254780677

254780677

hypothetical protein CLIBASIA_02820

GeneID in NCBI database:8209681Locus tag:CLIBASIA_02820
Protein GI in NCBI database:254780677Protein Accession:YP_003065090.1
Gene range:-(589899, 590357)Protein Length:152aa
Gene description:hypothetical protein
COG prediction:[I] Oligoketide cyclase/lipid transport protein
KEGG prediction:hypothetical protein
SEED prediction:Putative oligoketide cyclase/lipid transport protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLFDMMLKAIFDPSFLSFAKAFEERAHKIYHLPSL
cccEEEEEEEcccHHHHHHHHccHHHHHHHccccccEEEEEEcccccccEEEEEEEEEEEEEEEEEEEEEEEEccccEEEEEEcccccHHccEEEEEEEcccccEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
ccccccEEEccccHHHHHHHHHHHHHcccccccccccEEEEccccccccEEEEEEEEccccEEEEEEEEEEccccccEEEEEEcccccHHcccEEEEEcccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
MYHFTADRIVNHSSQQMLSLVSDierypefvplCKKVViherdnygenEVLVASMTINYACMQREFMTQVRINQKEHYIAVKHIKNLFNFLENhwhfeeiseskckVHFSIKYELKNRLFDMMLKAIFDPSFLSFAKAFEERAHkiyhlpsl
myhftadrivnhssqQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEeiseskckvHFSIKYELKNRLFDMMLKAIFDPSFLSFAKAFEERAHkiyhlpsl
MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLFDMMLKAIFDPSFLSFAKAFEERAHKIYHLPSL
***FTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLFDMMLKAIFDPSFLSFAKAFEERAHKIYHLP**
MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLFDMMLKAIFDPSFLSFAKAFEERAHKIYHLPSL
***FTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLFDMMLKAIFDPSFLSFAKAFEERAHKIYHLPS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLFDMMLKAIFDPSFLSFAKAFEERAHKIYHLPSL
MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLFDMMLKAIFDPSFLSFAKAFEERAHKIYHLPSL
MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLFDMMLKAIFDPSFLSFAKAFEERAHKIYHLPSL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target152 hypothetical protein CLIBASIA_02820 [Candidatus Liberib
315122212160 hypothetical protein CKC_02310 [Candidatus Liberibacter 1 2e-51
325292771151 oligoketide cyclase/dehydrase protein [Agrobacterium sp 1 5e-33
116252008150 hypothetical protein RL2252 [Rhizobium leguminosarum bv 1 1e-32
121601706153 cyclase/dehydrase family protein [Bartonella bacillifor 1 2e-32
209549213150 cyclase/dehydrase [Rhizobium leguminosarum bv. trifolii 1 2e-32
241204535150 cyclase/dehydrase [Rhizobium leguminosarum bv. trifolii 1 3e-32
150396304149 cyclase/dehydrase [Sinorhizobium medicae WSM419] Length 1 2e-31
15965207149 hypothetical protein SMc01038 [Sinorhizobium meliloti 1 1 3e-31
307309221149 cyclase/dehydrase [Sinorhizobium meliloti BL225C] Lengt 1 3e-31
15888766151 hypothetical protein Atu1441 [Agrobacterium tumefaciens 1 4e-31
>gi|315122212|ref|YP_004062701.1| hypothetical protein CKC_02310 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 160 Back     alignment and organism information
 Score =  205 bits (521), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 95/152 (62%), Positives = 126/152 (82%)

Query: 1   MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYA 60
           M+HFTADRIVN+SS+QM  LV+D+E+YPEFVPLCK++VIHE +  G +++L+ASM I+Y 
Sbjct: 1   MHHFTADRIVNYSSKQMFDLVADVEKYPEFVPLCKELVIHESEQRGSDKILIASMKISYV 60

Query: 61  CMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLF 120
            +Q  F+T+V+I++ ++ I+V+H+KNLFN LEN W+FEEIS SKC V FSIKYEL+NRLF
Sbjct: 61  GIQETFVTRVQIDEHQNRISVRHLKNLFNSLENDWYFEEISGSKCIVRFSIKYELQNRLF 120

Query: 121 DMMLKAIFDPSFLSFAKAFEERAHKIYHLPSL 152
           D ML+AIF+P+F +F KAFE RA KIY   SL
Sbjct: 121 DKMLRAIFEPAFSAFVKAFERRAKKIYFPLSL 152


