254780676

254780676

lipoyl synthase

GeneID in NCBI database:8209680Locus tag:CLIBASIA_02815
Protein GI in NCBI database:254780676Protein Accession:YP_003065089.1
Gene range:-(590378, 591367)Protein Length:329aa
Gene description:lipoyl synthase
COG prediction:none
KEGG prediction:lipoyl synthase (EC:2.8.1.8); K03644 lipoic acid synthetase [EC:2.8.1.8]
SEED prediction:Lipoate synthase
Pathway involved in KEGG:Lipoic acid metabolism [PATH:las00785]
Subsystem involved in SEED:Lipoic acid metabolism
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MVTVFDTINKKKHVLHATPNAERLRHPEKIHKPDTEKMQKPDWIRVRAPVSSGYKETYNILRSRNLTTVCEEAGCPNIGECWNKNHATFMILGAICTRACTFCNVATGKPQPLDPQEPENISWAVRSMKLSHVVITSVDRDDLDDGGAQHFAEVISAIRESAPSTTIEVLTPDFLRKPHALEKVVSAKPDVFNHNLETVASNYLMVRPGARYFHSLRLLQRVKELDPLIFTKSGIMLGLGETRNEILQLMDDLRTADVDFLTMGQYLQPTRKHHKVESFVTPQDFKSYETIAYSKGFLMVSASPLTRSSYHAGDDFLRLKNNRRQHLHE
cEEEEcccccccccccccccccccccHHHHcccccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHccccccccccccEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHccccEEEcccHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccEEEccccHHHHHHHHHHHHHccccEEEccccccccccccccHHcccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHccc
ccEEEEccccccccccccccHHccccccccccccccccccccEEEEcccccHHHHHHHHHHHHccccEEEcccccccccHccccccEEEEEEcccccccccccccccccccccccccHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHccccccccccccccHHcccccccccHHHHHHHHHHHHHHccccccccccEEcccccHHHHHHHHHHHHHccccEEEHHHHcccccccccEEEEccHHHHHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHHHHHHcc
MVTVFDTINkkkhvlhatpnaerlrhpekihkpdtekmqkpdwirvrapvssgykeTYNILRSRnlttvceeagcpnigecwnknHATFMILGAICTRActfcnvatgkpqpldpqepenISWAVRSMKLSHVVITsvdrddlddggAQHFAEVISAIResapsttievltpdflrkphalekvvsakpdvfnhnletvasnylmvrpgaryfhSLRLLQRVkeldpliftksgimlglgETRNEILQLMDDLRTADVDFltmgqylqptrkhhkvesfvtpqdfksyetIAYSKGFLMvsaspltrssyhagddflRLKNNRRQHLHE
mvtvfdtinkkkhvlhatpnaerlrhpekihkpdtekmqkpdwirvrapvssgyketynilrsrnLTTVCEEAGCPNIGECWNKNHATFMILGAICTRACTFCNVatgkpqpldpQEPENISWAVRSMKLSHVVITSVDRDDLDDGGAQHFAEVISairesapsttiEVLTPDFLRKPHALEKVvsakpdvfnHNLETVASNYLMVRPGARYFHSLRLLQRVKELDPLIFTKSGIMLGLGETRNEILQLMDDLRTADVDFLTMGQYlqptrkhhkvesfvtpqdfKSYETIAYSKGFLMVSASPLTRSSYHAGDDFLRLKNNRRQHLHE
MVTVFDTINKKKHVLHATPNAERLRHPEKIHKPDTEKMQKPDWIRVRAPVSSGYKETYNILRSRNLTTVCEEAGCPNIGECWNKNHATFMILGAICTRACTFCNVATGKPQPLDPQEPENISWAVRSMKLSHVVITSVDRDDLDDGGAQHFAEVISAIRESAPSTTIEVLTPDFLRKPHALEKVVSAKPDVFNHNLETVASNYLMVRPGARYFHSLRLLQRVKELDPLIFTKSGIMLGLGETRNEILQLMDDLRTADVDFLTMGQYLQPTRKHHKVESFVTPQDFKSYETIAYSKGFLMVSASPLTRSSYHAGDDFLRLKNNRRQHLHE
******************************************WIRVRAPVSSGYKETYNILRSRNLTTVCEEAGCPNIGECWNKNHATFMILGAICTRACTFCNVATGKPQPLDPQEPENISWAVRSMKLSHVVITSVDRDDLDDGGAQHFAEVISAIRESAPSTTIEVLTPDFLRKPHALEKVVSAKPDVFNHNLETVASNYLMVRPGARYFHSLRLLQRVKELDPLIFTKSGIMLGLGETRNEILQLMDDLRTADVDFLTMGQYLQPTRKHHKVESFVTPQDFKSYETIAYSKGFLMVSASPLTRSSYHAGDDFLR***********
MVTVFDTINKKKHVLHATPNAERLRHPEKIHKPDTEKMQKPDWIRVRAPVSSGYKETYNILRSRNLTTVCEEAGCPNIGECWNKNHATFMILGAICTRACTFCNVATGKPQPLDPQEPENISWAVRSMKLSHVVITSVDRDDLDDGGAQHFAEVISAIRESAPSTTIEVLTPDFLRKPHALEKVVSAKPDVFNHNLETVASNYLMVRPGARYFHSLRLLQRVKELDPLIFTKSGIMLGLGETRNEILQLMDDLRTADVDFLTMGQYLQPTRKHHKVESFVTPQDFKSYETIAYSKGFLMVSASPLTRSSYHAGDDFLRLKNNRRQHLHE
*VTVFDT*NKKKHV********RLRHPEKIHKPDTEKMQKPDWIRVRAPVSSGYKETYNILRSRNLTTVCEEAGCPNIGECWNKNHATFMILGAICTRACTFCNVATGKPQPLDPQEPENISWAVRSMKLSHVVITSVDRDDLDDGGAQHFAEVISAIRESAPSTTIEVLTPDFLRKPHALEKVVSAKPDVFNHNLETVASNYLMVRPGARYFHSLRLLQRVKELDPLIFTKSGIMLGLGETRNEILQLMDDLRTADVDFLTMGQYLQPTRKHHKVESFVTPQDFKSYETIAYSKGFLMVSASPLTRSSYHAGDDFLRLKNNRRQHLH*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTVFDTINKKKHVLHATPNAERLRHPEKIHKPDTEKMQKPDWIRVRAPVSSGYKETYNILRSRNLTTVCEEAGCPNIGECWNKNHATFMILGAICTRACTFCNVATGKPQPLDPQEPENISWAVRSMKLSHVVITSVDRDDLDDGGAQHFAEVISAIRESAPSTTIEVLTPDFLRKPHALEKVVSAKPDVFNHNLETVASNYLMVRPGARYFHSLRLLQRVKELDPLIFTKSGIMLGLGETRNEILQLMDDLRTADVDFLTMGQYLQPTRKHHKVESFVTPQDFKSYETIAYSKGFLMVSASPLTRSSYHAGDDFLRLKNNRRQHLHE
MVTVFDTINKKKHVLHATPNAERLRHPEKIHKPDTEKMQKPDWIRVRAPVSSGYKETYNILRSRNLTTVCEEAGCPNIGECWNKNHATFMILGAICTRACTFCNVATGKPQPLDPQEPENISWAVRSMKLSHVVITSVDRDDLDDGGAQHFAEVISAIRESAPSTTIEVLTPDFLRKPHALEKVVSAKPDVFNHNLETVASNYLMVRPGARYFHSLRLLQRVKELDPLIFTKSGIMLGLGETRNEILQLMDDLRTADVDFLTMGQYLQPTRKHHKVESFVTPQDFKSYETIAYSKGFLMVSASPLTRSSYHAGDDFLRLKNNRRQHLHE
MVTVFDTINKKKHVLHATPNAERLRHPEKIHKPDTEKMQKPDWIRVRAPVSSGYKETYNILRSRNLTTVCEEAGCPNIGECWNKNHATFMILGAICTRACTFCNVATGKPQPLDPQEPENISWAVRSMKLSHVVITSVDRDDLDDGGAQHFAEVISAIRESAPSTTIEVLTPDFLRKPHALEKVVSAKPDVFNHNLETVASNYLMVRPGARYFHSLRLLQRVKELDPLIFTKSGIMLGLGETRNEILQLMDDLRTADVDFLTMGQYLQPTRKHHKVESFVTPQDFKSYETIAYSKGFLMVSASPLTRSSYHAGDDFLRLKNNRRQHLHE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target329 lipoyl synthase [Candidatus Liberibacter asiaticus str.
315122213328 lipoyl synthase [Candidatus Liberibacter solanacearum C 1 1e-168
86357562323 lipoyl synthase [Rhizobium etli CFN 42] Length = 323 1 1e-149
327191421322 lipoate synthase protein [Rhizobium etli CNPAF512] Leng 1 1e-149
190891635323 lipoate synthase [Rhizobium etli CIAT 652] Length = 323 1 1e-149
307321962322 lipoic acid synthetase [Sinorhizobium meliloti AK83] Le 1 1e-149
227821854323 lipoyl synthase [Sinorhizobium fredii NGR234] Length = 1 1e-148
209549210323 lipoyl synthase [Rhizobium leguminosarum bv. trifolii W 1 1e-148
150396303323 lipoyl synthase [Sinorhizobium medicae WSM419] Length = 1 1e-148
15965205322 lipoyl synthase [Sinorhizobium meliloti 1021] Length = 1 1e-148
116252005323 lipoyl synthase [Rhizobium leguminosarum bv. viciae 384 1 1e-148
>gi|315122213|ref|YP_004062702.1| lipoyl synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 328 Back     alignment and organism information
 Score =  596 bits (1536), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 277/327 (84%), Positives = 300/327 (91%)

