254780675

254780675

dihydrolipoamide dehydrogenase

GeneID in NCBI database:8209679Locus tag:CLIBASIA_02810
Protein GI in NCBI database:254780675Protein Accession:YP_003065088.1
Gene range:-(591645, 593090)Protein Length:481aa
Gene description:dihydrolipoamide dehydrogenase
COG prediction:[C] Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes
KEGG prediction:lpdA; dihydrolipoamide dehydrogenase (EC:1.8.1.4); K00382 dihydrolipoamide dehydrogenase [EC:1.8.1.4]
SEED prediction:Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4)
Pathway involved in KEGG:Glycolysis / Gluconeogenesis [PATH:las00010]
Citrate cycle (TCA cycle) [PATH:las00020]
Pyruvate metabolism [PATH:las00620]
Glycine, serine and threonine metabolism [PATH:las00260]
Valine, leucine and isoleucine degradation [PATH:las00280]
Subsystem involved in SEED:Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate;
TCA Cycle
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-
MSRLYDIILIGSGPAGYVAAIRAAQLGFKVAIVEYAGLGGICLNWGCIPTKSLLRSAEILDHIQNAQHYGLNVAGKVEFNIEDIVKRSRDISHRLNRGVEFLMHKNKVDIIWGKATLKNPSEITVSKPSQPAVQPQHPIPKKVLGEGTYKAKHIIIATGARPRHIEGIEPDSHLIWTYFDALKPSKTPKSLIVMGSGAIGVEFSSFYKSLDVDVSLIEVKDRILPVEDSEISQFVQRSLQKRGIKILTESKISSVKQKGDMVSVQVERKDGSVSSMQAEKLLLSAGVQGNIENIGLEKIGVKTSNGCIIVDGYGRTNVPGIYAIGDVAGAPMLAHKAEHEGIICIEKIAGKSKVYPLDKSKIPGCTYCNPQVASIGLTEEKARSQGLDIRVGKHSFSANGKAITLGEDSGMIKTIFNNKTGEVLGVHMVGPEVTELIQGFSIAMSLETTEEELMHTVFPHPTISETMKESILDAYGRAIHS
ccccEEEEEEcccHHHHHHHHHHHHccccEEEEEccccccEEEEcccccccccccHHHHHHHHHHHcccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcEEEEccccEEEEEEcccEEEEcccccEEEEEccEEEEccEEEEEccccccccccccccccEEccHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEEcccccEEEEEccEEEEEcccccccccccHHHccccHHccEEEEccccccccccEEEccccccccccHHHHHHHHHHHHHHHccccccccEEcccEEEEEEEcccEEEEcccHHHHHHccccEEEEEEEEcccccEEEccccccEEEEEEEccccEEEEEEEEcccHHHHHHHHHHHHHccccHHHHHccccccccHHHHHHHHHHHHHcccccc
EEEEEEEEEEcccccHHHHHHHHHHccccEEEEccccccHHHHHHcHHHHHHHHHHHHHHHHHcccHHHcccccccccccHHHHHHHHHHHHHHHcccHHHHHccccEEEEEEEEEEccccEEEEEcccccEEcccccccccccccEEEEEEEEEEcccEEEccccccccccccEEcHHHHccccccccEEEEEcccHHHHHHHHHHHHHccEEEEEEccccccccccHHHHHHHHHHHHHcccEEEEcEEEEEEEEEccccEEEEEEEEcccccEEcccEEEcccEEEccccccHHHccccEEcccEccccccEcccccEEEcHHHHcccccHHHHHHHHHHHHHHHHccccccccccccccEEEcccccEEEEEccHHHHHHHcccEEEEEEEccccHHHHHccccccEEEEEEEccccEEEEEEEEEccHHHHHHHHHHHHHcccEHHHHHccccccccccHHHHHHHHHHHcccccc
MSRLYDIILIGSGPAGYVAAIRAAQLGFKVAIVEYAGLggiclnwgciptkslLRSAEILDHIQNAQHYglnvagkvefNIEDIVKRSRDISHRLNRGVEFLMHKNKVDIIWgkatlknpseitvskpsqpavqpqhpipkkvlgegtyKAKHIIIatgarprhiegiepdshLIWTYFdalkpsktpkslivmGSGAIGVEFSSFyksldvdvslievkdrilpvedseISQFVQRSLQKRGIKILTeskissvkqkgdMVSVQVerkdgsvssMQAEKLLLSAGvqgnieniglekigvktsngciivdgygrtnvpgiyaigdvagapmlahkaeHEGIICIEKIagkskvypldkskipgctycnpqvasigltEEKArsqgldirvgkhsfsangkaitlgedsGMIKTIFNnktgevlgvhmvgpevTELIQGFSIAMSLETTEEELmhtvfphptisetMKESILDAYGRAIHS
MSRLYDIILIGSGPAGYVAAIRAAQLGFKVAIVEYAGLGGICLNWGCIPTKSLLRSAEILDHIQNAQHYGLNVAGKVEFNIEDIVKRSRDISHRlnrgveflmhknkVDIIWGKATLKNPSEITvskpsqpavqpqhpipkkvlgegTYKAKHIIIatgarprhiEGIEPDSHLIWTYFDALKPSKTPKSLIVMGSGAIGVEFSSFYKSLDVDVSLIEVKdrilpvedseisqfvqrslqkrgikilteskissvkqkgdmvsVQVERKDGSVSSMQAEKLLLSAGVQGNIENIGlekigvktsNGCIIVDGYGRTNVPGIYAIGDVAGAPMLAHKAEHEGIICIEKIAGKSKVYPLDKSKIPGCTYCNPQVASIGLTEEKARSQGLdirvgkhsfsangkaitlgedsgMIKTIFNNKTGEVLGVHMVGPEVTELIQGFSIAMSLETTEEELMHTvfphptisetmKESILDAYGRAIHS
MSRLYDIILIGSGPAGYVAAIRAAQLGFKVAIVEYAGLGGICLNWGCIPTKSLLRSAEILDHIQNAQHYGLNVAGKVEFNIEDIVKRSRDISHRLNRGVEFLMHKNKVDIIWGKATLKNPSEITVSKPSQPAVQPQHPIPKKVLGEGTYKAKHIIIATGARPRHIEGIEPDSHLIWTYFDALKPSKTPKSLIVMGSGAIGVEFSSFYKSLDVDVSLIEVKDRILPVEDSEISQFVQRSLQKRGIKILTESKISSVKQKGDMVSVQVERKDGSVSSMQAEKLLLSAGVQGNIENIGLEKIGVKTSNGCIIVDGYGRTNVPGIYAIGDVAGAPMLAHKAEHEGIICIEKIAGKSKVYPLDKSKIPGCTYCNPQVASIGLTEEKARSQGLDIRVGKHSFSANGKAITLGEDSGMIKTIFNNKTGEVLGVHMVGPEVTELIQGFSIAMSLETTEEELMHTVFPHPTISETMKESILDAYGRAIHS
*SRLYDIILIGSGPAGYVAAIRAAQLGFKVAIVEYAGLGGICLNWGCIPTKSLLRSAEILDHIQNAQHYGLNVAGKVEFNIEDIVKRSRDI*HRLNRGVEFLMHKNKVDIIWGKATLKNPSEITVSK*********H*IPKKVLGEGTYKAKHIIIATGARPRHIEGIEPDSHLIWTYFDALKPSKTPKSLIVMGSGAIGVEFSSFYKSLDVDVSLIEVKDRILPVEDSEISQFVQRSLQKRGIKILTESKISSVKQKGDMVSVQVERKDGSVSSMQAEKLLLSAGVQGNIENIGLEKIGVKTSNGCIIVDGYGRTNVPGIYAIGDVAGAPMLAHKAEHEGIICIEKIAGKSKVYPLDKSKIPGCTYCNPQVASIGLTEEKARSQGLDIRVGKHSFSANGKAITLGEDSGMIKTIFNNKTGEVLGVHMVGPEVTELIQGFSIAMSLETTEEELMHTVFPHPTISETMKESILDAYGRAIH*
MSRLYDIILIGSGPAGYVAAIRAAQLGFKVAIVEYAGLGGICLNWGCIPTKSLLRSAEILDHIQNAQHYGLNVAGKVEFNIEDIVKRSRDISHRLNRGVEFLMHKNKVDIIWGKATLKNPSEI*************HPIPKKVLGEGTYKAKHIIIATGARPRHIEGIEPDSHLIWTYFDALKPSKTPKSLIVMGSGAIGVEFSSFYKSLDVDVSLIEVKDRILPVEDSEISQFVQRSLQKRGIKILTESKISSVKQKGDMVSVQVERKDGSVSSMQAEKLLLSAGVQGNIENIGLEKIGVKTSNGCIIVDGYGRTNVPGIYAIGDVAGAPMLAHKAEHEGIICIEKIAGKSKVYPLDKSKIPGCTYCNPQVASIGLTEEKARSQGLDIRVGKHSFSANGKAITLGEDSGMIKTIFNNKTGEVLGVHMVGPEVTELIQGFSIAMSLETTEEELMHTVFPHPTISETMKESILDAYGRAIHS
MSRLYDIILIGSGPAGYVAAIRAAQLGFKVAIVEYAGLGGICLNWGCIPTKSLLRSAEILDHIQNAQHYGLNVAGKVEFNIEDIVKRSRDISHRLNRGVEFLMHKNKVDIIWGKATLKNPSEITVSKPSQPAVQPQHPIPKKVLGEGTYKAKHIIIATGARPRHIEGIEPDSHLIWTYFDALKPSKTPKSLIVMGSGAIGVEFSSFYKSLDVDVSLIEVKDRILPVEDSEISQFVQRSLQKRGIKILTESKISSVKQKGDMVSVQVERKDGSVSSMQAEKLLLSAGVQGNIENIGLEKIGVKTSNGCIIVDGYGRTNVPGIYAIGDVAGAPMLAHKAEHEGIICIEKIAGKSKVYPLDKSKIPGCTYCNPQVASIGLTEEKARSQGLDIRVGKHSFSANGKAITLGEDSGMIKTIFNNKTGEVLGVHMVGPEVTELIQGFSIAMSLETTEEELMHTVFPHPTISETMKESILDAYG*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxhhhhhhhhhhhhhhhhhhhhxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRLYDIILIGSGPAGYVAAIRAAQLGFKVAIVEYAGLGGICLNWGCIPTKSLLRSAEILDHIQNAQHYGLNVAGKVEFNIEDIVKRSRDISHRLNRGVEFLMHKNKVDIIWGKATLKNPSEITVSKPSQPAVQPQHPIPKKVLGEGTYKAKHIIIATGARPRHIEGIEPDSHLIWTYFDALKPSKTPKSLIVMGSGAIGVEFSSFYKSLDVDVSLIEVKDRILPVEDSEISQFVQRSLQKRGIKILTESKISSVKQKGDMVSVQVERKDGSVSSMQAEKLLLSAGVQGNIENIGLEKIGVKTSNGCIIVDGYGRTNVPGIYAIGDVAGAPMLAHKAEHEGIICIEKIAGKSKVYPLDKSKIPGCTYCNPQVASIGLTEEKARSQGLDIRVGKHSFSANGKAITLGEDSGMIKTIFNNKTGEVLGVHMVGPEVTELIQGFSIAMSLETTEEELMHTVFPHPTISETMKESILDAYGRAIHS
MSRLYDIILIGSGPAGYVAAIRAAQLGFKVAIVEYAGLGGICLNWGCIPTKSLLRSAEILDHIQNAQHYGLNVAGKVEFNIEDIVKRSRDISHRLNRGVEFLMHKNKVDIIWGKATLKNPSEITVSKPSQPAVQPQHPIPKKVLGEGTYKAKHIIIATGARPRHIEGIEPDSHLIWTYFDALKPSKTPKSLIVMGSGAIGVEFSSFYKSLDVDVSLIEVKDRILPVEDSEISQFVQRSLQKRGIKILTESKISSVKQKGDMVSVQVERKDGSVSSMQAEKLLLSAGVQGNIENIGLEKIGVKTSNGCIIVDGYGRTNVPGIYAIGDVAGAPMLAHKAEHEGIICIEKIAGKSKVYPLDKSKIPGCTYCNPQVASIGLTEEKARSQGLDIRVGKHSFSANGKAITLGEDSGMIKTIFNNKTGEVLGVHMVGPEVTELIQGFSIAMSLETTEEELMHTVFPHPTISETMKESILDAYGRAIHS
MSRLYDIILIGSGPAGYVAAIRAAQLGFKVAIVEYAGLGGICLNWGCIPTKSLLRSAEILDHIQNAQHYGLNVAGKVEFNIEDIVKRSRDISHRLNRGVEFLMHKNKVDIIWGKATLKNPSEITVSKPSQPAVQPQHPIPKKVLGEGTYKAKHIIIATGARPRHIEGIEPDSHLIWTYFDALKPSKTPKSLIVMGSGAIGVEFSSFYKSLDVDVSLIEVKDRILPVEDSEISQFVQRSLQKRGIKILTESKISSVKQKGDMVSVQVERKDGSVSSMQAEKLLLSAGVQGNIENIGLEKIGVKTSNGCIIVDGYGRTNVPGIYAIGDVAGAPMLAHKAEHEGIICIEKIAGKSKVYPLDKSKIPGCTYCNPQVASIGLTEEKARSQGLDIRVGKHSFSANGKAITLGEDSGMIKTIFNNKTGEVLGVHMVGPEVTELIQGFSIAMSLETTEEELMHTVFPHPTISETMKESILDAYGRAIHS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target481 dihydrolipoamide dehydrogenase [Candidatus Liberibacter
254781053466 dihydrolipoamide dehydrogenase [Candidatus Liberib 4e-73
254781055461 glutathione reductase [Candidatus Liberibacter asi 2e-49
254780283321 thioredoxin reductase (NADPH) protein [Candidatus 3e-04
254780842384 2-octaprenyl-6-methoxyphenyl hydroxylase [Candidat 0.001
>gi|254781053|ref|YP_003065466.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 466 Back     alignment
 Score =  267 bits (682), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 174/482 (36%), Positives = 270/482 (56%), Gaps = 23/482 (4%)