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325292771|ref|YP_004278635.1| oligoketide cyclase/dehydrase protein [Agrobacterium sp. H13-3] Length = 151 Back     alignment and organism information
>gi|116252008|ref|YP_767846.1| hypothetical protein RL2252 [Rhizobium leguminosarum bv. viciae 3841] Length = 150 Back     alignment and organism information
>gi|121601706|ref|YP_988854.1| cyclase/dehydrase family protein [Bartonella bacilliformis KC583] Length = 153 Back     alignment and organism information
>gi|209549213|ref|YP_002281130.1| cyclase/dehydrase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 150 Back     alignment and organism information
>gi|241204535|ref|YP_002975631.1| cyclase/dehydrase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 150 Back     alignment and organism information
>gi|150396304|ref|YP_001326771.1| cyclase/dehydrase [Sinorhizobium medicae WSM419] Length = 149 Back     alignment and organism information
>gi|15965207|ref|NP_385560.1| hypothetical protein SMc01038 [Sinorhizobium meliloti 1021] Length = 149 Back     alignment and organism information
>gi|307309221|ref|ZP_07588892.1| cyclase/dehydrase [Sinorhizobium meliloti BL225C] Length = 149 Back     alignment and organism information
>gi|15888766|ref|NP_354447.1| hypothetical protein Atu1441 [Agrobacterium tumefaciens str. C58] Length = 151 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target152 hypothetical protein CLIBASIA_02820 [Candidatus Liberib
COG2867146 COG2867, COG2867, Oligoketide cyclase/lipid transport p 2e-31
KOG3177227 KOG3177, KOG3177, KOG3177, Oligoketide cyclase/lipid tr 8e-19
pfam03364125 pfam03364, Polyketide_cyc, Polyketide cyclase / dehydra 4e-18
PRK10724158 PRK10724, PRK10724, hypothetical protein; Provisional 7e-13
cd07812141 cd07812, SRPBCC, START/RHO_alpha_C/PITP/Bet_v1/CoxG/Cal 2e-06
cd07813138 cd07813, COQ10p_like, Coenzyme Q-binding protein COQ10p 1e-37
cd07819140 cd07819, SRPBCC_2, Ligand-binding SRPBCC domain of an u 0.002
>gnl|CDD|32694 COG2867, COG2867, Oligoketide cyclase/lipid transport protein [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|38387 KOG3177, KOG3177, KOG3177, Oligoketide cyclase/lipid transport protein [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|146152 pfam03364, Polyketide_cyc, Polyketide cyclase / dehydrase and lipid transport Back     alignment and domain information
>gnl|CDD|182678 PRK10724, PRK10724, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|176854 cd07812, SRPBCC, START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC) ligand-binding domain superfamily Back     alignment and domain information
>gnl|CDD|176855 cd07813, COQ10p_like, Coenzyme Q-binding protein COQ10p and similar proteins Back     alignment and domain information
>gnl|CDD|176861 cd07819, SRPBCC_2, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 152 hypothetical protein CLIBASIA_02820 [Candidatus Liberib
PRK10724158 hypothetical protein; Provisional 100.0
COG2867146 Oligoketide cyclase/lipid transport protein [Lipid meta 100.0
KOG3177227 consensus 99.98
pfam03364125 Polyketide_cyc Polyketide cyclase / dehydrase and lipid 99.92
COG5637217 Predicted integral membrane protein [Function unknown] 99.57
pfam10604139 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipi 99.56
pfam06240140 COXG Carbon monoxide dehydrogenase subunit G (CoxG). Th 98.79
COG3427146 Carbon monoxide dehydrogenase subunit G, CoxG [Energy p 98.58
cd00177212 START START(STeroidogenic Acute Regulatory (STAR) relat 98.5
pfam01852207 START START domain. 97.77
smart00234206 START in StAR and phosphatidylcholine transfer protein. 97.66
COG4276153 Uncharacterized conserved protein [Function unknown] 97.44
pfam10698159 DUF2505 Protein of unknown function (DUF2505). Members 95.57
pfam11687120 DUF3284 Domain of unknown function (DUF3284). This fami 94.1
pfam00407150 Bet_v_1 Pathogenesis-related protein Bet v I family. Th 97.64
COG3832149 Uncharacterized conserved protein [Function unknown] 96.32
pfam08327124 AHSA1 Activator of Hsp90 ATPase homolog 1-like protein. 94.32
>PRK10724 hypothetical protein; Provisional Back     alignment and domain information
>COG2867 Oligoketide cyclase/lipid transport protein [Lipid metabolism] Back     alignment and domain information
>KOG3177 consensus Back     alignment and domain information
>pfam03364 Polyketide_cyc Polyketide cyclase / dehydrase and lipid transport Back     alignment and domain information
>COG5637 Predicted integral membrane protein [Function unknown] Back     alignment and domain information
>pfam10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport Back     alignment and domain information
>pfam06240 COXG Carbon monoxide dehydrogenase subunit G (CoxG) Back     alignment and domain information
>COG3427 Carbon monoxide dehydrogenase subunit G, CoxG [Energy production and conversion] Back     alignment and domain information
>cd00177 START START(STeroidogenic Acute Regulatory (STAR) related lipid Transfer) Domain Back     alignment and domain information
>pfam01852 START START domain Back     alignment and domain information
>smart00234 START in StAR and phosphatidylcholine transfer protein Back     alignment and domain information
>COG4276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam10698 DUF2505 Protein of unknown function (DUF2505) Back     alignment and domain information
>pfam11687 DUF3284 Domain of unknown function (DUF3284) Back     alignment and domain information
>pfam00407 Bet_v_1 Pathogenesis-related protein Bet v I family Back     alignment and domain information
>COG3832 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam08327 AHSA1 Activator of Hsp90 ATPase homolog 1-like protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target152 hypothetical protein CLIBASIA_02820 [Candidatus Liberib
1t17_A148 Solution Structure Of The 18 Kda Protein Cc1736 Fro 3e-30
2d4r_A147 Crystal Structure Of Ttha0849 From Thermus Thermoph 6e-08
3p9v_A161 High Resolution Crystal Structure Of Protein Maqu_3 8e-05
3ggn_A155 Crystal Structure Of Dr_a0006 From Deinococcus Radi 3e-04
2kcz_A155 Solution Nmr Structure Of The C-Terminal Domain Of 5e-04
2rer_A173 Crystal Structure Of The AromataseCYCLASE DOMAIN OF 2e-04
2rez_A157 Tetracenomycin AroCYC NAI STRUCTURE Length = 157 4e-04
2res_A173 Tetracenomycin AroCYC MUTANT R69A Length = 173 0.001
gi|58176733|pdb|1T17|A Chain A, Solution Structure Of The 18 Kda Protein Cc1736 From Caulobacter Crescentus: The Northeast Structural Genomics Consortium Target Ccr19 Length = 148 Back     alignment and structure
 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/149 (24%), Positives = 68/149 (45%), Gaps = 1/149 (0%)