Query: 1   MVTVFDTINKKKHVLHATPNAERLRHPEKIHKPDTEKMQKPDWIRVRAPVSSGYKETYNI 60
           MVTVF+TI++KKH  H T + ER+RHPEK    DTE+M+KP WIRVRA VS GYK+TY I
Sbjct: 1   MVTVFNTIDRKKHASHVTASRERIRHPEKASNADTERMEKPAWIRVRASVSDGYKDTYKI 60

Query: 61  LRSRNLTTVCEEAGCPNIGECWNKNHATFMILGAICTRACTFCNVATGKPQPLDPQEPEN 120
           LRSRNLTTVCEEAGCPNIGECWNKNHATFMI+G+ICTRAC FCNVATGKP+ LD QEP N
Sbjct: 61  LRSRNLTTVCEEAGCPNIGECWNKNHATFMIMGSICTRACAFCNVATGKPKSLDLQEPTN 120

Query: 121 ISWAVRSMKLSHVVITSVDRDDLDDGGAQHFAEVISAIRESAPSTTIEVLTPDFLRKPHA 180
           ISWAV+SM LSHVVITSVDRDDL+DGGAQHFAEVISAIR+++PSTTIEVLTPDFLRKPHA
Sbjct: 121 ISWAVKSMGLSHVVITSVDRDDLEDGGAQHFAEVISAIRKTSPSTTIEVLTPDFLRKPHA 180

Query: 181 LEKVVSAKPDVFNHNLETVASNYLMVRPGARYFHSLRLLQRVKELDPLIFTKSGIMLGLG 240
           LEKVV AKPDVFNHNLETVAS YL VRPGARYFHSLR+LQRVKELDPL+FTKSGIMLGLG
Sbjct: 181 LEKVVLAKPDVFNHNLETVASKYLTVRPGARYFHSLRILQRVKELDPLMFTKSGIMLGLG 240

Query: 241 ETRNEILQLMDDLRTADVDFLTMGQYLQPTRKHHKVESFVTPQDFKSYETIAYSKGFLMV 300
           ETRNEILQLMDDLR A+VDFLTMGQYLQPTRKHHKVESF+TPQDFKSYETIAY+KGFLMV
Sbjct: 241 ETRNEILQLMDDLRIAEVDFLTMGQYLQPTRKHHKVESFITPQDFKSYETIAYTKGFLMV 300

Query: 301 SASPLTRSSYHAGDDFLRLKNNRRQHL 327
           SASPLTRSSYHAGDDFL+LK  R +  
Sbjct: 301 SASPLTRSSYHAGDDFLKLKKAREKQF 327