Query: 4   LYDIILIGSGPAGYVAAIRAAQLGFKVAIVEY-AGLGGICLNWGCIPTKSLLRSAEILDH 62
           +YD+ ++G GPAGY  AI+AAQL  KVAI+E     GG CLN GCIP+K+LL ++E+  H
Sbjct: 2   VYDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEKTYGGTCLNIGCIPSKALLHASEMYSH 61

Query: 63  I-QNAQHYGLNVAGKVEFNIEDIVKRSRDISHRLNRGVEFLMHKNKVDIIWGKATLKNPS 121
           I + A   G+N+A     +++ ++   + I     +G+ FL+ KNK+    G A + + +
Sbjct: 62  IAKEAGDLGINIA-SCHLDLKKMMSYKKSIVESNTQGINFLLKKNKIITYHGSARIVSNN 120

Query: 122 EITVSKPSQPAVQPQHPIPKKVLGEGTYKAKHIIIATGARPRHIEG--IEPDSHLIWTYF 179
           +I V   S                E T +AK+I+IATG+    + G  I+ D  +I +  
Sbjct: 121 KILVKGSSS---------------EETIEAKNIVIATGSEASGLPGMSIDFDEQVIVSST 165

Query: 180 DALKPSKTPKSLIVMGSGAIGVEFSSFYKSLDVDVSLIEVKDRILPVEDSEISQFVQRSL 239
            AL  S  PK+L+V+G+G IG+E  S +  L   V +IE    IL   D EI+    + +
Sbjct: 166 GALSFSSVPKNLLVIGAGVIGLELGSVWTRLGSCVKIIEHSGTILNGMDKEIAAHCLKIM 225