Query: 1   MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYA 60
           M+     +++ ++  Q+  LV D++ YP+FVP    +        G    + A   + ++
Sbjct: 1   MHRHVVTKVLPYTPDQLFELVGDVDAYPKFVPWITGMRTWNGRVDGAVSTVDAEAQVGFS 60

Query: 61  CMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLF 120
            ++ +F T+VR ++    I V  +   F  L N W F    +   +V F I++  K+ L 
Sbjct: 61  FLREKFATRVRRDKDARSIDVSLLYGPFKRLNNGWRFMPEGD-ATRVEFVIEFAFKSALL 119

Query: 121 DMMLKAIFDPSFLSFAKAFEERAHKIYHL 149
           D ML A  D +       FE RA +++  
Sbjct: 120 DAMLAANVDRAAGKLIACFEARAQQLHGA 148


>gi|85544521|pdb|2D4R|A Chain A, Crystal Structure Of Ttha0849 From Thermus Thermophilus Hb8 Length = 147 Back     alignment and structure
>gi|310690000|pdb|3P9V|A Chain A, High Resolution Crystal Structure Of Protein Maqu_3174 From Marinobacter Aquaeolei, Northeast Structural Genomics Consortium Target Mqr197 Length = 161 Back     alignment and structure
>gi|225734269|pdb|3GGN|A Chain A, Crystal Structure Of Dr_a0006 From Deinococcus Radiodurans. Northeast Structural Genomics Consortium Target Drr147d Length = 155 Back     alignment and structure
>gi|221046466|pdb|2KCZ|A Chain A, Solution Nmr Structure Of The C-Terminal Domain Of Protein Dr_a0006 From Deinococcus Radiodurans. Northeast Structural Genomics Consortium Target Drr147d Length = 155 Back     alignment and structure
>gi|185177603|pdb|2RER|A Chain A, Crystal Structure Of The AromataseCYCLASE DOMAIN OF TCMN From Streptomyces Glaucescens Length = 173 Back     alignment and structure
>gi|185177605|pdb|2REZ|A Chain A, Tetracenomycin AroCYC NAI STRUCTURE Length = 157 Back     alignment and structure
>gi|185177604|pdb|2RES|A Chain A, Tetracenomycin AroCYC MUTANT R69A Length = 173 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target152 hypothetical protein CLIBASIA_02820 [Candidatus Liberib
1t17_A148 Conserved hypothetical protein; beta-alpha-beta-BETA-be 3e-23
2d4r_A147 Hypothetical protein TTHA0849; start domain, structural 3e-17
2kf2_A167 Putative polyketide cyclase; aromatase/cyclase, ARO/CYC 4e-14
3p9v_A161 Uncharacterized protein; structural genomics, PSI-2, pr 2e-11
2rer_A173 Multifunctional cyclase-dehydratase-3-O-methyl transfer 6e-10
2pcs_A162 Conserved protein; structural genomics, unknown functio 4e-09
3p51_A160 Uncharacterized protein; structural genomics, PSI-2, pr 3e-08
3ggn_A155 Uncharacterized protein DR_A0006; structural genomics, 7e-08
2ns9_A157 Hypothetical protein APE2225; uncharacterized conserved 4e-07
>1t17_A Conserved hypothetical protein; beta-alpha-beta-BETA-beta-BETA-beta-BETA-helix, structural genomics, protein structure initiative; NMR {Caulobacter crescentus CB15} SCOP: d.129.3.6 Length = 148 Back     alignment and structure
 Score =  102 bits (255), Expect = 3e-23
 Identities = 37/147 (25%), Positives = 69/147 (46%), Gaps = 1/147 (0%)

Query: 1   MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYA 60
           M+     +++ ++  Q+  LV D++ YP+FVP    +        G    + A   + ++
Sbjct: 1   MHRHVVTKVLPYTPDQLFELVGDVDAYPKFVPWITGMRTWNGRVDGAVSTVDAEAQVGFS 60

