255764490

255764490

dehydrogenase, E1 component

GeneID in NCBI database:8209676Locus tag:CLIBASIA_02795
Protein GI in NCBI database:255764490Protein Accession:YP_003065085.2
Gene range:-(595867, 596961)Protein Length:364aa
Gene description:dehydrogenase, E1 component
COG prediction:[C] Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit
KEGG prediction:dehydrogenase, E1 component; K00161 pyruvate dehydrogenase E1 component subunit alpha [EC:1.2.4.1]
SEED prediction:Pyruvate dehydrogenase E1 component alpha subunit (EC 1.2.4.1)
Pathway involved in KEGG:Glycolysis / Gluconeogenesis [PATH:las00010]
Citrate cycle (TCA cycle) [PATH:las00020]
Pyruvate metabolism [PATH:las00620]
Butanoate metabolism [PATH:las00650]
Valine, leucine and isoleucine biosynthesis [PATH:las00290]
Subsystem involved in SEED:Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP3 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360----
MYVAKQDVTVGDIKMALNPSVSAKRAATSSVDCVDIPFLEGFEVSEFNKEQELSAYRLMLLIRRFEEKAGQLYGMGMVGGFCHLCIGQEAVIVGMKMSLTEGDQMITAYREHGHILACGVDASKIMAELTGRQGGISKGKGGSMHMFSTKNGFYGGHGIVGAQVSLGTGIAFANKYRRSDKICVVCFGDGAANQGQVYESFNIAALWNLNVIYVIENNQYAMGTSVSRASAQTNFSKRGVSFNIPGMQVDGMDIRAVKATMDKAVAYCRAHKGPIIIEMLTYRYRGHSMSDPANYRTREEINEMRSNHDPIEQVRKRLLHNKWASEGDLKEIEMNVRKIINNSVEFAQSDKEPDPAELYSDILI
cEEEEEEEEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccEEEEccccHHHHHHccccHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEccHHHHHHHHHHHHHHHHccccEEEEEEccccEEcccHHHHccccHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccc
cccccccccEEEEEccccHccccccccccHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHcccccEEEEcccccccEEcccccHHHHHHHHHcccccccccccccccccccccccccccEEEcccccHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHHcccEEEEEEcccccccccHHHHccccHHHHccHHccccccEEcHHHHHHHHHHHHHHHHHHHcccccEEEEEEcEcccccccccccccccHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccc
myvakqdvtvgdikmalnpsvsakraatssvdcvdipflegfevsefnkEQELSAYRLMLLIRRFEEKAGQLYGMGMVGGFCHLCIGQEAVIVGMKMSLTEGDQMITAYREHGHILACGVDASKIMAELTgrqggiskgkggsmhmfstkngfygghgIVGAQVSLGTGIAFAnkyrrsdkicvvcfgdgaanqgqvyESFNIAALWNLNVIYVIENNQYAMGTSVSRasaqtnfskrgvsfnipgmqvdgmDIRAVKATMDKAVAYCRAHKGPIIIEMLTYryrghsmsdpanyrtREEINEMRSNHDPIEQVRKRLLHnkwasegdlKEIEMNVRKIINNSVefaqsdkepdpaelysdili
myvakqdvtvgdikmalnpsvsakraatssvDCVDIPFLegfevsefnkeQELSAYRLMLLIRRFEEKAGQLYGMGMVGGFCHLCIGQEAVIVGMKMSLTEGDQMITAYREHGHILACGVDASKIMAELTGRQGGISKGKGGSMHMFSTKNGFYGGHGIVGAQVSLGTGIAFANKYRRSDKICVVCFGDGAANQGQVYESFNIAALWNLNVIYVIENNQYAMGTSVSRASAQTNFSKrgvsfnipgmqvdGMDIRAVKATMDKAVAycrahkgpiiIEMLTYRYRGHSMSDPANYRTREEINemrsnhdpieqVRKRLLhnkwasegdlkeiEMNVRKIINNsvefaqsdkepdpaelysdili
MYVAKQDVTVGDIKMALNPSVSAKRAATSSVDCVDIPFLEGFEVSEFNKEQELSAYRLMLLIRRFEEKAGQLYGMGMVGGFCHLCIGQEAVIVGMKMSLTEGDQMITAYREHGHILACGVDASKIMAELTGRQggiskgkggsMHMFSTKNGFYGGHGIVGAQVSLGTGIAFANKYRRSDKICVVCFGDGAANQGQVYESFNIAALWNLNVIYVIENNQYAMGTSVSRASAQTNFSKRGVSFNIPGMQVDGMDIRAVKATMDKAVAYCRAHKGPIIIEMLTYRYRGHSMSDPANYRTREEINEMRSNHDPIEQVRKRLLHNKWASEGDLKEIEMNVRKIINNSVEFAQSDKEPDPAELYSDILI