Query: 240 QKRGIKILTESKISSVKQKGDMVSVQVERKDGSVSSMQAEKLLLSAGVQGNIENIGLEKI 299
            K+G+     SK+SSVK+      V     D    +++A+ +L++AG +   + +GLE+I
Sbjct: 226 SKQGMNFQLNSKVSSVKKVKGKAQVVYRSTDDEPINIEADAVLVAAGRRPYTKGLGLEEI 285

Query: 300 GVKTSN-GCIIVDGYGRTNVPGIYAIGDVAGAPMLAHKAEHEGIICIEKIAGKSKVYPLD 358
           G+   + GCI + G  +T++  IYAIGDV   PMLAHKAE EGI   E I+G+     ++
Sbjct: 286 GINIDHRGCIEIGGQFQTSISTIYAIGDVVRGPMLAHKAEDEGIAVAEIISGQKG--HVN 343

Query: 359 KSKIPGCTYCNPQVASIGLTEEKARSQGLDIRVGKHSFSANGKAITLGEDSGMIKTIFNN 418
              IP   Y +P+VASIG TEE+ + +    +VGK  FSANG+A ++    G +K + N 
Sbjct: 344 YGIIPSVVYTHPEVASIGKTEEQLKCEKKSYKVGKFPFSANGRARSMNSIDGFVKILANE 403

Query: 419 KTGEVLGVHMVGPEVTELIQGFSIAMSLETTEEELMHTVFPHPTISETMKESILDAYGRA 478
           K+  V GVH++G    E+I   ++ M    + E+L      HPT+SE ++E+ L  + + 
Sbjct: 404 KSDRVEGVHIIGGSAGEMIHEAAVLMEFGGSSEDLARICHAHPTMSEAVREAALSCFDQP 463

Query: 479 IH 480
           IH
Sbjct: 464 IH 465

>gi|254781055|ref|YP_003065468.1| glutathione reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Back     alignment
 Score =  188 bits (477), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 131/469 (27%), Positives = 232/469 (49%), Gaps = 28/469 (5%)

Query: 1   MSRLYDIILIGSGPAGYVAAIRAAQLGFKVAIVEYAGLGGICLNWGCIPTKSLLRSAEIL 60
           M   YD+++IG+G +G  +A  AAQLG KVAI E   +GG C+  GCIP K +  +++  
Sbjct: 1   MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYS 60

Query: 61  DHIQNAQHYGLNVAGKVEFNIEDIVKRSRDISHRLNRGVEFLMHKNKVDIIWGKATLKNP 120
           ++ +++Q +G +V  K  F+ + ++        RL       +    V+I   K  L +P
Sbjct: 61  EYFEDSQGFGWSVDHK-SFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSP 119

Query: 121 SEITVSKPSQPAVQPQHPIPKKVLGEGTYKAKHIIIATGARPRHIEGIEPDSHLIWTYFD 180
             + ++  ++                 T  +++I+++TG  P  ++     S L  T  +
Sbjct: 120 HSVYIANLNR-----------------TITSRYIVVSTGGSPNRMDF--KGSDLCITSDE 160

Query: 181 ALKPSKTPKSLIVMGSGAIGVEFSSFYKSLDVDVSLIEVKDRILPVEDSEISQFVQRSLQ 240
                  P+S +++G G I VEF+    SL    +L+   + IL   DS+I Q +   + 
Sbjct: 161 IFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMI 220

Query: 241 KRGIKILTESKISS-VKQKGDMVSVQVERKDGSVSSMQAEKLLLSAGVQGNIENIGLEKI 299
            RG+++     I S V + G + S+    K G +  ++ ++++L+ G       IGLEK+
Sbjct: 221 SRGMQVFHNDTIESVVSESGQLKSI---LKSGKI--VKTDQVILAVGRTPRTTGIGLEKV 275

Query: 300 GVKTS-NGCIIVDGYGRTNVPGIYAIGDVAGAPMLAHKAEHEGIICIEKIAGKSKVYPLD 358
           GVK   NG II D Y RTNV  I+++GD++G   L   A H     +E +   +   P D
Sbjct: 276 GVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIP-D 334

Query: 359 KSKIPGCTYCNPQVASIGLTEEKARSQGLDIRVGKHSFSANGKAITLGEDSGMIKTIFNN 418
              +P   +  P++AS+GLTEE+A  +   + + K  F      ++   +  ++K I + 
Sbjct: 335 YDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHA 394

Query: 419 KTGEVLGVHMVGPEVTELIQGFSIAMSLETTEEELMHTVFPHPTISETM 467
              +VLGVH++G E +E+IQ   + +     +++    +  HPT SE +
Sbjct: 395 DNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEEL 443

>gi|254780283|ref|YP_003064696.1| thioredoxin reductase (NADPH) protein [Candidatus Liberibacter asiaticus str. psy62] Length = 321 Back     alignment
 Score = 38.1 bits (87), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 24/34 (70%)

Query: 7  IILIGSGPAGYVAAIRAAQLGFKVAIVEYAGLGG 40
          I++IGSGPAGY AAI AA+   K  I+  + LGG
Sbjct: 8  ILIIGSGPAGYTAAIYAARAMLKPVIIAGSDLGG 41

>gi|254780842|ref|YP_003065255.1| 2-octaprenyl-6-methoxyphenyl hydroxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 384 Back     alignment
 Score = 36.2 bits (82), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 23/29 (79%)

Query: 5  YDIILIGSGPAGYVAAIRAAQLGFKVAIV 33
          +D+I+IGSG AG VAAI AA+ GF  A+V
Sbjct: 4  FDVIIIGSGLAGSVAAIGAAKKGFLTALV 32

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target481 dihydrolipoamide dehydrogenase [Candidatus Liberibacter
315122214481 dihydrolipoamide dehydrogenase [Candidatus Liberibacter 1 0.0
150396301481 dihydrolipoamide dehydrogenase [Sinorhizobium medicae W 1 0.0
15965203481 dihydrolipoamide dehydrogenase [Sinorhizobium meliloti 1 0.0
222148561481 dihydrolipoamide dehydrogenase [Agrobacterium vitis S4] 1 0.0
307321960481 dihydrolipoamide dehydrogenase [Sinorhizobium meliloti 1 0.0
307942234482 dihydrolipoyl dehydrogenase [Roseibium sp. TrichSKD4] L 1 0.0
254504095482 dihydrolipoamide dehydrogenase [Labrenzia alexandrii DF 1 0.0
227821852481 dihydrolipoamide dehydrogenase [Sinorhizobium fredii NG 1 0.0
227820166479 dihydrolipoamide dehydrogenase [Sinorhizobium fredii NG 1 0.0
118589903482 dihydrolipoamide dehydrogenase [Stappia aggregata IAM 1 1 0.0
>gi|315122214|ref|YP_004062703.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 481 Back     alignment and organism information
 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/481 (86%), Positives = 453/481 (94%)

Query: 1   MSRLYDIILIGSGPAGYVAAIRAAQLGFKVAIVEYAGLGGICLNWGCIPTKSLLRSAEIL 60
           MS+ Y++I+IGSGPAGYV AIRAAQLGFKVAIVEY  LGGICLNWGCIPTKSLLRSAE+ 
Sbjct: 1   MSKSYEVIVIGSGPAGYVCAIRAAQLGFKVAIVEYDSLGGICLNWGCIPTKSLLRSAEMF 60

Query: 61  DHIQNAQHYGLNVAGKVEFNIEDIVKRSRDISHRLNRGVEFLMHKNKVDIIWGKATLKNP 120
           DHI+NAQHYG+N+ GK++ NIEDIVKRSR+ISHRLNRGVEFLMHKNK+DIIWGKA LK P
Sbjct: 61  DHIKNAQHYGINIEGKIKSNIEDIVKRSRNISHRLNRGVEFLMHKNKIDIIWGKAVLKTP 120