Query: 61  CMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLF 120
            ++ +F T+VR ++    I V  +   F  L N W F    ++  +V F I++  K+ L 
Sbjct: 61  FLREKFATRVRRDKDARSIDVSLLYGPFKRLNNGWRFMPEGDA-TRVEFVIEFAFKSALL 119

Query: 121 DMMLKAIFDPSFLSFAKAFEERAHKIY 147
           D ML A  D +       FE RA +++
Sbjct: 120 DAMLAANVDRAAGKLIACFEARAQQLH 146


>2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus HB8} SCOP: d.129.3.6 Length = 147 Back     alignment and structure
>2kf2_A Putative polyketide cyclase; aromatase/cyclase, ARO/CYC, structural genomics, PSI-2, protein structure initiative; NMR {Streptomyces coelicolor A3} Length = 167 Back     alignment and structure
>3p9v_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 1.78A {Marinobacter aquaeolei} Length = 161 Back     alignment and structure
>2rer_A Multifunctional cyclase-dehydratase-3-O-methyl transferase TCMN; aromatase, polyketide, helix-GRIP, anticancer, antibiotic; 1.90A {Streptomyces glaucescens} SCOP: d.129.3.6 PDB: 2res_A 2rez_A Length = 173 Back     alignment and structure
>2pcs_A Conserved protein; structural genomics, unknown function, ligand binding, PSI- 2, protein structure initiative; HET: UNL; 2.40A {Geobacillus kaustophilus HTA426} SCOP: d.129.3.10 Length = 162 Back     alignment and structure
>3p51_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.06A {Nitrosospira multiformis} Length = 160 Back     alignment and structure
>3ggn_A Uncharacterized protein DR_A0006; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Deinococcus radiodurans R1} PDB: 2kcz_A Length = 155 Back     alignment and structure
>2ns9_A Hypothetical protein APE2225; uncharacterized conserved protein, structural genomics, PSI, protein structure initiative; 1.80A {Aeropyrum pernix} SCOP: d.129.3.10 Length = 157 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target152 hypothetical protein CLIBASIA_02820 [Candidatus Liberib
1t17_A148 Conserved hypothetical protein; beta-alpha-beta-BETA-be 100.0
2d4r_A147 Hypothetical protein TTHA0849; start domain, structural 99.89
2rer_A173 Multifunctional cyclase-dehydratase-3-O-methyl transfer 99.81
2kf2_A167 Putative polyketide cyclase; aromatase/cyclase, ARO/CYC 99.81
3p9v_A161 Uncharacterized protein; structural genomics, PSI-2, pr 99.77
3ggn_A155 Uncharacterized protein DR_A0006; structural genomics, 99.72
3f08_A146 Uncharacterized protein Q6HG14; NESG Q6HG14_bachk Q6HG1 99.56
2ns9_A157 Hypothetical protein APE2225; uncharacterized conserved 99.56
3p51_A160 Uncharacterized protein; structural genomics, PSI-2, pr 99.55
3ijt_A155 SMU.440, putative uncharacterized protein; hypothetical 99.49
2pcs_A162 Conserved protein; structural genomics, unknown functio 99.24
2qpv_A156 Uncharacterized protein ATU1531; structural genomics, P 99.01
1em2_A229 MLN64 protein; beta barrel, lipid binding protein; HET: 98.97
1jss_A224 Stard4, cholesterol-regulated start protein 4; start do 98.82
2vq5_A201 S-norcoclaurine synthase; lyase, S- norcoclaurine biosy 98.8
2r55_A231 STAR-related lipid transfer protein 5; alpha and beta p 98.76
2flh_A155 Cytokinin-specific binding protein; zeatin, pathogenesi 98.71
1ln1_A214 PC-TP, phosphatidylcholine transfer protein; start doma 98.64
2e3n_A255 Lipid-transfer protein CERT; ceramide transfer, lipid t 98.61
3k3k_A211 Abscisic acid receptor PYR1; ABA receptor, plant hormon 98.45
3jrs_A208 PYL1, putative uncharacterized protein AT5G46790; plant 98.39
3kl1_A190 PYL2, putative uncharacterized protein AT2G26040; absci 98.33
1z94_A147 Conserved hypothetical protein; NESG, CV1439, structura 98.03
1xfs_A178 NC_840354, conserved hypothetical protein; structural g 97.92
2pso_A237 STAR-related lipid transfer protein 13; alpha and beta 97.9
3klx_A209 F3N23.20 protein, PYL3; abscisic acid receptor, crystal 97.84
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1 97.83
1zxf_A155 CALC; SELF-sacrificing resistance protein, structural g 96.78
3ni8_A158 PFC0360W protein; heat shock, malaria, ATPase, structur 96.06
3fo5_A258 Thioesterase, adipose associated, isoform BFIT2; orthog 98.42
2vjg_A154 Major allergen DAU C 1; major carrot allergen, pathogen 98.27
1fm4_A159 Major pollen allergen BET V 1-L; alpha-beta: 6 anti-par 98.19
1xuv_A178 Hypothetical protein MM0500; alpha-beta protein, northe 98.16
1tw0_A157 Pathogenesis-related class 10 protein SPE-16; seven ant 98.14
1e09_A159 PRU AV 1; allergen, major cherry allergen, pathogenesis 98.11
1icx_A155 Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-ter 98.08
2qim_A158 PR10.2B; trans-zeatin, cytokinin, plant hormones, plant 97.88
2i9y_A166 Major latex protein-like protein 28 or MLP-like protein 97.82
3otl_A158 Putative uncharacterized protein; structural genomics, 97.82
3eli_A152 AHSA1, AHA1 domain protein; alpha-beta protein, structu 97.82
2il5_A171 Hypothetical protein; structural genomics, APC23650, PS 97.8
1xn6_A143 Hypothetical protein BC4709; structural genomics, prote 97.77
1xn5_A146 BH1534 unknown conserved protein; structural genomics, 97.7
2nn5_A184 Hypothetical protein EF_2215; structural genomics, APC2 97.63
2k5g_A191 Uncharacterized protein; structural genomiccs, protein 97.53
2kew_A152 Uncharacterized protein YNDB; start domain, resonance a 97.4
3ie5_A165 Phenolic oxidative coupling protein HYP-1; hypericin, S 97.38
1x53_A145 Activator of 90 kDa heat shock protein ATPase homolog 1 95.62
1vjh_A122 BET V I allergen family; structural genomics, center fo 94.25
>1t17_A Conserved hypothetical protein; beta-alpha-beta-BETA-beta-BETA-beta-BETA-helix, structural genomics, protein structure initiative; NMR {Caulobacter crescentus CB15} SCOP: d.129.3.6 Back     alignment and structure
Probab=100.00  E-value=1.1e-36  Score=253.43  Aligned_cols=148  Identities=25%  Similarity=0.446  Sum_probs=143.0