**************************************************QELSAYRLMLLIRRFEEKAGQLYGMGMVGGFCHLCIGQEAVIVGMKMSLTEGDQMITAYREHGHILACGVDASKIMAELTGRQGGISKGKGGSMHMFSTKNGFYGGHGIVGAQVSLGTGIAFANKYRRSDKICVVCFGDGAANQGQVYESFNIAALWNLNVIYVIENNQYAMGTSVSRASAQTNFSKRGVSFNIPGMQVDGMDIRAVKATMDKAVAYCRAHKGPIIIEMLTYRYRGHSMSDPANYRTREEINEMRSNHDPIEQVRKRLLHNKWASEGDLKEIEMNVRKIINNSVEFAQSDKEPDPAELYSDILI
MYVAKQDVTVGDIKMALNPS*********SVDCVDIPFLEGFEVSEFNKEQELSAYRLMLLIRRFEEKAGQLYGMGMVGGFCHLCIGQEAVIVGMKMSLTEGDQMITAYREHGHILACGVDASKIMAELTGRQGGISKGKGGSMHMFSTKNGFYGGHGIVGAQVSLGTGIAFANKYRRSDKICVVCFGDGAANQGQVYESFNIAALWNLNVIYVIENNQYAMGTSVSRASAQTNFSKRGVSFNIPGMQVDGMDIRAVKATMDKAVAYCRAHKGPIIIEMLTYRYRGHSMSDPANYRTREEINEMRSNHDPIEQVRKRLLHNKWASEGDLKEIEMNVRKIINNSVEFA**********LYSDILI
**VAKQDVTVGDIKMALNPSVSAKRAATSSVDCVDIPFLEGFEVSEFNKEQELSAYRLMLLIRRFEEKAGQLYGMGMVGGFCHLCIGQEAVIVGMKMSLTEGDQMITAYREHGHILACGVDASKIMAELTGRQGGISKGKGGSMHMFSTKNGFYGGHGIVGAQVSLGTGIAFANKYRRSDKICVVCFGDGAANQGQVYESFNIAALWNLNVIYVIENNQYAMGTSVSRASAQTNFSKRGVSFNIPGMQVDGMDIRAVKATMDKAVAYCRAHKGPIIIEMLTYRYRGHSMSDPANYRTREEINEMRSNHDPIEQVRKRLLHNKWASEGDLKEIEMNVRKIINNSVEFAQSDKEPDPAELYSDILI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYVAKQDVTVGDIKMALNPSVSAKRAATSSVDCVDIPFLEGFEVSEFNKEQELSAYRLMLLIRRFEEKAGQLYGMGMVGGFCHLCIGQEAVIVGMKMSLTEGDQMITAYREHGHILACGVDASKIMAELTGRQGGISKGKGGSMHMFSTKNGFYGGHGIVGAQVSLGTGIAFANKYRRSDKICVVCFGDGAANQGQVYESFNIAALWNLNVIYVIENNQYAMGTSVSRASAQTNFSKRGVSFNIPGMQVDGMDIRAVKATMDKAVAYCRAHKGPIIIEMLTYRYRGHSMSDPANYRTREEINEMRSNHDPIEQVRKRLLHNKWASEGDLKEIEMNVRKIINNSVEFAQSDKEPDPAELYSDILI
MYVAKQDVTVGDIKMALNPSVSAKRAATSSVDCVDIPFLEGFEVSEFNKEQELSAYRLMLLIRRFEEKAGQLYGMGMVGGFCHLCIGQEAVIVGMKMSLTEGDQMITAYREHGHILACGVDASKIMAELTGRQGGISKGKGGSMHMFSTKNGFYGGHGIVGAQVSLGTGIAFANKYRRSDKICVVCFGDGAANQGQVYESFNIAALWNLNVIYVIENNQYAMGTSVSRASAQTNFSKRGVSFNIPGMQVDGMDIRAVKATMDKAVAYCRAHKGPIIIEMLTYRYRGHSMSDPANYRTREEINEMRSNHDPIEQVRKRLLHNKWASEGDLKEIEMNVRKIINNSVEFAQSDKEPDPAELYSDILI
MYVAKQDVTVGDIKMALNPSVSAKRAATSSVDCVDIPFLEGFEVSEFNKEQELSAYRLMLLIRRFEEKAGQLYGMGMVGGFCHLCIGQEAVIVGMKMSLTEGDQMITAYREHGHILACGVDASKIMAELTGRQGGISKGKGGSMHMFSTKNGFYGGHGIVGAQVSLGTGIAFANKYRRSDKICVVCFGDGAANQGQVYESFNIAALWNLNVIYVIENNQYAMGTSVSRASAQTNFSKRGVSFNIPGMQVDGMDIRAVKATMDKAVAYCRAHKGPIIIEMLTYRYRGHSMSDPANYRTREEINEMRSNHDPIEQVRKRLLHNKWASEGDLKEIEMNVRKIINNSVEFAQSDKEPDPAELYSDILI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target364 dehydrogenase, E1 component [Candidatus Liberibacter as
254781051 957 alpha-ketoglutarate decarboxylase [Candidatus Libe 5e-11
>gi|254781051|ref|YP_003065464.1| alpha-ketoglutarate decarboxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 957 Back     alignment
 Score = 60.5 bits (145), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 85/177 (48%), Gaps = 6/177 (3%)