Query: 121 SEITVSKPSQPAVQPQHPIPKKVLGEGTYKAKHIIIATGARPRHIEGIEPDSHLIWTYFD 180
           SEI VSK S+PAVQPQHPIPKK+LGE TY AKHIIIATGARPR+I GIEPD HL+WTYFD
Sbjct: 121 SEIVVSKSSKPAVQPQHPIPKKILGEDTYTAKHIIIATGARPRNISGIEPDGHLVWTYFD 180

Query: 181 ALKPSKTPKSLIVMGSGAIGVEFSSFYKSLDVDVSLIEVKDRILPVEDSEISQFVQRSLQ 240
           ALKPSKTPKSLIVMGSGAIGVEFSSFYKSL+VDVSLIEVKDRILP ED EISQFVQ+SLQ
Sbjct: 181 ALKPSKTPKSLIVMGSGAIGVEFSSFYKSLNVDVSLIEVKDRILPTEDLEISQFVQKSLQ 240

Query: 241 KRGIKILTESKISSVKQKGDMVSVQVERKDGSVSSMQAEKLLLSAGVQGNIENIGLEKIG 300
            RGIKILTESKIS++K KGD VSVQVE KDGSVSS++AE+LLLSAGVQGNIENIGLE++G
Sbjct: 241 NRGIKILTESKISNIKTKGDTVSVQVENKDGSVSSLKAERLLLSAGVQGNIENIGLEELG 300

Query: 301 VKTSNGCIIVDGYGRTNVPGIYAIGDVAGAPMLAHKAEHEGIICIEKIAGKSKVYPLDKS 360
           VKT+NGCI++D YG TN+PGIYAIGDVAGAPMLAHKAEHEGIICIEKIAG S V P+DK+
Sbjct: 301 VKTNNGCIVIDDYGNTNIPGIYAIGDVAGAPMLAHKAEHEGIICIEKIAGISNVSPIDKT 360

Query: 361 KIPGCTYCNPQVASIGLTEEKARSQGLDIRVGKHSFSANGKAITLGEDSGMIKTIFNNKT 420
           KIPGCTYCNPQ+ASIGLTEEKAR QGLDIRVGKH+FSANGKAITLGED+GMIKTIF+NKT
Sbjct: 361 KIPGCTYCNPQIASIGLTEEKAREQGLDIRVGKHNFSANGKAITLGEDAGMIKTIFDNKT 420

Query: 421 GEVLGVHMVGPEVTELIQGFSIAMSLETTEEELMHTVFPHPTISETMKESILDAYGRAIH 480
           GE+LGVHMVGPEVTELIQG SIAM+LETTEEELMHT+FPHPT+SETMKESILDAYGRAIH
Sbjct: 421 GELLGVHMVGPEVTELIQGVSIAMNLETTEEELMHTIFPHPTLSETMKESILDAYGRAIH 480