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86357562|ref|YP_469454.1| lipoyl synthase [Rhizobium etli CFN 42] Length = 323 Back     alignment and organism information
>gi|327191421|gb|EGE58444.1| lipoate synthase protein [Rhizobium etli CNPAF512] Length = 322 Back     alignment and organism information
>gi|190891635|ref|YP_001978177.1| lipoate synthase [Rhizobium etli CIAT 652] Length = 323 Back     alignment and organism information
>gi|307321962|ref|ZP_07601343.1| lipoic acid synthetase [Sinorhizobium meliloti AK83] Length = 322 Back     alignment and organism information
>gi|227821854|ref|YP_002825824.1| lipoyl synthase [Sinorhizobium fredii NGR234] Length = 323 Back     alignment and organism information
>gi|209549210|ref|YP_002281127.1| lipoyl synthase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 323 Back     alignment and organism information
>gi|150396303|ref|YP_001326770.1| lipoyl synthase [Sinorhizobium medicae WSM419] Length = 323 Back     alignment and organism information
>gi|15965205|ref|NP_385558.1| lipoyl synthase [Sinorhizobium meliloti 1021] Length = 322 Back     alignment and organism information
>gi|116252005|ref|YP_767843.1| lipoyl synthase [Rhizobium leguminosarum bv. viciae 3841] Length = 323 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target329 lipoyl synthase [Candidatus Liberibacter asiaticus str.
PRK05481289 PRK05481, PRK05481, lipoyl synthase; Provisional 1e-159
PRK12928290 PRK12928, PRK12928, lipoyl synthase; Provisional 1e-126
TIGR00510302 TIGR00510, lipA, lipoate synthase 6e-96
PLN02428349 PLN02428, PLN02428, lipoic acid synthase 2e-91
KOG2672360 KOG2672, KOG2672, KOG2672, Lipoate synthase [Coenzyme t 9e-86
PTZ00413398 PTZ00413, PTZ00413, lipoate synthase; Provisional 4e-82
COG0320306 COG0320, LipA, Lipoate synthase [Coenzyme metabolism] 1e-138
pfam04055165 pfam04055, Radical_SAM, Radical SAM superfamily 1e-15
smart00729216 smart00729, Elp3, Elongator protein 3, MiaB family, Rad 1e-11
COG0502335 COG0502, BioB, Biotin synthase and related enzymes [Coe 5e-09
cd01335204 cd01335, Radical_SAM, Radical SAM superfamily 1e-08
TIGR00433296 TIGR00433, bioB, biotin synthetase 1e-05
PRK06256336 PRK06256, PRK06256, biotin synthase; Validated 5e-05
COG1060370 COG1060, ThiH, Thiamine biosynthesis enzyme ThiH and re 4e-04
>gnl|CDD|180115 PRK05481, PRK05481, lipoyl synthase; Provisional Back     alignment and domain information
>gnl|CDD|183830 PRK12928, PRK12928, lipoyl synthase; Provisional Back     alignment and domain information
>gnl|CDD|161907 TIGR00510, lipA, lipoate synthase Back     alignment and domain information
>gnl|CDD|178048 PLN02428, PLN02428, lipoic acid synthase Back     alignment and domain information
>gnl|CDD|37883 KOG2672, KOG2672, KOG2672, Lipoate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|173603 PTZ00413, PTZ00413, lipoate synthase; Provisional Back     alignment and domain information
>gnl|CDD|30668 COG0320, LipA, Lipoate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|146602 pfam04055, Radical_SAM, Radical SAM superfamily Back     alignment and domain information
>gnl|CDD|128968 smart00729, Elp3, Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>gnl|CDD|30848 COG0502, BioB, Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|100105 cd01335, Radical_SAM, Radical SAM superfamily Back     alignment and domain information
>gnl|CDD|161876 TIGR00433, bioB, biotin synthetase Back     alignment and domain information
>gnl|CDD|180492 PRK06256, PRK06256, biotin synthase; Validated Back     alignment and domain information
>gnl|CDD|31260 COG1060, ThiH, Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 329 lipoyl synthase [Candidatus Liberibacter asiaticus str.
PRK12928290 lipoyl synthase; Provisional 100.0
COG0320306 LipA Lipoate synthase [Coenzyme metabolism] 100.0
PRK05481289 lipoyl synthase; Provisional 100.0
KOG2672360 consensus 100.0
TIGR00510310 lipA lipoic acid synthetase; InterPro: IPR003698 Lipoic 100.0
COG0621437 MiaB 2-methylthioadenine synthetase [Translation, ribos 98.86
PRK05926371 hypothetical protein; Provisional 98.72
PRK08207497 coproporphyrinogen III oxidase; Provisional 97.94
COG1313335 PflX Uncharacterized Fe-S protein PflX, homolog of pyru 96.39
PRK08508279 biotin synthase; Provisional 99.94
PRK07094323 biotin synthase; Provisional 99.92
PRK06256325 biotin synthase; Validated 99.92
COG0502335 BioB Biotin synthase and related enzymes [Coenzyme meta 99.91
TIGR00433350 bioB biotin synthase; InterPro: IPR002684 Biotin syntha 99.87
PRK06267324 hypothetical protein; Provisional 99.81
COG1060370 ThiH Thiamine biosynthesis enzyme ThiH and related unch 99.26
PRK06245336 cofG FO synthase subunit 1; Reviewed 99.23
TIGR03550322 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin sy 99.16
PRK09240371 thiH thiamine biosynthesis protein ThiH; Reviewed 98.88
TIGR03471472 HpnJ hopanoid biosynthesis associated radical SAM prote 98.67
TIGR00423331 TIGR00423 conserved hypothetical protein TIGR00423; Int 98.49
PRK09613 471 thiH thiamine biosynthesis protein ThiH; Reviewed 98.26
TIGR00089455 TIGR00089 RNA modification enzyme, MiaB family; InterPr 98.24
PRK09234 846 fbiC FO synthase; Reviewed 98.18
PRK05628 376 coproporphyrinogen III oxidase; Validated 98.1
COG0535347 Predicted Fe-S oxidoreductases [General function predic 98.08
PRK06582 390 coproporphyrinogen III oxidase; Provisional 97.93
PRK00164334 moaA molybdenum cofactor biosynthesis protein A; Review 97.9
PRK05799 374 coproporphyrinogen III oxidase; Provisional 97.89
TIGR03470318 HpnH hopanoid biosynthesis associated radical SAM prote 97.87
PRK13361329 molybdenum cofactor biosynthesis protein A; Provisional 97.83
PRK05660 378 coproporphyrinogen III oxidase; Provisional 97.79
PRK09058 447 coproporphyrinogen III oxidase; Provisional 97.76
PRK08208 436 coproporphyrinogen III oxidase; Validated 97.74
PRK13347 453 coproporphyrinogen III oxidase; Provisional 97.72
PRK06294 374 coproporphyrinogen III oxidase; Provisional 97.68
PRK07379 399 coproporphyrinogen III oxidase; Provisional 97.68
PRK09249 456 coproporphyrinogen III oxidase; Provisional 97.58
PRK05904353 coproporphyrinogen III oxidase; Provisional 97.58
PRK08599 377 coproporphyrinogen III oxidase; Provisional 97.54
PRK08898 393 coproporphyrinogen III oxidase; Provisional 97.5
TIGR01579492 MiaB-like-C MiaB-like tRNA modifying enzyme; InterPro: 97.5
PRK08446351 coproporphyrinogen III oxidase; Provisional 97.49
PRK08807 385 consensus 97.49
PRK08949 378 consensus 97.49
PRK09057 381 coproporphyrinogen III oxidase; Provisional 97.45
COG1533297 SplB DNA repair photolyase [DNA replication, recombinat 97.28
COG0635 416 HemN Coproporphyrinogen III oxidase and related Fe-S ox 96.92
COG2516339 Biotin synthase-related enzyme [General function predic 96.53
COG2100414 Predicted Fe-S oxidoreductase [General function predict 96.47
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . This entry represents the bacterial form of MoaA (molybdenum cofactor biosynthesis protein A). The MoaA protein is a member of the wider S-adenosylmethionine(SAM)-dependent enzyme family which catalyze the formation of protein and/or substrate radicals by reductive cleavage of SAM via a [4Fe-4S] cluster. Monomeric and homodimeric forms of MoaA have been observed in vivo, and it is not clear what the physiologically relevant form of the enzyme is . The core of each monomer consists of an incomplete TIM barrel, formed by the N-terminal region of the protein, containing a [4Fe-4S] cluster. The C-terminal region of the protein, which also contains a [4Fe-4S] cluster consists of a beta-sheet covering the lateral opening of the barrel, an extended loop and three alpha helices. The N-terminal [4Fe-4S] cluster is coordinated with 3 cysteines and an exchangeable SAM molecule, while the C-terminal [4Fe-4S], also coordinated with 3 cysteines, is the binding and activation site for GTP .; GO: 0046872 metal ion binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02666">TIGR02666346 moaA molybdenum cofactor biosynthesis protein A; InterP 96.41
pfam00682237 HMGL-like HMGL-like. This family contains a diverse set 95.87
COG2896322 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme 95.85
PRK08629 424 coproporphyrinogen III oxidase; Provisional 95.83
COG0731296 Fe-S oxidoreductases [Energy production and conversion] 95.63
COG1180260 PflA Pyruvate-formate lyase-activating enzyme [Posttran 95.33
PRK11145246 pflA pyruvate formate lyase-activating enzyme 1; Provis 92.99
KOG2492552 consensus 92.88
COG0119 409 LeuA Isopropylmalate/homocitrate/citramalate synthases 92.55
COG1856275 Uncharacterized homolog of biotin synthetase [Function 91.88
TIGR02026506 BchE magnesium-protoporphyrin IX monomethyl ester anaer 91.69
smart00729216 Elp3 Elongator protein 3, MiaB family, Radical SAM. Thi 99.53
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin sy 99.51
KOG2900380 consensus 99.51
PRK07360375 FO synthase subunit 2; Reviewed 99.48
PRK08444353 hypothetical protein; Provisional 99.43
cd01335204 Radical_SAM Radical SAM superfamily. Enzymes of this fa 99.32
pfam04055165 Radical_SAM Radical SAM superfamily. Radical SAM protei 98.77
PRK09234846 fbiC FO synthase; Reviewed 98.75
COG1032490 Fe-S oxidoreductase [Energy production and conversion] 98.36
PRK05301 375 pyrroloquinoline quinone biosynthesis protein PqqE; Pro 98.15
TIGR01578487 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-t 97.47