Query: 178 RSDKICVVCFGDGA-ANQGQVYESFNIAALWNLNV---IYVIENNQYAMGTSVSRASAQT 233
           RS  + ++  GD A A QG V E+F ++ L    V   I++I NNQ    T+ S A + T
Sbjct: 367 RSRVLPLIIHGDAAFAGQGIVSETFGLSGLSGYTVAGNIHLIINNQIGFTTNPSSARSCT 426

Query: 234 NFSKRGVSFNIPGMQVDGMDIRAVKATMDKAVAYCRAHKGPIIIEMLTYRYRGHSMSDPA 293
             S    S  IP   V+G D  AV   +  AV++       ++I+++ YR  GH+  D  
Sbjct: 427 YASDISKSIGIPIFHVNGDDPEAVIRVVRMAVSFRMKFHKSVVIDIVCYRRFGHNEGDEP 486

Query: 294 NYRTREEINEMRSNHDPIEQVRKRLLHNKWASEGDLKEIEMNVRKIINNSVEFAQSD 350
           ++        +RS+   ++     L+ N+  S+ +L+ +  N  K +    E+ +S+
Sbjct: 487 SFTQPMMYKTIRSHKSVLQLYADSLMKNQVISKQELQSLANNWHKYLE--AEYKESE 541

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target364 dehydrogenase, E1 component [Candidatus Liberibacter as
315122217350 dehydrogenase, E1 component [Candidatus Liberibacter so 1 1e-167
110633982360 dehydrogenase, E1 component [Mesorhizobium sp. BNC1] Le 1 1e-142
153009389346 dehydrogenase E1 component [Ochrobactrum anthropi ATCC 1 1e-140
222085876347 pyruvate dehydrogenase alpha subunit protein [Agrobacte 1 1e-140
239832018366 pyruvate dehydrogenase (acetyl-transferring) E1 compone 1 1e-140
260459502345 pyruvate dehydrogenase (acetyl-transferring) E1 compone 1 1e-138
319783388345 pyruvate dehydrogenase (acetyl-transferring) E1 compone 1 1e-138
227821846348 pyruvate dehydrogenase E1 component alpha subunit [Sino 1 1e-137
163760091345 putative pyruvate dehydrogenase subunit [Hoeflea photot 1 1e-136
241204524348 pyruvate dehydrogenase (acetyl-transferring) E1 compone 1 1e-136
>gi|315122217|ref|YP_004062706.1| dehydrogenase, E1 component [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 350 Back     alignment and organism information
 Score =  593 bits (1528), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 283/350 (80%), Positives = 322/350 (92%)

Query: 15  MALNPSVSAKRAATSSVDCVDIPFLEGFEVSEFNKEQELSAYRLMLLIRRFEEKAGQLYG 74
           MALN S+S K    SSVD +DI F + F+VSEF+K QELSAY+ MLLIRRFEEK GQLYG
Sbjct: 1   MALNTSISGKENGISSVDHMDISFFKEFKVSEFDKTQELSAYQKMLLIRRFEEKTGQLYG 60

Query: 75  MGMVGGFCHLCIGQEAVIVGMKMSLTEGDQMITAYREHGHILACGVDASKIMAELTGRQG 134
           MG++GGFCHLCIGQEAVI+GMKM++ EGDQMITAYR+HGHIL+CGV+ASK+MAELTGRQG
Sbjct: 61  MGLIGGFCHLCIGQEAVIIGMKMAMAEGDQMITAYRDHGHILSCGVEASKVMAELTGRQG 120

Query: 135 GISKGKGGSMHMFSTKNGFYGGHGIVGAQVSLGTGIAFANKYRRSDKICVVCFGDGAANQ 194
           GISKGKGGSMHMFST+NGFYGGHGIVGAQVSLGTGIAFANKYR+SDK+CVVC GDGAANQ
Sbjct: 121 GISKGKGGSMHMFSTENGFYGGHGIVGAQVSLGTGIAFANKYRKSDKVCVVCLGDGAANQ 180

Query: 195 GQVYESFNIAALWNLNVIYVIENNQYAMGTSVSRASAQTNFSKRGVSFNIPGMQVDGMDI 254
           GQVYESFN+A LW L VIYVIENNQYAMGTSV+RASAQ N SKRG+SFNIPG+QVDGMD+
Sbjct: 181 GQVYESFNMAELWKLGVIYVIENNQYAMGTSVARASAQPNLSKRGISFNIPGIQVDGMDV 240

Query: 255 RAVKATMDKAVAYCRAHKGPIIIEMLTYRYRGHSMSDPANYRTREEINEMRSNHDPIEQV 314
           R+VKA ++KA AYCRA+KGPII+EMLTYRYRGHSMSDPA YRTR+E+N+MR+NHDPIEQV
Sbjct: 241 RSVKAAIEKATAYCRANKGPIILEMLTYRYRGHSMSDPATYRTRDEVNDMRTNHDPIEQV 300

Query: 315 RKRLLHNKWASEGDLKEIEMNVRKIINNSVEFAQSDKEPDPAELYSDILI 364
           R+RLL  KWASE DLK IEM+VRKI+N+SVEFAQSD+EP+ +ELYSDILI
Sbjct: 301 RERLLQKKWASESDLKAIEMSVRKIVNDSVEFAQSDEEPNSSELYSDILI 350