Query: 481 S 481
           S
Sbjct: 481 S 481


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150396301|ref|YP_001326768.1| dihydrolipoamide dehydrogenase [Sinorhizobium medicae WSM419] Length = 481 Back     alignment and organism information
>gi|15965203|ref|NP_385556.1| dihydrolipoamide dehydrogenase [Sinorhizobium meliloti 1021] Length = 481 Back     alignment and organism information
>gi|222148561|ref|YP_002549518.1| dihydrolipoamide dehydrogenase [Agrobacterium vitis S4] Length = 481 Back     alignment and organism information
>gi|307321960|ref|ZP_07601341.1| dihydrolipoamide dehydrogenase [Sinorhizobium meliloti AK83] Length = 481 Back     alignment and organism information
>gi|307942234|ref|ZP_07657585.1| dihydrolipoyl dehydrogenase [Roseibium sp. TrichSKD4] Length = 482 Back     alignment and organism information
>gi|254504095|ref|ZP_05116246.1| dihydrolipoamide dehydrogenase [Labrenzia alexandrii DFL-11] Length = 482 Back     alignment and organism information
>gi|227821852|ref|YP_002825822.1| dihydrolipoamide dehydrogenase [Sinorhizobium fredii NGR234] Length = 481 Back     alignment and organism information
>gi|227820166|ref|YP_002824137.1| dihydrolipoamide dehydrogenase [Sinorhizobium fredii NGR234] Length = 479 Back     alignment and organism information
>gi|118589903|ref|ZP_01547307.1| dihydrolipoamide dehydrogenase [Stappia aggregata IAM 12614] Length = 482 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target481 dihydrolipoamide dehydrogenase [Candidatus Liberibacter
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Rev 0.0
TIGR01350461 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase 1e-163
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Val 1e-133
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Val 1e-129
PRK07818466 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Rev 1e-122
PRK06327475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Val 1e-122
KOG1335506 KOG1335, KOG1335, KOG1335, Dihydrolipoamide dehydrogena 1e-103
PRK06912458 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validat 1e-101
PRK06467471 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Rev 1e-100
PRK06115466 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Rev 1e-95
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 1e-94
TIGR02053463 TIGR02053, MerA, mercuric reductase 2e-87
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide transhy 3e-79
PRK06116450 PRK06116, PRK06116, glutathione reductase; Validated 3e-78
TIGR01424446 TIGR01424, gluta_reduc_2, glutathione-disulfide reducta 7e-67
KOG0405478 KOG0405, KOG0405, KOG0405, Pyridine nucleotide-disulphi 1e-66
TIGR01421450 TIGR01421, gluta_reduc_1, glutathione-disulfide reducta 4e-62
PRK07845466 PRK07845, PRK07845, flavoprotein disulfide reductase; R 2e-60
PLN02507499 PLN02507, PLN02507, glutathione reductase 2e-58
PRK07251438 PRK07251, PRK07251, pyridine nucleotide-disulfide oxido 6e-58
PRK07846451 PRK07846, PRK07846, mycothione reductase; Reviewed 1e-57
PTZ00153659 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provisiona 2e-56
TIGR03452452 TIGR03452, mycothione_red, mycothione reductase 1e-53
TIGR01438484 TIGR01438, TGR, thioredoxin and glutathione reductase s 2e-51
PRK14727479 PRK14727, PRK14727, putative mercuric reductase; Provis 3e-50
PRK14694468 PRK14694, PRK14694, putative mercuric reductase; Provis 6e-50
PTZ00058561 PTZ00058, PTZ00058, glutathione reductase; Provisional 1e-49
KOG4716503 KOG4716, KOG4716, KOG4716, Thioredoxin reductase [Postt 2e-48
PRK13748561 PRK13748, PRK13748, putative mercuric reductase; Provis 2e-46
TIGR01423486 TIGR01423, trypano_reduc, trypanothione-disulfide reduc 3e-46
PRK08010441 PRK08010, PRK08010, pyridine nucleotide-disulfide oxido 1e-45
PLN02546558 PLN02546, PLN02546, glutathione reductase 5e-45
PTZ00052499 PTZ00052, PTZ00052, thioredoxin reductase; Provisional 3e-40
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase com 1e-136
pfam07992277 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide 2e-53
COG3634520 COG3634, AhpF, Alkyl hydroperoxide reductase, large sub 4e-11
TIGR03140515 TIGR03140, AhpF, alkyl hydroperoxide reductase, F subun 9e-08
KOG0404322 KOG0404, KOG0404, KOG0404, Thioredoxin reductase [Postt 3e-07
pfam02852110 pfam02852, Pyr_redox_dim, Pyridine nucleotide-disulphid 6e-36
TIGR03385427 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase 4e-24
PRK09564444 PRK09564, PRK09564, coenzyme A disulfide reductase; Rev 4e-21
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehyd 2e-17
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide ox 4e-17
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing subuni 5e-17
KOG1336478 KOG1336, KOG1336, KOG1336, Monodehydroascorbate/ferredo 6e-17
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslational 7e-16
PTZ00318424 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Pr 5e-10
KOG2495491 KOG2495, KOG2495, KOG2495, NADH-dehydrogenase (ubiquino 6e-10
PRK13512438 PRK13512, PRK13512, coenzyme A disulfide reductase; Pro 2e-07
COG1251 793 COG1251, NirB, NAD(P)H-nitrite reductase [Energy produc 8e-13
TIGR02374 785 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], 1e-11
TIGR01292300 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase 3e-11
PRK09754396 PRK09754, PRK09754, phenylpropionate dioxygenase ferred 9e-09
TIGR03169364 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide 5e-05
KOG1346659 KOG1346, KOG1346, KOG1346, Programmed cell death 8 (apo 1e-04
TIGR01316449 TIGR01316, gltA, glutamate synthase (NADPH), homotetram 5e-04
PRK14989 847 PRK14989, PRK14989, nitrite reductase subunit NirD; Pro 7e-04
PRK04965377 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase 1e-08
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy p 4e-07
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase family 2e-05
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase 9e-05
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 7e-07
PRK05329422 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehy 3e-05
PRK06134581 PRK06134, PRK06134, putative FAD-binding dehydrogenase; 3e-05
pfam01134391 pfam01134, GIDA, Glucose inhibited division protein A 2e-04
PRK04176257 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase 4e-04
COG1635262 COG1635, THI4, Flavoprotein involved in thiazole biosyn 0.002
PRK12839572 PRK12839, PRK12839, hypothetical protein; Provisional 0.002
PRK07843557 PRK07843, PRK07843, 3-ketosteroid-delta-1-dehydrogenase 2e-06
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and related pr 5e-06
TIGR01292300 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase 2e-05
COG1053562 COG1053, SdhA, Succinate dehydrogenase/fumarate reducta 3e-05
pfam03486405 pfam03486, HI0933_like, HI0933-like protein 7e-05
TIGR03143555 TIGR03143, AhpF_homolog, putative alkyl hydroperoxide r 9e-05
PRK07494388 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydrox 2e-04
COG2081408 COG2081, COG2081, Predicted flavoproteins [General func 3e-04
TIGR03378419 TIGR03378, glycerol3P_GlpB, glycerol-3-phosphate dehydr 5e-04
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslational 6e-04
PRK12834549 PRK12834, PRK12834, putative FAD-binding dehydrogenase; 0.001
PRK07803 626 PRK07803, sdhA, succinate dehydrogenase flavoprotein su 0.001
TIGR00275400 TIGR00275, TIGR00275, flavoprotein, HI0933 family 0.002
PRK15317517 PRK15317, PRK15317, alkyl hydroperoxide reductase subun 0.003
PRK12843 578 PRK12843, PRK12843, putative FAD-binding dehydrogenase; 2e-04
PRK07804541 PRK07804, PRK07804, L-aspartate oxidase; Provisional 6e-04
COG0029518 COG0029, NadB, Aspartate oxidase [Coenzyme metabolism] 9e-04
TIGR00551488 TIGR00551, nadB, L-aspartate oxidase 0.002
PRK08071510 PRK08071, PRK08071, L-aspartate oxidase; Provisional 0.003
PRK15317517 PRK15317, PRK15317, alkyl hydroperoxide reductase subun 6e-04
>gnl|CDD|180558 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|162312 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|180333 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180516 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181132 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180529 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|36549 KOG1335, KOG1335, KOG1335, Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180743 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180579 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180409 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180546 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|162675 TIGR02053, MerA, mercuric reductase Back     alignment and domain information
>gnl|CDD|179973 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180410 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|162352 TIGR01424, gluta_reduc_2, glutathione-disulfide reductase, plant Back     alignment and domain information
>gnl|CDD|35626 KOG0405, KOG0405, KOG0405, Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|130488 TIGR01421, gluta_reduc_1, glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>gnl|CDD|181141 PRK07845, PRK07845, flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|178123 PLN02507, PLN02507, glutathione reductase Back     alignment and domain information
>gnl|CDD|180907 PRK07251, PRK07251, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181142 PRK07846, PRK07846, mycothione reductase; Reviewed Back     alignment and domain information
>gnl|CDD|173442 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|132493 TIGR03452, mycothione_red, mycothione reductase Back     alignment and domain information
>gnl|CDD|162359 TIGR01438, TGR, thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>gnl|CDD|173190 PRK14727, PRK14727, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|173157 PRK14694, PRK14694, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|185420 PTZ00058, PTZ00058, glutathione reductase; Provisional Back     alignment and domain information
>gnl|CDD|39914 KOG4716, KOG4716, KOG4716, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|130490 TIGR01423, trypano_reduc, trypanothione-disulfide reductase Back     alignment and domain information
>gnl|CDD|181196 PRK08010, PRK08010, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|178161 PLN02546, PLN02546, glutathione reductase Back     alignment and domain information
>gnl|CDD|185416 PTZ00052, PTZ00052, thioredoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|31441 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|149204 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|33432 COG3634, AhpF, Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|163151 TIGR03140, AhpF, alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>gnl|CDD|35625 KOG0404, KOG0404, KOG0404, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|145812 pfam02852, Pyr_redox_dim, Pyridine nucleotide-disulphide oxidoreductase, dimerization domain Back     alignment and domain information
>gnl|CDD|163244 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase Back     alignment and domain information