TIGR01125475 TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR011 97.22
TIGR02351378 thiH thiazole biosynthesis protein ThiH; InterPro: IPR0 96.94
COG2108353 Uncharacterized conserved protein related to pyruvate f 96.94
TIGR01212307 TIGR01212 radical SAM protein, TIGR01212 family; InterP 95.99
TIGR02668324 moaA_archaeal probable molybdenum cofactor biosynthesis 95.97
KOG4355 547 consensus 94.73
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 94.08
TIGR01574456 miaB-methiolase tRNA-i(6)A37 thiotransferase enzyme Mia 90.13
PRK08445348 hypothetical protein; Provisional 99.09
PRK05927350 hypothetical protein; Provisional 99.08
COG1242312 Predicted Fe-S oxidoreductase [General function predict 97.91
PRK08195337 4-hydroxy-2-ketovalerate aldolase; Validated 93.69
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. Membe 92.62
PRK05588256 histidinol-phosphatase; Provisional 93.83
KOG1939 1247 consensus 93.16
>PRK12928 lipoyl synthase; Provisional Back     alignment and domain information
>COG0320 LipA Lipoate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK05481 lipoyl synthase; Provisional Back     alignment and domain information
>KOG2672 consensus Back     alignment and domain information
>TIGR00510 lipA lipoic acid synthetase; InterPro: IPR003698 Lipoic acid is a covalently bound disulphide-containing cofactor required for function of the pyruvate dehydrogenase, alpha-ketoglutarate dehydrogenase, and glycine cleavage enzyme complexes of Escherichia coli Back     alignment and domain information
>COG0621 MiaB 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05926 hypothetical protein; Provisional Back     alignment and domain information
>PRK08207 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG1313 PflX Uncharacterized Fe-S protein PflX, homolog of pyruvate formate lyase activating proteins [General function prediction only] Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>TIGR00433 bioB biotin synthase; InterPro: IPR002684 Biotin synthase 2 Back     alignment and domain information
>PRK06267 hypothetical protein; Provisional Back     alignment and domain information
>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK06245 cofG FO synthase subunit 1; Reviewed Back     alignment and domain information
>TIGR03550 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit Back     alignment and domain information
>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ Back     alignment and domain information
>TIGR00423 TIGR00423 conserved hypothetical protein TIGR00423; InterPro: IPR005244 This entry describes a family of conserved hypothetical proteins with no known function Back     alignment and domain information
>PRK09613 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>TIGR00089 TIGR00089 RNA modification enzyme, MiaB family; InterPro: IPR005839 This entry represents a family defined on the basis of sequence similarity Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>PRK05628 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>COG0535 Predicted Fe-S oxidoreductases [General function prediction only] Back     alignment and domain information
>PRK06582 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>PRK05799 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH Back     alignment and domain information
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional Back     alignment and domain information
>PRK05660 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09058 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08208 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK13347 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK06294 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK07379 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09249 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05904 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08599 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08898 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR01579 MiaB-like-C MiaB-like tRNA modifying enzyme; InterPro: IPR006467 This clade of sequences is closely related to MiaB, a modifier of isopentenylated adenosine-37 of certain eukaryotic and bacterial tRNAs (see IPR006463 from INTERPRO) Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08807 consensus Back     alignment and domain information
>PRK08949 consensus Back     alignment and domain information
>PRK09057 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG1533 SplB DNA repair photolyase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>COG2516 Biotin synthase-related enzyme [General function prediction only] Back     alignment and domain information
>COG2100 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02666 moaA molybdenum cofactor biosynthesis protein A; InterPro: IPR013483 The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cisdithiolene moiety to molybdopterin (MPT) Back     alignment and domain information
>pfam00682 HMGL-like HMGL-like Back     alignment and domain information
>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>PRK08629 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG0731 Fe-S oxidoreductases [Energy production and conversion] Back     alignment and domain information
>COG1180 PflA Pyruvate-formate lyase-activating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11145 pflA pyruvate formate lyase-activating enzyme 1; Provisional Back     alignment and domain information
>KOG2492 consensus Back     alignment and domain information
>COG0119 LeuA Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism] Back     alignment and domain information
>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown] Back     alignment and domain information
>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase; InterPro: IPR011772 This entry respresents the cobalamin-dependent oxidative cyclase responsible for forming the distinctive E-ring of the chlorin ring system under anaerobic conditions Back     alignment and domain information
>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>KOG2900 consensus Back     alignment and domain information
>PRK07360 FO synthase subunit 2; Reviewed Back     alignment and domain information
>PRK08444 hypothetical protein; Provisional Back     alignment and domain information
>cd01335 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>pfam04055 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>COG1032 Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional Back     alignment and domain information
>TIGR01578 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-type; InterPro: IPR006466 This clade of sequences is closely related to MiaB, a modifier of isopentenylated adenosine-37 of certain eukaryotic and bacterial tRNAs (see IPR006463 from INTERPRO) Back     alignment and domain information
>TIGR01125 TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR01125; InterPro: IPR005840 This is a family of mainly hypothetical proteins of unknown function Back     alignment and domain information
>TIGR02351 thiH thiazole biosynthesis protein ThiH; InterPro: IPR012726 Members of this protein family are the ThiH proteins involved in thiamine biosynthesis Back     alignment and domain information
>COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme [General function prediction only] Back     alignment and domain information
>TIGR01212 TIGR01212 radical SAM protein, TIGR01212 family; InterPro: IPR005911 This uncharacterised protein family shows significant similarity to IPR005910 from INTERPRO, a longer protein that is a histone acetyltransferase at its C-terminus and is a subunit of RNA polymerase II (in yeast) Back     alignment and domain information
>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A; InterPro: IPR013485 This entry consists of archaeal proteins which are predicted to be functionally equivalent to MoaA (molybdenum cofactor biosynthesis protein A) from bacteria (see IPR013483 from INTERPRO) Back     alignment and domain information
>KOG4355 consensus Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>TIGR01574 miaB-methiolase tRNA-i(6)A37 thiotransferase enzyme MiaB; InterPro: IPR006463 These sequences are homologs of the MiaB enzyme responsible for the modification of the isopentenylated adenine-37 base of most bacterial and eukaryotic tRNAs that read codons beginning with uracil (all except tRNA(I,V) Ser) Back     alignment and domain information
>PRK08445 hypothetical protein; Provisional Back     alignment and domain information
>PRK05927 hypothetical protein; Provisional Back     alignment and domain information
>COG1242 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08195 4-hydroxy-2-ketovalerate aldolase; Validated Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>PRK05588 histidinol-phosphatase; Provisional Back     alignment and domain information
>KOG1939 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target329 lipoyl synthase [Candidatus Liberibacter asiaticus str.
1r30_A369 The Crystal Structure Of Biotin Synthase, An S- Ade 7e-07
>gi|42543470|pdb|1R30|A Chain A, The Crystal Structure Of Biotin Synthase, An S- Adenosylmethionine-Dependent Radical Enzyme Length = 369 Back     alignment and structure
 Score = 59.3 bits (142), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 43/231 (18%), Positives = 84/231 (36%), Gaps = 30/231 (12%)