Q ss_pred             CCCEEEEEEECCCHHHHHHHHHHHHHCHHHCCCCCEEEEEECCCCCCCEEEEEEEEECCCEEEEEEEEEEECCCCCEEEE
Q ss_conf             97248999835987999999875742310187520579997268888419999999623126899988861576620896
Q gi|254780677|r    1 MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQREFMTQVRINQKEHYIA   80 (152)
Q Consensus         1 M~~~~~~~~i~~~~e~i~~iV~Dve~YpeFlP~c~~~~v~~r~~~~~~~~~~a~l~v~~~~~~~~~~s~~~~~~~~~~i~   80 (152)
                      |++++.+++|+|||+++|++|+|||+||+|+|||.+++|+++.+++......+.+.++++++..+++++....++...+.
T Consensus         1 m~~~~~~~ii~~s~e~vf~vI~Dve~Yp~FlP~c~~s~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (148)
T 1t17_A            1 MHRHVVTKVLPYTPDQLFELVGDVDAYPKFVPWITGMRTWNGRVDGAVSTVDAEAQVGFSFLREKFATRVRRDKDARSID   80 (148)
T ss_dssp             CCEEEEEEEESSCTHHHHHHHTTTTCCSSCCSSCCCCCEEEEEEETTEEEEEEEEECSTTSSCCEEEEEEEEETTTCEEE
T ss_pred             CCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCEEEEEEEEEEEEEEEEEEEEEEEECCCCEEEE
T ss_conf             98427999837999999999997877766560227059996046787206999999985235788888864057725999


Q ss_pred             EECCCCCEEEEEEEEEEEECCCCCEEEEEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             312454102113799999879981899999998508878999999999999999999999999977089
Q gi|254780677|r   81 VKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLFDMMLKAIFDPSFLSFAKAFEERAHKIYHL  149 (152)
Q Consensus        81 ~~~~~g~f~~~~g~W~f~~~~~~~t~V~~~l~fe~~~~~~~~~~~~~~~~~~~~~i~aF~~Ra~~~yg~  149 (152)
                      ....+|+|+.+.|.|+|.|.++ +|+|+|+++|||++|+++.+++++++.++++||+||++||++|||.
T Consensus        81 ~~~~~~~~~~~~~~w~~~~~~~-~T~V~~~l~fe~~~~l~~~~~~~~~~~~~~~~i~aF~~Ra~~lyg~  148 (148)
T 1t17_A           81 VSLLYGPFKRLNNGWRFMPEGD-ATRVEFVIEFAFKSALLDAMLAANVDRAAGKLIACFEARAQQLHGA  148 (148)
T ss_dssp             EEESSTTSSCEEEEEEEEEETT-EEEEEEEEEECCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_pred             EECCCCHHHHCCCCEEECCCCC-CEEEEEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             8506764675276158526789-5599999999878488999999999999999999999999997393