>gnl|CDD|181958 PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|30795 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|143852 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|31444 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|36550 KOG1336, KOG1336, KOG1336, Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|30838 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185553 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|37706 KOG2495, KOG2495, KOG2495, NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|184103 PRK13512, PRK13512, coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>gnl|CDD|31443 COG1251, NirB, NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162827 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>gnl|CDD|162288 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase Back     alignment and domain information
>gnl|CDD|170080 PRK09754, PRK09754, phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>gnl|CDD|163170 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|36560 KOG1346, KOG1346, KOG1346, Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>gnl|CDD|184951 PRK14989, PRK14989, nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>gnl|CDD|179902 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|30989 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162668 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|30999 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|144475 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|180019 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|180419 PRK06134, PRK06134, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|144651 pfam01134, GIDA, Glucose inhibited division protein A Back     alignment and domain information
>gnl|CDD|179767 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|31822 COG1635, THI4, Flavoprotein involved in thiazole biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|171762 PRK12839, PRK12839, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181140 PRK07843, PRK07843, 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|31426 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|162288 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase Back     alignment and domain information
>gnl|CDD|31253 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|146239 pfam03486, HI0933_like, HI0933-like protein Back     alignment and domain information
>gnl|CDD|132187 TIGR03143, AhpF_homolog, putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>gnl|CDD|181001 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|32264 COG2081, COG2081, Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|132421 TIGR03378, glycerol3P_GlpB, glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>gnl|CDD|30838 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183782 PRK12834, PRK12834, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|181124 PRK07803, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|161797 TIGR00275, TIGR00275, flavoprotein, HI0933 family Back     alignment and domain information
>gnl|CDD|185217 PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|183786 PRK12843, PRK12843, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|181125 PRK07804, PRK07804, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|30379 COG0029, NadB, Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|161923 TIGR00551, nadB, L-aspartate oxidase Back     alignment and domain information
>gnl|CDD|181220 PRK08071, PRK08071, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|185217 PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 481 dihydrolipoamide dehydrogenase [Candidatus Liberibacter
TIGR01350481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 100.0
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK13748561 putative mercuric reductase; Provisional 100.0
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK05976464 dihydrolipoamide dehydrogenase; Validated 100.0
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 100.0
PTZ00153673 lipoamide dehydrogenase; Provisional 100.0
PRK06327475 dihydrolipoamide dehydrogenase; Validated 100.0
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 100.0
PRK06370459 mercuric reductase; Validated 100.0
TIGR02053494 MerA mercuric reductase; InterPro: IPR011796 This entry 100.0
PRK07845467 flavoprotein disulfide reductase; Reviewed 100.0
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 100.0
PRK06292460 dihydrolipoamide dehydrogenase; Validated 100.0
PRK07846453 mycothione/glutathione reductase; Reviewed 100.0
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 100.0
PRK06116450 glutathione reductase; Validated 100.0
PTZ00052541 thioredoxin reductase; Provisional 100.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 100.0
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 100.0
KOG1335506 consensus 100.0
TIGR01421475 gluta_reduc_1 glutathione-disulfide reductase; InterPro 100.0
TIGR01424478 gluta_reduc_2 glutathione-disulfide reductase; InterPro 100.0
TIGR01438513 TGR thioredoxin and glutathione reductase; InterPro: IP 100.0
KOG0405478 consensus 100.0
KOG4716503 consensus 100.0
PRK09564443 coenzyme A disulfide reductase; Reviewed 100.0
PRK13512438 coenzyme A disulfide reductase; Provisional 100.0
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 100.0
TIGR01423486 trypano_reduc trypanothione-disulfide reductase; InterP 100.0
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 100.0
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production and c 99.98
PRK04965378 nitric oxide reductase; Provisional 100.0
TIGR02374 813 nitri_red_nirB nitrite reductase [NAD(P)H], large subun 100.0
KOG1336478 consensus 99.95
KOG1346659 consensus 99.86
TIGR01292321 TRX_reduct thioredoxin-disulfide reductase; InterPro: I 100.0
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductase F s 100.0
PRK12770350 putative glutamate synthase subunit beta; Provisional 100.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 100.0
PRK10262321 thioredoxin reductase; Provisional 100.0
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 100.0
COG0492305 TrxB Thioredoxin reductase [Posttranslational modificat 100.0
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 100.0
PRK11749460 putative oxidoreductase; Provisional 100.0
PRK098531032 putative selenate reductase subunit YgfK; Provisional 100.0
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 100.0
PRK12814652 putative NADPH-dependent glutamate synthase small subun 100.0
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 100.0
PRK12831464 putative oxidoreductase; Provisional 100.0
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 100.0
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 100.0
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 100.0
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 99.98
PRK12778760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 99.97
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 99.97
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 99.97
PRK13984604 putative oxidoreductase; Provisional 99.97
PRK12779 944 putative bifunctional glutamate synthase subunit beta/2 99.97
PRK12775 993 putative trifunctional 2-polyprenylphenol hydroxylase/g 99.97
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 99.94
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit [Post 99.94
KOG2495491 consensus 99.93
KOG0404322 consensus 99.92
COG0493457 GltD NADPH-dependent glutamate synthase beta chain and 99.87
TIGR01372 1026 soxA sarcosine oxidase, alpha subunit family; InterPro: 99.81
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 99.81
KOG03992142 consensus 99.8
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary metabo 99.51
KOG1399448 consensus 99.44
KOG1800468 consensus 99.19
PTZ00188506 adrenodoxin reductase; Provisional 98.98
PTZ00318514 NADH dehydrogenase; Provisional 99.97
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases 99.96
pfam02852110 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreduc 99.95
COG2072443 TrkA Predicted flavoprotein involved in K+ transport [I 99.57
PRK09897535 hypothetical protein; Provisional 98.02
COG1148622 HdrA Heterodisulfide reductase, subunit A and related p 99.54
KOG2755334 consensus 99.42
KOG3851446 consensus 99.38
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.5
PRK07803 631 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.48
PRK09077535 L-aspartate oxidase; Provisional 99.47
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.41
PRK07395556 L-aspartate oxidase; Provisional 99.41
PRK09231582 fumarate reductase flavoprotein subunit; Validated 99.41
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.41
PTZ00139 622 succinate dehydrogenase (flavoprotein) subunit; Provisi 99.4
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.4
PRK08071510 L-aspartate oxidase; Provisional 99.38
PRK07804533 L-aspartate oxidase; Provisional 99.38
PRK06263539 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.38
PRK13800 894 putative oxidoreductase/HEAT repeat-containing protein; 99.37
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.37
PRK06069582 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.35
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.34
PRK07512507 L-aspartate oxidase; Provisional 99.34
PRK06854 610 adenylylsulfate reductase; Validated 99.32
PRK06175433 L-aspartate oxidase; Provisional 99.31
PRK08626 657 fumarate reductase flavoprotein subunit; Provisional 99.29
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.27
PRK08401464 L-aspartate oxidase; Provisional 99.26
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 99.25
PRK12842567 putative succinate dehydrogenase; Reviewed 99.24
PRK07573 638 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.24
COG2081408 Predicted flavoproteins [General function prediction on 99.19
PRK06134579 putative FAD-binding dehydrogenase; Reviewed 99.17
PRK12839574 hypothetical protein; Provisional 99.16
PRK07843560 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.16
PRK12843576 putative FAD-binding dehydrogenase; Reviewed 99.09
PRK12844552 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.08
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.07
PRK10015429 hypothetical protein; Provisional 99.06
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.06
PRK12845566 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.02
PRK07121491 hypothetical protein; Validated 99.01
TIGR02032343 GG-red-SF geranylgeranyl reductase family; InterPro: IP 99.0
PRK08274456 tricarballylate dehydrogenase; Validated 98.94
PRK06184503 hypothetical protein; Provisional 98.9
PRK12837515 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.89
TIGR01813487 flavo_cyto_c flavocytochrome c; InterPro: IPR010960 Thi 98.88
pfam00890401 FAD_binding_2 FAD binding domain. This family includes 98.88
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy production 98.88
PRK06183554 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validat 98.84
PRK06834488 hypothetical protein; Provisional 98.83
PRK10157428 putative oxidoreductase FixC; Provisional 98.83