Query: 96  CTRACTFC----NVATGKPQPLDPQEPENISWAVRSMKLSHVV--ITSVDRDDLDDGGAQ 149
           C   C +C       TG  +     E E +  + R  K +            +  +    
Sbjct: 76  CPEDCKYCPQSSRYKTG-LEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMP 134

Query: 150 HFAEVISAIRESAPSTTIEVLTPDFLRKPHALEKVVSAKPDVFNHNLETVASNYLMVRPG 209
           +  +++  ++       + + T          +++ +A  D +NHNL+T    Y  +   
Sbjct: 135 YLEQMVQGVKAMGLEACMTLGTL----SESQAQRLANAGLDYYNHNLDTSPEFYGNIITT 190

Query: 210 ARYFHSLRLLQRVKELDPLIFTKSGIMLGLGETRNEILQLMDDLRTADV--DFLTMGQYL 267
             Y   L  L++V++    I   SG ++GLGET  +   L+  L       + + +   +
Sbjct: 191 RTYQERLDTLEKVRDAG--IKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLV 248

Query: 268 Q----PTRKHHKVESFVTPQDFKSYETIAYSKGFLMVSASPLTRSSYHAGD 314
           +    P   +  V        F    TIA ++  +M ++    R S  AG 
Sbjct: 249 KVKGTPLADNDDV------DAFDFIRTIAVAR-IMMPTS--YVRLS--AGR 288


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target329 lipoyl synthase [Candidatus Liberibacter asiaticus str.
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, FES c 3e-17
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Length = 369 Back     alignment and structure
 Score = 84.5 bits (208), Expect = 3e-17
 Identities = 32/210 (15%), Positives = 73/210 (34%), Gaps = 13/210 (6%)

Query: 89  FMILGAICTRACTFC------NVATGKPQPLDPQEPENISWAVRSMKLSHVVITSVDRDD 142
             I    C   C +C             + ++ ++    +   ++   +   + +    +
Sbjct: 69  LSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGA-AWKN 127

Query: 143 LDDGGAQHFAEVISAIRESAPSTTIEVLTPDFLRKPHALEKVVSAKPDVFNHNLETVASN 202
             +    +  +++  ++       + + T          +++ +A  D +NHNL+T    
Sbjct: 128 PHERDMPYLEQMVQGVKAMGLEACMTLGTLSE----SQAQRLANAGLDYYNHNLDTSPEF 183

Query: 203 YLMVRPGARYFHSLRLLQRVKELDPLIFTKSGIMLGLGETRNEILQLMDDLRTADVDFLT 262
           Y  +     Y   L  L++V++    I   SG ++GLGET  +   L+  L        +
Sbjct: 184 YGNIITTRTYQERLDTLEKVRDAG--IKVCSGGIVGLGETVKDRAGLLLQLANLPTPPES 241

Query: 263 MGQYLQPTRKHHKVESFVTPQDFKSYETIA 292
           +   +    K   +        F    TIA
Sbjct: 242 VPINMLVKVKGTPLADNDDVDAFDFIRTIA 271


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target329 lipoyl synthase [Candidatus Liberibacter asiaticus str.
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, FES c 99.86
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM radica 99.79
2qgq_A304 Protein TM_1862; alpha-beta protein, structural genomic 99.01
1olt_A 457 Oxygen-independent coproporphyrinogen III oxidase; heme 98.5
3c8f_A245 Pyruvate formate-lyase 1-activating enzyme; adoMet radi 98.11
2yx0_A342 Radical SAM enzyme; predicted tRNA modification enzyme, 98.0
1tv8_A340 MOAA, molybdenum cofactor biosynthesis protein A; TIM b 97.88
2z2u_A311 UPF0026 protein MJ0257; metal binding protein; 2.40A {M 97.23
2a5h_A416 L-lysine 2,3-aminomutase; radical SAM, four-iron-four-s 96.62
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunn 94.68
3ivs_A 423 Homocitrate synthase, mitochondrial; TIM barrel, metall 92.9
2iw0_A254 Chitin deacetylase; hydrolase, chitin DE-N-acetylase, f 93.94
3no5_A275 Uncharacterized protein; PFAM DUF849 domain containing 90.49
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
Probab=99.86  E-value=1.6e-20  Score=165.05  Aligned_cols=200  Identities=17%  Similarity=0.245  Sum_probs=156.6

Q ss_pred             EEEEEECCCCCCCCCCCCCCC----CCCC--CCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             699986652235352234467----8998--8882357999999997077518985054453453258999999999985
Q gi|254780676|r   87 ATFMILGAICTRACTFCNVAT----GKPQ--PLDPQEPENISWAVRSMKLSHVVITSVDRDDLDDGGAQHFAEVISAIRE  160 (329)
Q Consensus        87 ATFMilG~~CTR~C~FC~V~~----G~P~--~~D~~EP~rvA~av~~l~Lk~vViTSV~RDDL~DgGA~hfa~~I~~Ir~  160 (329)
                      ..|-|.-+.|+.+|.||+...    +.+.  ..+++|-...|+..+.+|.+.+.|.+-... ..|.....+.+.|+.|++
T Consensus        67 ~iin~~Tn~C~~~C~FCafs~~~~~~~~~~~l~s~eeI~e~a~~~~~~G~~~i~l~~g~~~-~~~~~~~~~~~~i~~i~~  145 (369)
T 1r30_A           67 TLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKN-PHERDMPYLEQMVQGVKA  145 (369)
T ss_dssp             EEEEEECSCBSSCCSSCSCBTTSCTTCCCCCCCCHHHHHHHHHHHHHTTCSEEEEEECCSS-CCTTTHHHHHHHHHHHHH
T ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCC-CCCCHHHHHHHHHHHHHH
T ss_conf             6877558999988922997341899987546688799999999898759979999957888-870279999999998520