>2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus HB8} SCOP: d.129.3.6 Back     alignment and structure
>2rer_A Multifunctional cyclase-dehydratase-3-O-methyl transferase TCMN; aromatase, polyketide, helix-GRIP, anticancer, antibiotic; 1.90A {Streptomyces glaucescens} SCOP: d.129.3.6 PDB: 2res_A 2rez_A Back     alignment and structure
>2kf2_A Putative polyketide cyclase; aromatase/cyclase, ARO/CYC, structural genomics, PSI-2, protein structure initiative; NMR {Streptomyces coelicolor A3} Back     alignment and structure
>3p9v_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 1.78A {Marinobacter aquaeolei} Back     alignment and structure
>3ggn_A Uncharacterized protein DR_A0006; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Deinococcus radiodurans R1} PDB: 2kcz_A Back     alignment and structure
>3f08_A Uncharacterized protein Q6HG14; NESG Q6HG14_bachk Q6HG14 BUR153, structural genomics, PSI-2; 2.20A {Bacillus thuringiensis serovarkonkukian} PDB: 3cnw_A Back     alignment and structure
>2ns9_A Hypothetical protein APE2225; uncharacterized conserved protein, structural genomics, PSI, protein structure initiative; 1.80A {Aeropyrum pernix} SCOP: d.129.3.10 Back     alignment and structure
>3p51_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.06A {Nitrosospira multiformis} Back     alignment and structure
>3ijt_A SMU.440, putative uncharacterized protein; hypothetical protein, unknown function; 2.38A {Streptococcus mutans} PDB: 2b79_A Back     alignment and structure
>2pcs_A Conserved protein; structural genomics, unknown function, ligand binding, PSI- 2, protein structure initiative; HET: UNL; 2.40A {Geobacillus kaustophilus HTA426} SCOP: d.129.3.10 Back     alignment and structure
>2qpv_A Uncharacterized protein ATU1531; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.35A {Agrobacterium tumefaciens str} SCOP: d.129.3.8 Back     alignment and structure
>1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Back     alignment and structure
>2vq5_A S-norcoclaurine synthase; lyase, S- norcoclaurine biosynthesis, dopamine, hydroxybenzaldehyde; HET: MSE LDP HBA; 2.09A {Thalictrum flavum} PDB: 2vne_A* Back     alignment and structure
>2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural genomics, structural genomics consortium, SGC; 2.50A {Homo sapiens} Back     alignment and structure
>2flh_A Cytokinin-specific binding protein; zeatin, pathogenesis-related proteins, multiple- ligand binding, plant protein; HET: ZEA; 1.20A {Vigna radiata} PDB: 3c0v_A* Back     alignment and structure
>1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* Back     alignment and structure
>2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* Back     alignment and structure
>3k3k_A Abscisic acid receptor PYR1; ABA receptor, plant hormone receptor, ABA, ABA sensor, drought tolerance, plant development, SEED dormancy; HET: A8S; 1.70A {Arabidopsis thaliana} PDB: 3k90_A* 3jrq_B* 3kdj_A* 3kay_A Back     alignment and structure
>3jrs_A PYL1, putative uncharacterized protein AT5G46790; plant hormone receptor, abscisic acid; HET: A8S; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>3kl1_A PYL2, putative uncharacterized protein AT2G26040; abscisic acid receptor, crystal, high resolution, PP2C, HORM receptor; 1.55A {Arabidopsis thaliana} PDB: 3kdi_A* 3kdh_A 3nr4_A* 3ns2_A* 3nj0_A* 3nj1_A* 3nmh_A* 3kaz_A 3kb0_A* 3kb3_A* 3nmp_A* 3nmt_A* 3nmv_A* Back     alignment and structure
>1z94_A Conserved hypothetical protein; NESG, CV1439, structural genomics, PSI, protein structure initiative; 2.10A {Chromobacterium violaceum atcc 12472} SCOP: d.129.3.5 Back     alignment and structure
>1xfs_A NC_840354, conserved hypothetical protein; structural genomics, protein structure initiative, NESG, alpha-beta protein, PSI; 1.70A {Nitrosomonas europaea atcc 19718} SCOP: d.129.3.5 Back     alignment and structure
>2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, structural genomics, structural genomics consortium; 2.80A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>3klx_A F3N23.20 protein, PYL3; abscisic acid receptor, crystal, PP2C, hormone receptor; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-2; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1zxf_A CALC; SELF-sacrificing resistance protein, structural genomics, PSI, protein structure initiative; NMR {Micromonospora echinospora} SCOP: d.129.3.5 PDB: 2gkc_A* 2gkd_A Back     alignment and structure