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|110633982|ref|YP_674190.1| dehydrogenase, E1 component [Mesorhizobium sp. BNC1] Length = 360 Back     alignment and organism information
>gi|153009389|ref|YP_001370604.1| dehydrogenase E1 component [Ochrobactrum anthropi ATCC 49188] Length = 346 Back     alignment and organism information
>gi|222085876|ref|YP_002544407.1| pyruvate dehydrogenase alpha subunit protein [Agrobacterium radiobacter K84] Length = 347 Back     alignment and organism information
>gi|239832018|ref|ZP_04680347.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit [Ochrobactrum intermedium LMG 3301] Length = 366 Back     alignment and organism information
>gi|260459502|ref|ZP_05807757.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit [Mesorhizobium opportunistum WSM2075] Length = 345 Back     alignment and organism information
>gi|319783388|ref|YP_004142864.1| pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 345 Back     alignment and organism information
>gi|227821846|ref|YP_002825816.1| pyruvate dehydrogenase E1 component alpha subunit [Sinorhizobium fredii NGR234] Length = 348 Back     alignment and organism information
>gi|163760091|ref|ZP_02167174.1| putative pyruvate dehydrogenase subunit [Hoeflea phototrophica DFL-43] Length = 345 Back     alignment and organism information
>gi|241204524|ref|YP_002975620.1| pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 348 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target364 dehydrogenase, E1 component [Candidatus Liberibacter as
TIGR03182315 TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E1 com 1e-155
COG1071358 COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase co 1e-113
cd02000293 cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate ( 1e-108
PLN02269362 PLN02269, PLN02269, Pyruvate dehydrogenase E1 component 1e-107
pfam00676303 pfam00676, E1_dh, Dehydrogenase E1 component 1e-101
CHL00149341 CHL00149, odpA, pyruvate dehydrogenase E1 component alp 1e-76
PLN02374433 PLN02374, PLN02374, pyruvate dehydrogenase (acetyl-tran 4e-74
TIGR03181341 TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E1 com 3e-65
KOG0225394 KOG0225, KOG0225, KOG0225, Pyruvate dehydrogenase E1, a 1e-114
KOG1182432 KOG1182, KOG1182, KOG1182, Branched chain alpha-keto ac 2e-37
COG0567 906 COG0567, SucA, 2-oxoglutarate dehydrogenase complex, de 6e-13
KOG0451 913 KOG0451, KOG0451, KOG0451, Predicted 2-oxoglutarate deh 7e-12
KOG0450 1017 KOG0450, KOG0450, KOG0450, 2-oxoglutarate dehydrogenase 2e-10
TIGR00239 929 TIGR00239, 2oxo_dh_E1, 2-oxoglutarate dehydrogenase, E1 1e-09
PRK09404 924 PRK09404, sucA, 2-oxoglutarate dehydrogenase E1 compone 0.001
cd02016265 cd02016, TPP_E1_OGDC_like, Thiamine pyrophosphate (TPP) 2e-12
cd02012255 cd02012, TPP_TK, Thiamine pyrophosphate (TPP) family, T 5e-11
cd02007195 cd02007, TPP_DXS, Thiamine pyrophosphate (TPP) family, 5e-08
COG3959243 COG3959, COG3959, Transketolase, N-terminal subunit [Ca 9e-08
KOG0523 632 KOG0523, KOG0523, KOG0523, Transketolase [Carbohydrate 3e-07
cd00568168 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) enzy 4e-06
pfam02775150 pfam02775, TPP_enzyme_C, Thiamine pyrophosphate enzyme, 1e-05
PLN02234 641 PLN02234, PLN02234, 1-deoxy-D-xylulose-5-phosphate synt 1e-05
PRK12571 641 PRK12571, PRK12571, 1-deoxy-D-xylulose-5-phosphate synt 0.002
PRK07586514 PRK07586, PRK07586, hypothetical protein; Validated 0.004
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Revie 2e-07
PLN02582 677 PLN02582, PLN02582, 1-deoxy-D-xylulose-5-phosphate synt 0.001
COG1154 627 COG1154, Dxs, Deoxyxylulose-5-phosphate synthase [Coenz 0.003
PRK05444 580 PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synt 0.002
>gnl|CDD|163176 TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>gnl|CDD|31269 COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|48163 cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>gnl|CDD|177910 PLN02269, PLN02269, Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information
>gnl|CDD|144320 pfam00676, E1_dh, Dehydrogenase E1 component Back     alignment and domain information
>gnl|CDD|177069 CHL00149, odpA, pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>gnl|CDD|178002 PLN02374, PLN02374, pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>gnl|CDD|132225 TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>gnl|CDD|35446 KOG0225, KOG0225, KOG0225, Pyruvate dehydrogenase E1, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|36396 KOG1182, KOG1182, KOG1182, Branched chain alpha-keto acid dehydrogenase complex, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|30913 COG0567, SucA, 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|35672 KOG0451, KOG0451, KOG0451, Predicted 2-oxoglutarate dehydrogenase, E1 subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|35671 KOG0450, KOG0450, KOG0450, 2-oxoglutarate dehydrogenase, E1 subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|161785 TIGR00239, 2oxo_dh_E1, 2-oxoglutarate dehydrogenase, E1 component Back     alignment and domain information
>gnl|CDD|181824 PRK09404, sucA, 2-oxoglutarate dehydrogenase E1 component; Reviewed Back     alignment and domain information
>gnl|CDD|48179 cd02016, TPP_E1_OGDC_like, Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
>gnl|CDD|48175 cd02012, TPP_TK, Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>gnl|CDD|73294 cd02007, TPP_DXS, Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>gnl|CDD|33740 COG3959, COG3959, Transketolase, N-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|35743 KOG0523, KOG0523, KOG0523, Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|48162 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>gnl|CDD|145759 pfam02775, TPP_enzyme_C, Thiamine pyrophosphate enzyme, C-terminal TPP binding domain Back     alignment and domain information