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 98.79
TIGR00551546 nadB L-aspartate oxidase; InterPro: IPR005288 L-asparta 98.78
PRK08132549 hypothetical protein; Provisional 98.76
PRK09126392 hypothetical protein; Provisional 98.76
PRK13369503 glycerol-3-phosphate dehydrogenase; Provisional 98.74
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 98.7
PRK08244494 hypothetical protein; Provisional 98.69
PRK08163396 salicylate hydroxylase; Provisional 98.68
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreductase. T 98.67
PRK08294 634 phenol 2-monooxygenase; Provisional 98.65
PRK06126545 hypothetical protein; Provisional 98.65
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethylamino 98.64
PRK06475400 salicylate hydroxylase; Provisional 98.63
PRK07190480 hypothetical protein; Provisional 98.6
PRK08774402 consensus 98.59
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.59
PRK11445348 putative oxidoreductase; Provisional 98.54
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 98.5
PRK05335434 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 98.49
KOG2415621 consensus 98.46
PRK12266503 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.44
PRK06996397 hypothetical protein; Provisional 98.43
TIGR00292283 TIGR00292 thiazole biosynthesis enzyme; InterPro: IPR00 98.43
TIGR02023408 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 98.43
COG2509486 Uncharacterized FAD-dependent dehydrogenases [General f 98.42
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 98.41
KOG0042 680 consensus 98.38
TIGR02485467 CobZ_N-term precorrin 3B synthase CobZ; InterPro: IPR01 98.36
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 98.36
KOG0029501 consensus 98.35
pfam01946229 Thi4 Thi4 family. This family includes a putative thiam 98.33
PRK06185409 hypothetical protein; Provisional 98.31
PRK07608389 hypothetical protein; Provisional 98.29
TIGR00031390 UDP-GALP_mutase UDP-galactopyranose mutase; InterPro: I 98.29
PRK07364413 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 98.29
PRK08013400 hypothetical protein; Provisional 98.25
PRK01747660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 98.23
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRP 98.23
PRK02106555 choline dehydrogenase; Validated 98.23
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; Revi 98.19
PRK11101545 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; P 98.17
PRK09564443 coenzyme A disulfide reductase; Reviewed 98.16
PRK13512438 coenzyme A disulfide reductase; Provisional 98.13
TIGR02734526 crtI_fam phytoene desaturase; InterPro: IPR014105 Phyto 98.13
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, flavop 98.12
COG1231450 Monoamine oxidase [Amino acid transport and metabolism] 98.04
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 98.02
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biogenesi 97.99
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 97.95
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 97.93
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 97.93
PRK07045388 putative monooxygenase; Reviewed 97.89
PRK11883452 protoporphyrinogen oxidase; Reviewed 97.88
PRK05976464 dihydrolipoamide dehydrogenase; Validated 97.88
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 97.85
PRK06847375 hypothetical protein; Provisional 97.85
TIGR01373407 soxB sarcosine oxidase, beta subunit family; InterPro: 97.85
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 97.83
PRK07588391 hypothetical protein; Provisional 97.82
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.8
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 97.78
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases 97.77
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 97.75
PRK07538413 hypothetical protein; Provisional 97.74
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 97.73
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.73
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.72
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [General fun 97.72
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 97.72
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 97.71
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.71
PRK07845467 flavoprotein disulfide reductase; Reviewed 97.68
PRK05868372 hypothetical protein; Validated 97.68
PRK07236386 hypothetical protein; Provisional 97.68
TIGR01816 615 sdhA_forward succinate dehydrogenase, flavoprotein subu 97.66
PRK06116450 glutathione reductase; Validated 97.66
PRK06753373 hypothetical protein; Provisional 97.66
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.66
KOG2820399 consensus 97.65
COG3349485 Uncharacterized conserved protein [Function unknown] 97.64
PRK06370459 mercuric reductase; Validated 97.63
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 97.63
PTZ00052541 thioredoxin reductase; Provisional 97.59
PRK07846453 mycothione/glutathione reductase; Reviewed 97.58
KOG2404477 consensus 97.56
pfam05834374 Lycopene_cycl Lycopene cyclase protein. This family con 97.55
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] 97.51
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductase F s 97.48
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.46
PRK12416466 protoporphyrinogen oxidase; Provisional 97.43
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 97.42
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 97.4
KOG4254561 consensus 97.37
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Members of 97.34
COG3573552 Predicted oxidoreductase [General function prediction o 97.33
TIGR02730506 carot_isom carotene isomerase; InterPro: IPR014101 Memb 97.18
TIGR01812 636 sdhA_frdA_Gneg succinate dehydrogenase or fumarate redu 97.18
pfam00996439 GDI GDP dissociation inhibitor. 97.12
KOG0685498 consensus 97.09
TIGR01984425 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase; InterP 97.08
KOG1298509 consensus 97.06
TIGR01989481 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6; InterP 97.04
KOG2844 856 consensus 96.98
TIGR02360393 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase; Inter 96.91
COG1148622 HdrA Heterodisulfide reductase, subunit A and related p 96.78
PRK08255 770 salicylyl-CoA 5-hydroxylase; Reviewed 96.57
KOG1238623 consensus 96.55
KOG2853509 consensus 96.52
TIGR02061 651 aprA adenylylsulfate reductase, alpha subunit; InterPro 96.49
KOG2614420 consensus 96.36
pfam06100500 Strep_67kDa_ant Streptococcal 67 kDa myosin-cross-react 96.34
KOG1276491 consensus 96.26
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 96.21
TIGR01789392 lycopene_cycl lycopene cyclase; InterPro: IPR008461 Thi 96.09
KOG1335506 consensus 96.08
COG2907447 Predicted NAD/FAD-binding protein [General function pre 95.93
KOG3855481 consensus 95.89
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 95.8
PRK12921306 2-dehydropantoate 2-reductase; Provisional 95.74
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 95.66
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in tran 95.66
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 95.63
PRK07208474 hypothetical protein; Provisional 95.61
PRK08229341 2-dehydropantoate 2-reductase; Provisional 95.57
PRK06249313 2-dehydropantoate 2-reductase; Provisional 95.55
TIGR00745332 apbA_panE 2-dehydropantoate 2-reductase; InterPro: IPR0 95.44
TIGR01176 585 fum_red_Fp fumarate reductase, flavoprotein subunit; In 95.44
PRK07233430 hypothetical protein; Provisional 95.43
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 95.31
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 95.22
PRK05192 621 tRNA uridine 5-carboxymethylaminomethyl modification en 95.18
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 95.17
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production and c 94.93
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 94.92
KOG2960328 consensus 94.9
KOG1439440 consensus 94.71
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 94.7
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase; InterPro: IPR0 94.7
PRK08275554 putative oxidoreductase; Provisional 94.63
KOG3851446 consensus 94.56
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 94.52
TIGR03467430 HpnE squalene-associated FAD-dependent desaturase. The 94.51
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 94.46
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 94.38
PRK09496455 trkA potassium transporter peripheral membrane componen 94.32
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.11
KOG4405547 consensus 94.07
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 94.0
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 93.56
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.55
TIGR02733499 desat_CrtD C-3',4' desaturase CrtD; InterPro: IPR014104 93.53
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.47
TIGR00136 630 gidA glucose-inhibited division protein A; InterPro: IP 93.43
COG5044434 MRS6 RAB proteins geranylgeranyltransferase component A 93.39
PRK02006501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.38
COG1233487 Phytoene dehydrogenase and related proteins [Secondary 93.29
TIGR01811 620 sdhA_Bsu succinate dehydrogenase or fumarate reductase, 93.29
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.22
PRK11259377 solA N-methyltryptophan oxidase; Provisional 93.18
PRK07660283 consensus 92.9
TIGR01438513 TGR thioredoxin and glutathione reductase; InterPro: IP 92.82
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 92.8
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.77
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 92.69
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.68
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 92.66
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.65
PRK09117282 consensus 92.48
PRK05708305 2-dehydropantoate 2-reductase; Provisional 92.43
PRK11728400 hypothetical protein; Provisional 92.28
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.26
TIGR02352357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 92.1
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.06
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 92.03
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 91.83
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 91.8
PRK08948392 consensus 91.46
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 91.24
pfam00670162 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD 91.23
PRK00421459 murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona 91.22
PRK01390457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.17
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.12
TIGR01988445 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/Ub 91.04
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 91.0
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.96
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 90.95
PRK08277278 D-mannonate oxidoreductase; Provisional 90.95
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 99.48
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 98.44