>3ni8_A PFC0360W protein; heat shock, malaria, ATPase, structural genomics consortium, unknown function; 2.50A {Plasmodium falciparum} Back     alignment and structure
>3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Back     alignment and structure
>1fm4_A Major pollen allergen BET V 1-L; alpha-beta: 6 anti-parallel beta strands and 3 alpha helices.; HET: DXC; 1.97A {Betula pendula} SCOP: d.129.3.1 PDB: 3k78_A 1b6f_A 1btv_A 1bv1_A 1fsk_A 1llt_A 1qmr_A Back     alignment and structure
>1xuv_A Hypothetical protein MM0500; alpha-beta protein, northeast structural genomics consortium, NESG, structural genomics; 2.10A {Methanosarcina mazei GO1} SCOP: d.129.3.5 Back     alignment and structure
>1tw0_A Pathogenesis-related class 10 protein SPE-16; seven antiparallel beta-sheet, plant protein; 2.20A {Pachyrhizus erosus} SCOP: d.129.3.1 PDB: 1txc_A* Back     alignment and structure
>1e09_A PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} SCOP: d.129.3.1 PDB: 1h2o_A Back     alignment and structure
>1icx_A Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus} SCOP: d.129.3.1 PDB: 1ifv_A Back     alignment and structure
>2qim_A PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR- 10 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A Back     alignment and structure
>2i9y_A Major latex protein-like protein 28 or MLP-like protein 28; AT1G70830, BET V1-like, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>3otl_A Putative uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: MES; 1.90A {Rhizobium leguminosarum BV} Back     alignment and structure
>3eli_A AHSA1, AHA1 domain protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} SCOP: d.129.3.5 Back     alignment and structure
>2il5_A Hypothetical protein; structural genomics, APC23650, PSI-2, protein structure initiative, midwest center for structural genomics; 2.30A {Staphylococcus aureus subsp} SCOP: d.129.3.5 Back     alignment and structure
>1xn6_A Hypothetical protein BC4709; structural genomics, protein structure initiative, PSI, NESG target protein BCR68, alpha + beta; NMR {Bacillus cereus} SCOP: d.129.3.5 Back     alignment and structure
>1xn5_A BH1534 unknown conserved protein; structural genomics, protein structure initiative, PSI, bacillus halodurans protein BH1534; NMR {Bacillus halodurans c-125} SCOP: d.129.3.5 Back     alignment and structure
>2nn5_A Hypothetical protein EF_2215; structural genomics, APC29336, PSI-2, protein structure initiative; HET: MSE; 1.45A {Enterococcus faecalis V583} SCOP: d.129.3.5 Back     alignment and structure
>2k5g_A Uncharacterized protein; structural genomiccs, protein structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} SCOP: d.129.3.5 Back     alignment and structure
>2kew_A Uncharacterized protein YNDB; start domain, resonance assignments, lipid binding, structural genomics, unknown function, PSI-2; NMR {Bacillus subtilis subsp} PDB: 2kte_A Back     alignment and structure
>3ie5_A Phenolic oxidative coupling protein HYP-1; hypericin, ST JOHN'S WORT, depression, allergy, PR-10 protein, cytokinin, plant hormones; HET: PGE PG4 PE8 1PE; 1.69A {Hypericum perforatum} Back     alignment and structure
>1x53_A Activator of 90 kDa heat shock protein ATPase homolog 1; AHA1, HSP90,DUF704, C-terminal domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.129.3.5 Back     alignment and structure
>1vjh_A BET V I allergen family; structural genomics, center for eukaryotic structural genomics, protein structure initiative, CESG, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.129.3.1 PDB: 2q3q_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 152 hypothetical protein CLIBASIA_02820 [Candidatus Liberib
d1t17a_148 d.129.3.6 (A:) Hypothetical protein CC1736 {Caulobacter 1e-25
d2d4ra1146 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Ther 4e-18
d2pcsa1147 d.129.3.10 (A:1-147) Hypothetical protein GKP20 {Geobac 2e-12
d2rera1155 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclas 4e-09
>d1t17a_ d.129.3.6 (A:) Hypothetical protein CC1736 {Caulobacter crescentus [TaxId: 155892]} Length = 148 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: TBP-like
superfamily: Bet v1-like
family: oligoketide cyclase/dehydrase-like
domain: Hypothetical protein CC1736
species: Caulobacter crescentus [TaxId: 155892]
 Score =  109 bits (272), Expect = 1e-25
 Identities = 37/147 (25%), Positives = 69/147 (46%), Gaps = 1/147 (0%)

