb|1W85|B Chain B, The Crystal Structure Of Pyruvate Dehydrogenase E1 Bound To The Peripheral Subunit Binding Domain Of E2 Length = 324 | Back alignment and structure |
| gi|219689225|pdb|3DUF|B Chain B, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 325 | Back alignment and structure |
| >gi|134104670|pdb|2J9F|B Chain B, Human Branched-Chain Alpha-Ketoacid Dehydrogenase- Decarboxylase E1b Length = 350 | Back alignment and structure |
| >gi|7546385|pdb|1DTW|B Chain B, Human Branched-Chain Alpha-Keto Acid Dehydrogenase Length = 342 | Back alignment and structure |
| >gi|47169248|pdb|1UM9|B Chain B, Branched-Chain 2-Oxo Acid Dehydrogenase (E1) From Thermus Thermophilus Hb8 In Apo-Form Length = 324 | Back alignment and structure |