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 98.17
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 98.11
pfam03486405 HI0933_like HI0933-like protein. 98.09
PRK13984604 putative oxidoreductase; Provisional 98.05
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 98.01
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 98.0
PRK11749460 putative oxidoreductase; Provisional 98.0
PRK12771 560 putative glutamate synthase (NADPH) small subunit; Prov 97.96
pfam00743 532 FMO-like Flavin-binding monooxygenase-like. This family 97.95
PRK12814 652 putative NADPH-dependent glutamate synthase small subun 97.89
PRK04965378 nitric oxide reductase; Provisional 97.89
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 97.87
PRK12831464 putative oxidoreductase; Provisional 97.86
COG0493457 GltD NADPH-dependent glutamate synthase beta chain and 97.79
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 97.74
PRK12778760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 97.72
PRK12770350 putative glutamate synthase subunit beta; Provisional 97.71
PTZ00318 514 NADH dehydrogenase; Provisional 97.57
PRK10262321 thioredoxin reductase; Provisional 97.54
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 97.5
PRK12775 993 putative trifunctional 2-polyprenylphenol hydroxylase/g 97.46
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 97.42
KOG1399 448 consensus 97.39
PRK12779 944 putative bifunctional glutamate synthase subunit beta/2 97.31
COG2072 443 TrkA Predicted flavoprotein involved in K+ transport [I 97.19
KOG03992142 consensus 97.03
COG0492305 TrxB Thioredoxin reductase [Posttranslational modificat 96.87
KOG1336 478 consensus 96.82
KOG2495 491 consensus 96.27
TIGR02853288 spore_dpaA dipicolinic acid synthetase, A subunit; Inte 94.18
TIGR02731454 phytoene_desat phytoene desaturase; InterPro: IPR014102 94.02
pfam01946229 Thi4 Thi4 family. This family includes a putative thiam 92.91
TIGR00031390 UDP-GALP_mutase UDP-galactopyranose mutase; InterPro: I 92.3
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit [Post 91.21
PRK08275554 putative oxidoreductase; Provisional 99.47
PRK06481506 fumarate reductase flavoprotein subunit; Validated 96.96
pfam01134391 GIDA Glucose inhibited division protein A. 96.87
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy production 96.83
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 96.75
TIGR02023408 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 95.97
PRK10015429 hypothetical protein; Provisional 95.9
pfam00890401 FAD_binding_2 FAD binding domain. This family includes 95.86
PRK06126545 hypothetical protein; Provisional 95.48
TIGR00137444 gid gid protein; InterPro: IPR004417 The gid proteins a 95.48
PRK06834488 hypothetical protein; Provisional 95.23
KOG2614420 consensus 95.14
PRK05335434 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 94.76
COG2509486 Uncharacterized FAD-dependent dehydrogenases [General f 94.57
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; Revi 94.49
PRK06175433 L-aspartate oxidase; Provisional 94.33
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; Revi 93.52
PRK07121491 hypothetical protein; Validated 93.35
PTZ00139622 succinate dehydrogenase (flavoprotein) subunit; Provisi 92.92
PRK07804533 L-aspartate oxidase; Provisional 92.53
TIGR02061651 aprA adenylylsulfate reductase, alpha subunit; InterPro 92.13
COG2081408 Predicted flavoproteins [General function prediction on 92.06
PRK07573638 sdhA succinate dehydrogenase flavoprotein subunit; Revi 91.86
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 91.78
PRK07803631 sdhA succinate dehydrogenase flavoprotein subunit; Revi 91.78
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 91.72
PRK12844552 3-ketosteroid-delta-1-dehydrogenase; Reviewed 91.45
PRK09231582 fumarate reductase flavoprotein subunit; Validated 91.03
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, ana 99.39
PRK05329425 anaerobic glycerol-3-phosphate dehydrogenase subunit B; 99.38
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amin 98.61
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy product 98.61
PRK13339497 malate:quinone oxidoreductase; Reviewed 97.94
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 97.76
TIGR01320487 mal_quin_oxido malate:quinone-oxidoreductase; InterPro: 94.46
pfam01134391 GIDA Glucose inhibited division protein A. 99.26
pfam03486405 HI0933_like HI0933-like protein. 99.25
TIGR01790419 carotene-cycl lycopene cyclase family protein; InterPro 98.48
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 98.06
TIGR02053494 MerA mercuric reductase; InterPro: IPR011796 This entry 97.96
TIGR01350481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 97.81
TIGR02374 813 nitri_red_nirB nitrite reductase [NAD(P)H], large subun 97.14
TIGR01424478 gluta_reduc_2 glutathione-disulfide reductase; InterPro 95.38
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 98.96
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 98.91
PRK11259377 solA N-methyltryptophan oxidase; Provisional 98.85
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.79
PRK11728400 hypothetical protein; Provisional 98.78
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 98.69
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 98.69
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 98.66
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 98.65
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 98.59
COG1233487 Phytoene dehydrogenase and related proteins [Secondary 98.55
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 98.52
PRK07208474 hypothetical protein; Provisional 98.41
TIGR02352357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 98.31
PRK08948392 consensus 98.3
PRK07045388 putative monooxygenase; Reviewed 98.26
TIGR01988445 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/Ub 98.25
PRK07233430 hypothetical protein; Provisional 98.25
TIGR03467430 HpnE squalene-associated FAD-dependent desaturase. The 98.23
PRK06847375 hypothetical protein; Provisional 98.2
pfam06039489 Mqo Malate:quinone oxidoreductase (Mqo). This family co 98.15
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 97.98
PRK05868372 hypothetical protein; Validated 97.93
PRK07364413 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 97.81
COG2303542 BetA Choline dehydrogenase and related flavoproteins [A 97.78
PRK06185409 hypothetical protein; Provisional 97.67
PRK06753373 hypothetical protein; Provisional 97.55
PRK07588391 hypothetical protein; Provisional 97.54
PRK05257499 malate:quinone oxidoreductase; Validated 97.51
TIGR01377401 soxA_mon sarcosine oxidase, monomeric form; InterPro: I 97.49
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 97.4
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.38
PRK07236386 hypothetical protein; Provisional 97.36
PRK08774402 consensus 97.34
PRK07538413 hypothetical protein; Provisional 97.33
PRK07608389 hypothetical protein; Provisional 97.28
PRK08013400 hypothetical protein; Provisional 97.2
pfam01593444 Amino_oxidase Flavin containing amine oxidoreductase. T 97.06
PRK13977577 myosin-cross-reactive antigen; Provisional 97.03
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 97.0
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 96.94
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Members of 96.81
pfam04820457 Trp_halogenase Tryptophan halogenase. Tryptophan haloge 96.79
PRK09897 535 hypothetical protein; Provisional 96.36
PRK10157428 putative oxidoreductase FixC; Provisional 96.35
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [General fun 95.92
PRK11101 545 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; P 95.92
PRK11445348 putative oxidoreductase; Provisional 95.88
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 95.79
PRK06475400 salicylate hydroxylase; Provisional 95.68
TIGR01790419 carotene-cycl lycopene cyclase family protein; InterPro 95.63
PRK08163396 salicylate hydroxylase; Provisional 95.6
TIGR02360393 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase; Inter 95.57
KOG0029501 consensus 95.5
PRK11883452 protoporphyrinogen oxidase; Reviewed 95.38
PRK09126392 hypothetical protein; Provisional 94.34
PRK12416466 protoporphyrinogen oxidase; Provisional 93.73
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 92.62
PRK06996397 hypothetical protein; Provisional 91.21
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] 90.93
PRK05192 621 tRNA uridine 5-carboxymethylaminomethyl modification en 98.87
KOG2311 679 consensus 97.99
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethylamino 94.89
COG4529474 Uncharacterized protein conserved in bacteria [Function 98.73
PTZ00153 673 lipoamide dehydrogenase; Provisional 97.2
COG0579429 Predicted dehydrogenase [General function prediction on 98.72
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 98.53
TIGR02734526 crtI_fam phytoene desaturase; InterPro: IPR014105 Phyto 93.46
PRK06567 1048 putative bifunctional glutamate synthase subunit beta/2 98.44
PRK13748 561 putative mercuric reductase; Provisional 97.95
PRK01747 660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 97.56
KOG1298 509 consensus 95.57
PTZ00188 506 adrenodoxin reductase; Provisional 94.99
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 94.84
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 93.79
PRK08229341 2-dehydropantoate 2-reductase; Provisional 92.5
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 92.45
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 92.33
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh 91.86
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 91.45
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.45
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 91.12
TIGR02028401 ChlP geranylgeranyl reductase; InterPro: IPR011774 This 97.89
TIGR02733499 desat_CrtD C-3',4' desaturase CrtD; InterPro: IPR014104 97.82
PRK09853 1032 putative selenate reductase subunit YgfK; Provisional 97.74
TIGR01292321 TRX_reduct thioredoxin-disulfide reductase; InterPro: I 97.09
PRK08294 634 phenol 2-monooxygenase; Provisional 95.89
PRK06184503 hypothetical protein; Provisional 95.67
PRK08132549 hypothetical protein; Provisional 95.36
PRK08244494 hypothetical protein; Provisional 95.29
PRK06183554 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validat 95.08
PRK07190480 hypothetical protein; Provisional 94.97
KOG2665453 consensus 95.83
TIGR01810540 betA choline dehydrogenase; InterPro: IPR011533 Choline 94.82
TIGR00692341 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L- 95.8
TIGR00137444 gid gid protein; InterPro: IPR004417 The gid proteins a 95.62
KOG4716 503 consensus 93.71
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 93.56
COG3349485 Uncharacterized conserved protein [Function unknown] 93.11
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.64
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.42
PRK08255770 salicylyl-CoA 5-hydroxylase; Reviewed 91.18
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 92.32
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 90.98
PRK02472