Q ss_pred             HCCCCEEEEECCCCCCCHHHHHHHHHCCCHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCEEEEEE
Q ss_conf             33586899815462344689998741070233201383000275638970358999999999970891670140488764
Q gi|254780676|r  161 SAPSTTIEVLTPDFLRKPHALEKVVSAKPDVFNHNLETVASNYLMVRPGARYFHSLRLLQRVKELDPLIFTKSGIMLGLG  240 (329)
Q Consensus       161 ~~P~~~IEvLiPDf~G~~~al~~v~~A~pdV~nHNiETV~rLy~~VRp~a~Y~rSL~vL~~aK~~~~~i~TKSGlMvGLG  240 (329)
                      ..+.+.+.+-..    ..+.++.+.+||.+.++||+||.+++++.++++.+|++.+++++.++++|  +.+.+|+|+|+|
T Consensus       146 ~~~~i~~~~~~l----~~e~l~~Lk~aG~~~~~~~lEt~~~~~~~~~~~~~~~~rl~~l~~a~~~G--i~~~~g~i~G~g  219 (369)
T 1r30_A          146 MGLEACMTLGTL----SESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVRDAG--IKVCSGGIVGLG  219 (369)
T ss_dssp             TTSEEEEECSSC----CHHHHHHHHHHCCCEEECCCBSCHHHHHHHCCSSCHHHHHHHHHHHHHHH--CEEECCEEECSS
T ss_pred             CCCEEEEECCCC----CHHHHHHHHHHCCCEECCCHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHC--CCCEEEEEECCC
T ss_conf             475476512679----89999999851878883434245554213434587999999999999828--973588897889


Q ss_pred             ECHHHHHHHHHHHHHCCCCEEECCHH-CCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             20688999999999669939975022-2786100780002384699999999997
Q gi|254780676|r  241 ETRNEILQLMDDLRTADVDFLTMGQY-LQPTRKHHKVESFVTPQDFKSYETIAYS  294 (329)
Q Consensus       241 Et~eEi~e~l~DLr~~gvdilTiGQY-L~Ps~~h~pV~ryv~P~eF~~~~~~a~~  294 (329)
                      ||++|+++.+..|++.+++.-+++-+ +.|-+ .-|......|..++.++-+|..
T Consensus       220 Et~ed~i~~l~~Lr~L~~~~~~v~~~~f~P~~-gT~l~~~~~~~~~e~lr~iAi~  273 (369)
T 1r30_A          220 ETVKDRAGLLLQLANLPTPPESVPINMLVKVK-GTPLADNDDVDAFDFIRTIAVA  273 (369)
T ss_dssp             CCHHHHHHHHHHHHSSSSCCSEEEEEECCCCT-TSTTSSCCCCCHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEECCCCCC-CCCCCCCCCCCHHHHHHHHHHH
T ss_conf             99999999999998668998665550046689-9976667899999999999999



>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>2qgq_A Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8} Back     alignment and structure
>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4S cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2 Back     alignment and structure
>3c8f_A Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A* Back     alignment and structure
>2yx0_A Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii} Back     alignment and structure
>1tv8_A MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} SCOP: c.1.28.3 PDB: 1tv7_A* 2fb3_A* 2fb2_A* Back     alignment and structure
>2z2u_A UPF0026 protein MJ0257; metal binding protein; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>2a5h_A L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, S-adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale} Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling, bifunctional enzyme; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensation, amino-acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>2iw0_A Chitin deacetylase; hydrolase, chitin DE-N-acetylase, family 4 carbohydrate esterase; 1.81A {Colletotrichum lindemuthianum} SCOP: c.6.2.3 Back     alignment and structure
>3no5_A Uncharacterized protein; PFAM DUF849 domain containing protein, structural genomics, center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 329 lipoyl synthase [Candidatus Liberibacter asiaticus str.
d1r30a_312 c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 3e-12
>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]} Length = 312 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Radical SAM enzymes
family: Biotin synthase
domain: Biotin synthase
species: Escherichia coli [TaxId: 562]
 Score = 66.5 bits (161), Expect = 3e-12
 Identities = 34/214 (15%), Positives = 70/214 (32%), Gaps = 3/214 (1%)

Query: 86  HATFMILGAICTRACTFCNVATGKPQPLDPQEPENISWAVRSMK-LSHVVITSVDRDDLD 144
                I    C   C +C  ++     L+ +    +   + S +       T        
Sbjct: 40  STLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAW 99

Query: 145 DGGAQHFAEVISAIRESAPSTTIEVLTPDFLRKPHALEKVVSAKPDVFNHNLETVASNYL 204
               +     +  + +   +  +E             +++ +A  D +NHNL+T    Y 
Sbjct: 100 KNPHERDMPYLEQMVQGVKAMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG 159

Query: 205 MVRPGARYFHSLRLLQRVKELDPLIFTKSGIMLGLGETRNEILQLMDDLRTADVDFLTMG 264
            +     Y   L  L++V++        SG ++GLGET  +   L+  L        ++ 
Sbjct: 160 NIITTRTYQERLDTLEKVRDAGI--KVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVP 217

Query: 265 QYLQPTRKHHKVESFVTPQDFKSYETIAYSKGFL 298
             +    K   +        F    TIA ++  +
Sbjct: 218 INMLVKVKGTPLADNDDVDAFDFIRTIAVARIMM 251


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target329 lipoyl synthase [Candidatus Liberibacter asiaticus str.
d1r30a_312 Biotin synthase {Escherichia coli [TaxId: 562]} 99.78
d1olta_ 441 Oxygen-independent coproporphyrinogen III oxidase HemN 98.32
d1tv8a_327 Molybdenum cofactor biosynthesis protein A MoaA {Staphy 97.96
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scr 90.87
d1nvma2289 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain 90.21
>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Radical SAM enzymes
family: Biotin synthase
domain: Biotin synthase
species: Escherichia coli [TaxId: 562]
Probab=99.78  E-value=6.5e-18  Score=144.89  Aligned_cols=198  Identities=16%  Similarity=0.237  Sum_probs=151.4

Q ss_pred             EEEEEECCCCCCCCCCCCCCCCC------CCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             69998665223535223446789------988882357999999997077518985054453453258999999999985
Q gi|254780676|r   87 ATFMILGAICTRACTFCNVATGK------PQPLDPQEPENISWAVRSMKLSHVVITSVDRDDLDDGGAQHFAEVISAIRE  160 (329)
Q Consensus        87 ATFMilG~~CTR~C~FC~V~~G~------P~~~D~~EP~rvA~av~~l~Lk~vViTSV~RDDL~DgGA~hfa~~I~~Ir~  160 (329)
                      ..|.+..+.|..+|.||+.....      ...+++++....++.....|.+.+++.+-. +...+.....+.+.|+.+++
T Consensus        41 ~~~~~~TngC~~~C~fC~~~~~~~~~~~~~~~~~~e~i~~~~~~~~~~G~~~~~~~~g~-~~~~~~~~~~~~~~i~~~~~  119 (312)
T d1r30a_          41 TLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAW-KNPHERDMPYLEQMVQGVKA  119 (312)
T ss_dssp             EEEEEECSCBSSCCSSCSCBTTSCTTCCCCCCCCHHHHHHHHHHHHHTTCSEEEEEECC-SSCCTTTHHHHHHHHHHHHH
T ss_pred             EEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCC-CCCCHHHHHHHHHHHHHCCC
T ss_conf             13475189988869839987668988764212455789999999997499899970577-78740668999999985211