>gnl|CDD|177878 PLN02234, PLN02234, 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>gnl|CDD|183601 PRK12571, PRK12571, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|181051 PRK07586, PRK07586, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|183391 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|178194 PLN02582, PLN02582, 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>gnl|CDD|31348 COG1154, Dxs, Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>gnl|CDD|180086 PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 364 dehydrogenase, E1 component [Candidatus Liberibacter as
CHL00149343 odpA pyruvate dehydrogenase E1 component alpha subunit; 100.0
COG1071358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, deh 100.0
TIGR03182315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alph 100.0
TIGR03181341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alph 100.0
cd02000293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) famil 100.0
pfam00676303 E1_dh Dehydrogenase E1 component. This family uses thia 100.0
KOG1182432 consensus 100.0
PRK09404 931 kgd alpha-ketoglutarate decarboxylase; Reviewed 100.0
PRK12270 1234 kgd alpha-ketoglutarate decarboxylase; Reviewed 99.97
COG0567 906 SucA 2-oxoglutarate dehydrogenase complex, dehydrogenas 99.93
KOG0451 913 consensus 99.92
KOG0450 1017 consensus 99.91
TIGR00239 990 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component; 99.29
KOG0225394 consensus 100.0
cd02012255 TPP_TK Thiamine pyrophosphate (TPP) family, Transketola 99.92
cd02007195 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfam 99.84
pfam00456333 Transketolase_N Transketolase, thiamine diphosphate bin 99.84
PRK07979574 acetolactate synthase 3 catalytic subunit; Validated 99.36
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfam 99.36
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, 99.35
PRK06725570 acetolactate synthase 3 catalytic subunit; Validated 99.35
PRK07525589 sulfoacetaldehyde acetyltransferase; Validated 99.34
PRK08327568 acetolactate synthase catalytic subunit; Validated 99.34
PRK07064544 hypothetical protein; Provisional 99.32
PRK06154556 hypothetical protein; Provisional 99.32
PRK09107594 acetolactate synthase 3 catalytic subunit; Validated 99.32
PRK06546578 pyruvate dehydrogenase; Provisional 99.3
PRK08611576 pyruvate oxidase; Provisional 99.3
PRK12474518 hypothetical protein; Provisional 99.29
PRK11269591 glyoxylate carboligase; Provisional 99.29
PRK07524534 hypothetical protein; Provisional 99.29
PRK07418615 acetolactate synthase 3 catalytic subunit; Reviewed 99.28
PRK09124574 pyruvate dehydrogenase; Provisional 99.28
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 99.28
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 99.28
PRK08617552 acetolactate synthase; Reviewed 99.28
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-l 99.28
PRK05858543 hypothetical protein; Provisional 99.27
CHL00099588 ilvB acetohydroxyacid synthase large subunit 99.27
PRK06048562 acetolactate synthase 3 catalytic subunit; Reviewed 99.27
PRK08322547 acetolactate synthase; Reviewed 99.26
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolacta 99.26
PRK06112581 acetolactate synthase catalytic subunit; Validated 99.26
PRK08155564 acetolactate synthase catalytic subunit; Validated 99.26
PRK08266531 hypothetical protein; Provisional 99.26
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewed 99.25
PRK07092521 benzoylformate decarboxylase; Reviewed 99.25
PRK06457549 pyruvate dehydrogenase; Provisional 99.24
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase. Mem 99.24
PRK07449548 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic ac 99.24
PRK07586514 hypothetical protein; Validated 99.23
PRK08979572 acetolactate synthase 3 catalytic subunit; Validated 99.23
PRK06466574 acetolactate synthase 3 catalytic subunit; Validated 99.22
pfam02775150 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal 99.22
PRK08199553 acetolactate synthase 2 catalytic subunit; Validated 99.21
PRK07282566 acetolactate synthase catalytic subunit; Reviewed 99.2
cd02003205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subf 99.19
PRK07789612 acetolactate synthase 1 catalytic subunit; Validated 99.19
PRK08273597 pyruvate decarboxylase; Provisional 99.19
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subf 99.19
PRK08527560 acetolactate synthase 3 catalytic subunit; Validated 99.18
PRK06882574 acetolactate synthase 3 catalytic subunit; Validated 99.18
PRK06276586 acetolactate synthase catalytic subunit; Reviewed 99.17
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydr 99.17
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate o 99.17
PRK09259572 putative oxalyl-CoA decarboxylase; Validated 99.16
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, 99.15
TIGR03393539 indolpyr_decarb indolepyruvate decarboxylase, Erwinia f 99.14
PRK06965587 acetolactate synthase 3 catalytic subunit; Validated 99.14
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [acetolac 99.12
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number of ba 99.08
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_I 99.08
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxy 99.06
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, 99.01
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, Co 98.99
PRK11865298 pyruvate ferredoxin oxidoreductase subunit beta; Provis 98.99
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR- 98.92
cd03376235 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), 98.73
cd03375193 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglu 98.69
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subf 98.67
PRK06163202 hypothetical protein; Provisional 98.6
TIGR02720577 pyruv_oxi_spxB pyruvate oxidase; InterPro: IPR014092 Me 98.52
TIGR02418553 acolac_catab acetolactate synthase, catabolic; InterPro 98.45
cd02018237 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate 98.37
COG1013294 PorB Pyruvate:ferredoxin oxidoreductase and related 2-o 98.33
PRK09405 886 aceE pyruvate dehydrogenase subunit E1; Reviewed 98.24
KOG1185571 consensus 98.21
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. This fam 98.09
COG3961557 Pyruvate decarboxylase and related thiamine pyrophospha 98.04
TIGR03186 889 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. Severa 97.97
PRK13012 898 2-oxoacid dehydrogenase subunit E1; Provisional 97.84
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha and bet 97.45
TIGR02177302 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subun 97.39
KOG1184561 consensus 97.37
KOG4166675 consensus 97.36
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alp 97.06
COG3962617 Acetolactate synthase [Amino acid transport and metabol 96.8
cd06586154 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiam 94.47
cd07039164 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX. Thi 93.95
cd07035155 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX 90.87
TIGR00118 593 acolac_lg acetolactate synthase, large subunit, biosynt 90.42
PRK08659 377 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; 90.05
cd02016265 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E 99.89
PRK05899 661 transketolase; Reviewed 99.88
PRK12753 662 transketolase; Reviewed 99.83
PRK12754 663 transketolase; Reviewed 99.82
COG0021 663 TktA Transketolase [Carbohydrate transport and metaboli 99.81
PTZ00089 670 transketolase; Provisional 99.81
cd02017386 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) family, 99.48
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC 99.12
TIGR00118593 acolac_lg acetolactate synthase, large subunit, biosynt 99.02
PRK09628281 oorB 2-oxoglutarate-acceptor oxidoreductase subunit Oor 98.52
TIGR00204 627 dxs 1-deoxy-D-xylulose-5-phosphate synthase; InterPro: 98.51
PRK05778306 2-oxoglutarate ferredoxin oxidoreductase subunit beta; 98.44
PRK11866286 2-oxoacid ferredoxin oxidoreductase subunit beta; Provi 98.27
PRK11867280 2-oxoglutarate ferredoxin oxidoreductase subunit beta; 98.17
PRK11869284 2-oxoacid ferredoxin oxidoreductase subunit beta; Provi 97.86
COG1165566 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 96.54
PRK08366 394 vorA 2-ketoisovalerate ferredoxin oxidoreductase subuni 91.28
COG3959243 Transketolase, N-terminal subunit [Carbohydrate transpo 99.86
PRK05444 576 1-deoxy-D-xylulose-5-phosphate synthase; Provisional 99.86
PRK12315 581 1-deoxy-D-xylulose-5-phosphate synthase; Provisional 99.85
KOG0523 632 consensus 99.75
COG1154 627 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabo 99.64
PRK12571 642 1-deoxy-D-xylulose-5-phosphate synthase; Provisional 99.62
TIGR00232 675 tktlase_bact transketolase; InterPro: IPR005478 Transke 99.81
PRK11864300 2-ketoisovalerate ferredoxin oxidoreductase subunit bet 99.03
pfam09364379 XFP_N XFP N-terminal domain. Bacterial enzyme splits fr 98.66
PRK05261 786 putative phosphoketolase; Provisional 98.59
cd02011227 TPP_PK Thiamine pyrophosphate (TPP) family, Phosphoketo 98.59
COG3960592 Glyoxylate carboligase [General function prediction onl 97.89
COG3957 793 Phosphoketolase [Carbohydrate transport and metabolism] 97.68
TIGR01504593 glyox_carbo_lig glyoxylate carboligase; InterPro: IPR00 97.46
COG2609 887 AceE Pyruvate dehydrogenase complex, dehydrogenase (E1) 98.42
TIGR00759 905 aceE 2-oxo-acid dehydrogenase E1 component, homodimeric 97.94
cd03377365 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), PFOR_ 95.95
cd07038162 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain o 92.13
PRK07525589 sulfoacetaldehyde acetyltransferase; Validated 91.52
PRK09259 572 putative oxalyl-CoA decarboxylase; Validated 90.95
TIGR03457 579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase. Mem 90.89
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>pfam00676 E1_dh Dehydrogenase E1 component Back     alignment and domain information
>KOG1182 consensus Back     alignment and domain information
>PRK09404 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>COG0567 SucA 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>KOG0451 consensus Back     alignment and domain information
>KOG0450 consensus Back     alignment and domain information
>TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component; InterPro: IPR011603 2-oxoglutarate dehydrogenase is a key enzyme in the TCA cycle, converting 2-oxoglutarate, coenzyme A and NAD(+) to succinyl-CoA, NADH and carbon dioxide Back     alignment and domain information
>KOG0225 consensus Back     alignment and domain information
>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>pfam00456 Transketolase_N Transketolase, thiamine diphosphate binding domain Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK07449 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase; Validated Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>pfam02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain Back     alignment and domain information
>PRK08199 acetolactate synthase 2 catalytic subunit; Validated Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK08273 pyruvate decarboxylase; Provisional Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria Back     alignment and domain information
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase; InterPro: IPR014092 Members of this family are examples of pyruvate oxidase (1 Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic; InterPro: IPR012782 Acetolactate synthase is a thiamin pyrophosphate-dependent enzyme that combines two molecules of pyruvate to yield 2-acetolactate with the release of CO2 Back     alignment and domain information
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways Back     alignment and domain information
>COG1013 PorB Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed Back     alignment and domain information
>KOG1185 consensus Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase Back     alignment and domain information