Q ss_pred             HCCCCEEEEECCCCCCCHHHHHHHHHCCCHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCEEEEEE
Q ss_conf             33586899815462344689998741070233201383000275638970358999999999970891670140488764
Q gi|254780676|r  161 SAPSTTIEVLTPDFLRKPHALEKVVSAKPDVFNHNLETVASNYLMVRPGARYFHSLRLLQRVKELDPLIFTKSGIMLGLG  240 (329)
Q Consensus       161 ~~P~~~IEvLiPDf~G~~~al~~v~~A~pdV~nHNiETV~rLy~~VRp~a~Y~rSL~vL~~aK~~~~~i~TKSGlMvGLG  240 (329)
                      ..+.+.+.+...    +.+.++.+.+||.+.+++++||.++++..+.+..+|++.+++++.++++|  +.+.+|+|+|+|
T Consensus       120 ~~~~~~~~~~~l----~~e~l~~lk~aG~~~i~~~iEs~~~~~~~~~~~~~~~~~~~~~~~a~~~G--i~~~~~~i~G~~  193 (312)
T d1r30a_         120 MGLEACMTLGTL----SESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVRDAG--IKVCSGGIVGLG  193 (312)
T ss_dssp             TTSEEEEECSSC----CHHHHHHHHHHCCCEEECCCBSCHHHHHHHCCSSCHHHHHHHHHHHHHHH--CEEECCEEECSS
T ss_pred             CCCEEEECCCCC----HHHHHHHHHCCCCEEEECCCCHHHHHHCCCCCCCCHHHHHHHHHHHHHHC--CCEECCEEECCC
T ss_conf             363232011110----39998886534600674211214555334789999999999999999834--663002575576


Q ss_pred             ECHHHHHHHHHHHHHCCCC--EEECCHHCCCCC-CCCCCCCCCCHHHHHHHHHHH
Q ss_conf             2068899999999966993--997502227861-007800023846999999999
Q gi|254780676|r  241 ETRNEILQLMDDLRTADVD--FLTMGQYLQPTR-KHHKVESFVTPQDFKSYETIA  292 (329)
Q Consensus       241 Et~eEi~e~l~DLr~~gvd--ilTiGQYL~Ps~-~h~pV~ryv~P~eF~~~~~~a  292 (329)
                      ||.+|+++.+..|++.+.+  .+.+.-+ .|-+ ..+.-..-++++++..+-.++
T Consensus       194 et~~d~~~~l~~l~~l~~~~~~i~~~~~-~p~~gT~l~~~~~~~~~e~l~~iA~~  247 (312)
T d1r30a_         194 ETVKDRAGLLLQLANLPTPPESVPINML-VKVKGTPLADNDDVDAFDFIRTIAVA  247 (312)
T ss_dssp             CCHHHHHHHHHHHHSSSSCCSEEEEEEC-CCCTTSTTSSCCCCCHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEECCC-CCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             8679999999999855778876430541-68998432445689889999999999



>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tv8a_ c.1.28.3 (A:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 329 lipoyl synthase [Candidatus Liberibacter asiaticus
2a5h_A_95-342248 (A:95-342) L-lysine 2,3-aminomutase; radical SAM, 8e-25
1olt_A_1-364364 (A:1-364) Oxygen-independent coproporphyrinogen II 7e-23
1r30_A_369 (A:) Biotin synthase; SAM radical protein, TIM bar 2e-24
3iix_A_348 (A:) Biotin synthetase, putative; adoMet radical, 7e-23
>2a5h_A (A:95-342) L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, S-adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale}Length = 248 Back     alignment and structure
 Score =  108 bits (270), Expect = 8e-25
 Identities = 29/219 (13%), Positives = 66/219 (30%), Gaps = 5/219 (2%)

Query: 69  VCEEAGCPNIGECWNKNHATFMILGAICTRACTFCNVATGKPQPLDPQEPENISWAVRSM 128
           + E+   P  G          +++   C+  C  C       Q  D    E I  A+  +
Sbjct: 4   LHEDTDSPVPGLTHRYPDRVLLLITDXCSXYCRHCTRRRFAGQSDDSXPXERIDKAIDYI 63

Query: 129 KLSHVVITSVD-RDDLDDGGAQHFAEVISAIRESAPSTTIEVLTPDFLRKPHALEKVVSA 187
           + +  V   +    D      +    +I+ +RE      + + +   +  P  +   +  
Sbjct: 64  RNTPQVRDVLLSGGDALLVSDETLEYIIAKLREIPHVEIVRIGSRTPVVLPQRITPELVN 123

Query: 188 KPDVFNHNLETVASNYLMVRPGARYFHSLRLLQRVKELDPLIFTKSGIMLGLGETRNEIL 247
               ++        N     P      S R  Q + +    +  +S ++ G+ +  +   
Sbjct: 124 XLKKYHPVWL----NTHFNHPNEITEESTRACQLLADAGVPLGNQSVLLRGVNDCVHVXK 179

Query: 248 QLMDDLRTADVDFLTMGQYLQPTRKHHKVESFVTPQDFK 286
           +L++ L    V    + Q        H         +  
Sbjct: 180 ELVNKLVKIRVRPYYIYQCDLSLGLEHFRTPVSKGIEII 218


>1olt_A (A:1-364) Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4S cluster; HET: SAM; 2.07A {Escherichia coli}Length = 364 Back     alignment and structure
>1r30_A (A:) Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli}Length = 369 Back     alignment and structure
>3iix_A (A:) Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A*Length = 348 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target329 lipoyl synthase [Candidatus Liberibacter asiaticus str.
1r30_A_369 Biotin synthase; SAM radical protein, TIM barrel, 99.71
3iix_A_348 Biotin synthetase, putative; adoMet radical, SAM r 99.68
1olt_A_1-364364 Oxygen-independent coproporphyrinogen III oxidase; 99.51
2a5h_A_95-342248 L-lysine 2,3-aminomutase; radical SAM, four-iron-f 99.53
3c8f_A_245 Pyruvate formate-lyase 1-activating enzyme; adoMet 99.08
2yx0_A_342 Radical SAM enzyme; predicted tRNA modification en 98.93
1tv8_A_1-313313 MOAA, molybdenum cofactor biosynthesis protein A; 98.78
2qgq_A_113-234122 Protein TM_1862; alpha-beta protein, structural ge 97.82
2z2u_A_311 UPF0026 protein MJ0257; metal binding protein; 2.4 97.32
1nvm_A_1-273273 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 95.1
3eeg_A_325 2-isopropylmalate synthase; 11106D, beta barrel, P 92.96
3ivs_A_1-311311 Homocitrate synthase, mitochondrial; TIM barrel, m 96.4
3ewb_X_293 2-isopropylmalate synthase; LEUA, structural genom 95.31
3chv_A_284 Prokaryotic domain of unknown function (DUF849) wi 95.21
1ydn_A_295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 94.67
2ftp_A_302 Hydroxymethylglutaryl-COA lyase; structural genomi 94.22
1ydo_A_307 HMG-COA lyase; TIM-barrel protein, structural geno 93.5
3ble_A_337 Citramalate synthase from leptospira interrogans; 92.48
2ztj_A_1-277277 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 92.37
1rqb_A_1-308_422-472359 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 91.48
3can_A_182 Pyruvate-formate lyase-activating enzyme; structur 95.69
2qgq_A_1-112112 Protein TM_1862; alpha-beta protein, structural ge 95.42
>1r30_A (A:) Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} Back     alignment and structure
Probab=99.71  E-value=3.5e-17  Score=142.46  Aligned_cols=270  Identities=13%  Similarity=0.151  Sum_probs=204.2

Q ss_pred             CCCCCCCCCHHHCCCCCCCH--HHHHHHHHHHHCCCCEEECCCCCCCHHHHHCCCC--EEEEEECCCCCCCCCCCCCCCC
Q ss_conf             88888898824500179986--6899999999749823652578878767508972--6999866522353522344678
Q gi|254780676|r   33 PDTEKMQKPDWIRVRAPVSS--GYKETYNILRSRNLTTVCEEAGCPNIGECWNKNH--ATFMILGAICTRACTFCNVATG  108 (329)
Q Consensus        33 p~~~~~~kP~Wlk~~~p~~~--~~~~~~~~l~~~~L~TVCeeA~CPNi~ECw~~gt--ATFMilG~~CTR~C~FC~V~~G  108 (329)
                      ++.....+.+|+.-+...+.  ...+++.++....++.+.+.+.+++...++....  +.+++...-|..+|.||.+..+
T Consensus         9 ~~~~i~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~C~~~C~fC~~~~~   88 (369)
T 1r30_A            9 HDYDIPTTENLYFQGSAHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSR   88 (369)
T ss_dssp             ------------------CCCCCSTTTHHHHHSCHHHHHHHHHHHHHHHSCTTCCEEEEEEEEECSCBSSCCSSCSCBTT
T ss_pred             CCCCCCCHHHHHHHCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCC
T ss_conf             45678747777640146668999999999985999999999999999866989799986877448999987922998341


Q ss_pred             ------CCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHH
Q ss_conf             ------99888823579999999970775189850544534532589999999999853358689981546234468999
Q gi|254780676|r  109 ------KPQPLDPQEPENISWAVRSMKLSHVVITSVDRDDLDDGGAQHFAEVISAIRESAPSTTIEVLTPDFLRKPHALE  182 (329)
Q Consensus       109 ------~P~~~D~~EP~rvA~av~~l~Lk~vViTSV~RDDL~DgGA~hfa~~I~~Ir~~~P~~~IEvLiPDf~G~~~al~  182 (329)
                            ++..++++|-.+.++.++.+|.+++.+++-.= .+.......+.+.++..+.....+.+-...    -..+.++
T Consensus        89 ~~~~~~~~~~~~~e~i~~~~~~~~~~g~~~i~~~gg~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~  163 (369)
T 1r30_A           89 YKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWK-NPHERDMPYLEQMVQGVKAMGLEACMTLGT----LSESQAQ  163 (369)
T ss_dssp             SCTTCCCCCCCCHHHHHHHHHHHHHTTCSEEEEEECCS-SCCTTTHHHHHHHHHHHHHTTSEEEEECSS----CCHHHHH
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEEECC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCC----CCHHHHH
T ss_conf             89998754557878999999999973997999987358-865269999999999865238445305577----8999999


Q ss_pred             HHHHCCCHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCEEEEEEECHHHHHHHHHHHHHCCCCEEE
Q ss_conf             87410702332013830002756389703589999999999708916701404887642068899999999966993997
Q gi|254780676|r  183 KVVSAKPDVFNHNLETVASNYLMVRPGARYFHSLRLLQRVKELDPLIFTKSGIMLGLGETRNEILQLMDDLRTADVDFLT  262 (329)
Q Consensus       183 ~v~~A~pdV~nHNiETV~rLy~~VRp~a~Y~rSL~vL~~aK~~~~~i~TKSGlMvGLGEt~eEi~e~l~DLr~~gvdilT  262 (329)
                      .+.+++.+.+..++++.++.+..++.+.+|++.++.++.+++.|.  .+...+|+|.||+.+|+.++++.+++.|++..+
T Consensus       164 ~l~~~g~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~g~--~~~~~~i~g~~~~~~~~~~~~~~~~~l~~~~~~  241 (369)
T 1r30_A          164 RLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVRDAGI--KVCSGGIVGLGETVKDRAGLLLQLANLPTPPES  241 (369)
T ss_dssp             HHHHHCCCEEECCCBSCHHHHHHHCCSSCHHHHHHHHHHHHHHHC--EEECCEEECSSCCHHHHHHHHHHHHSSSSCCSE
T ss_pred             HHHHCCCCEEECCCCCCCHHHCCCCCCCCHHHHHHHHHHHHHCCC--CEEEEEEECCCCCHHHHHHHHHHHHHCCCCCCE
T ss_conf             998478608975302020122046777889999999999998699--165214836999999999999999865889888


Q ss_pred             CCHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCCCCCCC
Q ss_conf             50222786100780002384699999999997496243404830010
Q gi|254780676|r  263 MGQYLQPTRKHHKVESFVTPQDFKSYETIAYSKGFLMVSASPLTRSS  309 (329)
Q Consensus       263 iGQYL~Ps~~h~pV~ryv~P~eF~~~~~~a~~~Gf~~V~SgPlVRSS  309 (329)
                      |..+.-.-....+..++..+..++..+.++....+......++.+++
T Consensus       242 i~~~~~~p~~gt~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  288 (369)
T 1r30_A          242 VPINMLVKVKGTPLADNDDVDAFDFIRTIAVARIMMPTSYVRLSAGR  288 (369)
T ss_dssp             EEEEECCCCTTSTTSSCCCCCHHHHHHHHHHHHHHCTTSEEEEESSG
T ss_pred             EEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEECH
T ss_conf             76051068999864446799999999999999997888762686125



>3iix_A (A:) Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>1olt_A (A:1-364) Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4S cluster; HET: SAM; 2.07A {Escherichia coli} Back     alignment and structure
>2a5h_A (A:95-342) L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, S-adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale} Back     alignment and structure
>3c8f_A (A:) Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A* Back     alignment and structure
>2yx0_A (A:) Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii} Back     alignment and structure
>1tv8_A (A:1-313) MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} Back     alignment and structure
>2qgq_A (A:113-234) Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8} Back     alignment and structure
>2z2u_A (A:) UPF0026 protein MJ0257; metal binding protein; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>1nvm_A (A:1-273) HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling, bifunctional enzyme; HET: NAD; 1.70A {Pseudomonas SP} Back     alignment and structure
>3eeg_A (A:) 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3ivs_A (A:1-311) Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensation, amino-acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* Back     alignment and structure
>3ewb_X (X:) 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>3chv_A (A:) Prokaryotic domain of unknown function (DUF849) with A TIM barrel fold; YP_164873.1; HET: MSE; 1.45A {Silicibacter pomeroyi dss-3} PDB: 3fa5_A Back     alignment and structure
>1ydn_A (A:) Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein structure initiative; 2.30A {Brucella melitensis 16M} Back     alignment and structure
>2ftp_A (A:) Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1ydo_A (A:) HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>3ble_A (A:) Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>2ztj_A (A:1-277) Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid biosynthesis, cytoplasm, lysine biosynthesis; HET: AKG; 1.80A {Thermus thermophilus HB27} PDB: 2ztk_A* Back     alignment and structure
>1rqb_A (A:1-308,A:422-472) Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transferase; HET: KCX; 1.90A {Propionibacterium freudenreichiisubsp} Back     alignment and structure
>3can_A (A:) Pyruvate-formate lyase-activating enzyme; structural genomics, PSI, MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2qgq_A (A:1-112) Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8} Back     alignment and structure