>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family; InterPro: IPR011896 A number of anaerobic and microaerophilic species lack pyruvate dehydrogenase and have instead a four subunit, oxygen-sensitive pyruvate oxidoreductase, with either ferredoxins or flavodoxins used as the acceptor Back     alignment and domain information
>KOG1184 consensus Back     alignment and domain information
>KOG4166 consensus Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>COG3962 Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>cd07039 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>cd07035 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type; InterPro: IPR012846 Two groups of proteins form acetolactate from two molecules of pyruvate Back     alignment and domain information
>PRK08659 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; Validated Back     alignment and domain information
>cd02016 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>COG0021 TktA Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>cd02017 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) family, E1 of E Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type; InterPro: IPR012846 Two groups of proteins form acetolactate from two molecules of pyruvate Back     alignment and domain information
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase; InterPro: IPR005477 DXP synthase is a thiamine diphosphate-dependent enzyme related to transketolase and the pyruvate dehydrogenase E1-beta subunit Back     alignment and domain information
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated Back     alignment and domain information
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed Back     alignment and domain information
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>COG1165 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK08366 vorA 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>COG3959 Transketolase, N-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>KOG0523 consensus Back     alignment and domain information
>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase; InterPro: IPR005478 Transketolase (EC 2 Back     alignment and domain information
>PRK11864 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>pfam09364 XFP_N XFP N-terminal domain Back     alignment and domain information
>PRK05261 putative phosphoketolase; Provisional Back     alignment and domain information
>cd02011 TPP_PK Thiamine pyrophosphate (TPP) family, Phosphoketolase (PK) subfamily, TPP-binding module; PK catalyzes the conversion of D-xylulose 5-phosphate and phosphate to acetyl phosphate, D-glyceraldehyde-3-phosphate and H2O Back     alignment and domain information
>COG3960 Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>COG3957 Phosphoketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase; InterPro: IPR006397 This family represents glyoxylate carboligase, also called tartronate-semialdehyde synthase Back     alignment and domain information
>COG2609 AceE Pyruvate dehydrogenase complex, dehydrogenase (E1) component [Energy production and conversion] Back     alignment and domain information
>TIGR00759 aceE 2-oxo-acid dehydrogenase E1 component, homodimeric type; InterPro: IPR004660 Most members of this family are pyruvate dehydrogenase complex, E1 component Back     alignment and domain information
>cd03377 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), PFOR_PNO subfamily, TPP-binding module; composed of proteins similar to the single subunit pyruvate ferredoxin oxidoreductase (PFOR) of Desulfovibrio Africanus, present in bacteria and amitochondriate eukaryotes Back     alignment and domain information
>cd07038 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target364 dehydrogenase, E1 component [Candidatus Liberibacter as
3exe_A382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 3e-55
2ozl_A365 Human Pyruvate Dehydrogenase S264e Variant Length = 5e-55
3exf_A382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 6e-55
3exh_C382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 6e-55
3exi_A382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 2e-54
1ni4_A365 Human Pyruvate Dehydrogenase Length = 365 3e-52
1x7y_A400 Crystal Structure Of The Human Mitochondrial Branch 4e-48
1dtw_A400 Human Branched-Chain Alpha-Keto Acid Dehydrogenase 5e-48
1x7w_A400 Crystal Structure Of The Human Mitochondrial Branch 5e-48
1x80_A400 Crystal Structure Of The Human Mitochondrial Branch 6e-48
1x7z_A400 Crystal Structure Of The Human Mitochondrial Branch 6e-48
1x7x_A400 Crystal Structure Of The Human Mitochondrial Branch 6e-48
2j9f_A400 Human Branched-Chain Alpha-Ketoacid Dehydrogenase- 7e-48
1olu_A400 Roles Of His291-Alpha And His146-Beta' In The Reduc 9e-48
2bff_A400 Reactivity Modulation Of Human Branched-Chain Alpha 1e-47
1v16_A400 Crosstalk Between Cofactor Binding And The Phosphor 9e-47
2bfb_A400 Reactivity Modulation Of Human Branched-Chain Alpha 1e-46
1v11_A400 Crosstalk Between Cofactor Binding And The Phosphor 4e-46
2bfc_A400 Reactivity Modulation Of Human Branched-Chain Alpha 6e-46
2bfe_A399 Reactivity Modulation Of Human Branched-Chain Alpha 7e-46
2bfd_A400 Reactivity Modulation Of Human Branched-Chain Alpha 3e-45
1w88_A368 The Crystal Structure Of Pyruvate Dehydrogenase E1( 3e-43
1w85_A368 The Crystal Structure Of Pyruvate Dehydrogenase E1 3e-43
3duf_A369 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 3e-43
3dva_A369 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 3e-43
1um9_A367 Branched-Chain 2-Oxo Acid Dehydrogenase (E1) From T 1e-42
2bp7_A410 New Crystal Form Of The Pseudomonas Putida Branched 1e-39
1qs0_A407 Crystal Structure Of Pseudomonas Putida 2-Oxoisoval 8e-35
>gi|215261326|pdb|3EXE|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
 Score =  220 bits (560), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 173/343 (50%), Positives = 226/343 (65%), Gaps = 6/343 (1%)

Query: 23  AKRAATSSVDCVDIPFLEGFEVSE-FNKEQELSAYRLMLLIRRFEEKAGQLYGMGMVGGF 81
           A  A      C      EG  V+    +E  L  YR+M  +RR E KA QLY   ++ GF
Sbjct: 23  ANDATFEIKKCDLHRLEEGPPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGF 82

Query: 82  CHLCIGQEAVIVGMKMSLTEGDQMITAYREHGHILACGVDASKIMAELTGRQGGISKGKG 141
           CHLC GQEA  VG++  +   D +ITAYR HG     G+   +I+AELTGR+GG +KGKG
Sbjct: 83  CHLCDGQEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTGRKGGCAKGKG 142

Query: 142 GSMHMFSTKNGFYGGHGIVGAQVSLGTGIAFANKYRRSDKICVVCFGDGAANQGQVYESF 201
           GS  M      FYGG+GIVGAQV LG GIA A KY   D++C+  +GDGAANQGQ++E++
Sbjct: 143 GS--MHMYAKNFYGGNGIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAY 200

Query: 202 NIAALWNLNVIYVIENNQYAMGTSVSRASAQTNFSKRGVSFNIPGMQVDGMDIRAVKATM 261
           N+AALW L  I++ ENN+Y MGTSV RA+A T++ KRG    IPG++VDGMDI  V+   
Sbjct: 201 NMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGD--FIPGLRVDGMDILCVREAT 258

Query: 262 DKAVAYCRAHKGPIIIEMLTYRYRGHSMSDPA-NYRTREEINEMRSNHDPIEQVRKRLLH 320
             A AYCR+ KGPI++E+ TYRY GHSMSDP  +YRTREEI E+RS  DPI  ++ R+++
Sbjct: 259 RFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMVN 318

Query: 321 NKWASEGDLKEIEMNVRKIINNSVEFAQSDKEPDPAELYSDIL 363
           +  AS  +LKEI++ VRK I ++ +FA +D EP   EL   I 
Sbjct: 319 SNLASVEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY 361


>gi|149242791|pdb|2OZL|A Chain A, Human Pyruvate Dehydrogenase S264e Variant Length = 365 Back     alignment and structure
>gi|215261334|pdb|3EXF|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>gi|215261376|pdb|3EXH|C Chain C, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>gi|215261382|pdb|3EXI|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex With The Subunit-Binding Domain (Sbd) Of E2p, But Sbd Cannot Be Modeled Into The Electron Density Length = 382 Back     alignment and structure
>gi|33357459|pdb|1NI4|A Chain A, Human Pyruvate Dehydrogenase Length = 365 Back     alignment and structure
>gi|56967004|pdb|1X7Y|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha-Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>gi|7546384|pdb|1DTW|A Chain A, Human Branched-Chain Alpha-Keto Acid Dehydrogenase Length = 400 Back     alignment and structure
>gi|56967000|pdb|1X7W|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha-Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>gi|56967008|pdb|1X80|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha-Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>gi|56967006|pdb|1X7Z|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha-Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>gi|56967002|pdb|1X7X|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha-Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>gi|134104669|pdb|2J9F|A Chain A, Human Branched-Chain Alpha-Ketoacid Dehydrogenase- Decarboxylase E1b Length = 400 Back     alignment and structure
>gi|34810149|pdb|1OLU|A Chain A, Roles Of His291-Alpha And His146-Beta' In The Reductive Acylation Reaction Catalyzed By Human Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>gi|90108861|pdb|2BFF|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>gi|49259447|pdb|1V16|A Chain A, Crosstalk Between Cofactor Binding And The Phosphorylation Loop Conformation In The Bckd Machine Length = 400 Back     alignment and structure
>gi|90108853|pdb|2BFB|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>gi|49259445|pdb|1V11|A Chain A, Crosstalk Between Cofactor Binding And The Phosphorylation Loop Conformation In The Bckd Machine Length = 400 Back     alignment and structure
>gi|90108855|pdb|2BFC|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>gi|157881366|pdb|2BFE|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 399 Back     alignment and structure
>gi|90108857|pdb|2BFD|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>gi|56966713|pdb|1W88|A Chain A, The Crystal Structure Of Pyruvate Dehydrogenase E1(D180n, E183q) Bound To The Peripheral Subunit Binding Domain Of E2 Length = 368 Back     alignment and structure
>gi|56966700|pdb|1W85|A Chain A, The Crystal Structure Of Pyruvate Dehydrogenase E1 Bound To The Peripheral Subunit Binding Domain Of E2 Length = 368 Back     alignment and structure
gi|219689224|pdb|3DUF|A Chain A, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 369 Back     alignment and structure