Query: 1   MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYA 60
           M+     +++ ++  Q+  LV D++ YP+FVP    +        G    + A   + ++
Sbjct: 1   MHRHVVTKVLPYTPDQLFELVGDVDAYPKFVPWITGMRTWNGRVDGAVSTVDAEAQVGFS 60

Query: 61  CMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLF 120
            ++ +F T+VR ++    I V  +   F  L N W F    ++  +V F I++  K+ L 
Sbjct: 61  FLREKFATRVRRDKDARSIDVSLLYGPFKRLNNGWRFMPEGDA-TRVEFVIEFAFKSALL 119

Query: 121 DMMLKAIFDPSFLSFAKAFEERAHKIY 147
           D ML A  D +       FE RA +++
Sbjct: 120 DAMLAANVDRAAGKLIACFEARAQQLH 146


>d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} Length = 146 Back     information, alignment and structure
>d2pcsa1 d.129.3.10 (A:1-147) Hypothetical protein GKP20 {Geobacillus kaustophilus [TaxId: 1462]} Length = 147 Back     information, alignment and structure
>d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} Length = 155 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target152 hypothetical protein CLIBASIA_02820 [Candidatus Liberib
d1t17a_148 Hypothetical protein CC1736 {Caulobacter crescentus [Ta 100.0
d2d4ra1146 Hypothetical protein TTHA0849 {Thermus thermophilus [Ta 99.89
d2pcsa1147 Hypothetical protein GKP20 {Geobacillus kaustophilus [T 99.82
d2rera1155 Multifunctional enzyme TcmN, cyclase/aromatase domain { 99.74
d2ns9a1147 Hypothetical protein APE2225 {Aeropyrum pernix [TaxId: 99.55
d2b79a1137 Hypothetical protein SMU440 {Streptococcus mutans [TaxI 99.55
d3cnwa1138 Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1 99.47
d2qpva1133 Uncharacterized protein Atu1531 {Agrobacterium tumefaci 98.95
d1em2a_214 Lipid transport domain of Mln64 {Human (Homo sapiens) [ 98.88
d1jssa_199 Cholesterol-regulated Start protein 4 (Stard4). {Mouse 98.86
d1ln1a_203 Phosphatidylcholine transfer protein {Human (Homo sapie 98.79
d1xuva_163 Hypothetical protein MM0500 {Methanosarcina mazei [TaxI 98.5
d2psoa1197 Star-related lipid transfer protein 13 {Human (Homo sap 98.37
d1icxa_155 Plant pathogenesis-related protein PR10 {Yellow lupine 98.27
d1xfsa_165 Hypothetical protein NE0264 {Nitrosomonas europaea [Tax 97.83
d1zxfa1155 Calicheamicin gene cluster protein CalC {Micromonospora 96.71
d2bk0a1153 Major allergen api g 1 {Celery (Apium graveolens) [TaxI 98.38
d1txca1147 Plant pathogenesis-related protein PR10 {Jicama (Pachyr 98.28
d1xdfa1157 Plant pathogenesis-related protein PR10 {Yellow lupine 98.14
d1fm4a_159 Major tree pollen allergen {European white birch (Betul 98.05
d2il5a1164 Hypothetical protein SA2116 {Staphylococcus aureus [Tax 98.02
d1xn5a_138 Hypothetical protein BH1534 {Bacillus halodurans [TaxId 97.95
d1z94a1143 Hypothetical protein CV1439 {Chromobacterium violaceum 97.92
d1e09a_159 Major tree pollen allergen {Sweet cherry (Prunus avium) 97.82
d1xn6a_143 Hypothetical protein BC4709 {Bacillus cereus [TaxId: 13 97.58
d3elia1143 Uncharacterized protein SPO3351 {Silicibacter pomeroyi 97.24
d2nn5a1160 Hypothetical protein EF2215 {Enterococcus faecalis [Tax 97.18
d2k5ga1183 Uncharacterized protein BPP1335 {Bordetella parapertuss 96.96
d1vjha_120 Hypothetical protein At1G24000 {Thale cress (Arabidopsi 95.31
d1x53a1132 Activator of 90 kda heat shock protein ATPase homolog 1 95.19
>d1t17a_ d.129.3.6 (A:) Hypothetical protein CC1736 {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: TBP-like
superfamily: Bet v1-like
family: oligoketide cyclase/dehydrase-like
domain: Hypothetical protein CC1736
species: Caulobacter crescentus [TaxId: 155892]
Probab=100.00  E-value=3.4e-38  Score=261.64  Aligned_cols=148  Identities=25%  Similarity=0.446  Sum_probs=143.5

Q ss_pred             CCCEEEEEEECCCHHHHHHHHHHHHHCHHHCCCCCEEEEEECCCCCCCEEEEEEEEECCCEEEEEEEEEEECCCCCEEEE
Q ss_conf             97248999835987999999875742310187520579997268888419999999623126899988861576620896
Q gi|254780677|r    1 MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQREFMTQVRINQKEHYIA   80 (152)
Q Consensus         1 M~~~~~~~~i~~~~e~i~~iV~Dve~YpeFlP~c~~~~v~~r~~~~~~~~~~a~l~v~~~~~~~~~~s~~~~~~~~~~i~   80 (152)
                      |++++.+++|+|||+++|++|+|||+||+|+|||++++|+++.+++++..+.+++.++++++..+|++++...++...+.
T Consensus         1 m~~~~~~~vi~~~~e~vf~vV~Dve~Yp~FlP~c~~~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (148)
T d1t17a_           1 MHRHVVTKVLPYTPDQLFELVGDVDAYPKFVPWITGMRTWNGRVDGAVSTVDAEAQVGFSFLREKFATRVRRDKDARSID   80 (148)
T ss_dssp             CCEEEEEEEESSCTHHHHHHHTTTTCCSSCCSSCCCCCEEEEEEETTEEEEEEEEECSTTSSCCEEEEEEEEETTTCEEE
T ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCEEEEEEEEEEEEEEEEEEEEEEECCCCEEEE
T ss_conf             98515899917999999999998876455433437408985146555412667999974003789999864037833999


Q ss_pred             EECCCCCEEEEEEEEEEEECCCCCEEEEEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             312454102113799999879981899999998508878999999999999999999999999977089
Q gi|254780677|r   81 VKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLFDMMLKAIFDPSFLSFAKAFEERAHKIYHL  149 (152)
Q Consensus        81 ~~~~~g~f~~~~g~W~f~~~~~~~t~V~~~l~fe~~~~~~~~~~~~~~~~~~~~~i~aF~~Ra~~~yg~  149 (152)
                      +.+.+|+|+++.|.|+|.|.++ +|+|+|+++|||++|+++.+++++++.++++|++||++||++|||.
T Consensus        81 ~~~~~g~f~~l~~~W~f~~~~~-~T~V~~~l~fe~~~~l~~~~~~~~~~~~~~~~i~aF~~Ra~~lyg~  148 (148)
T d1t17a_          81 VSLLYGPFKRLNNGWRFMPEGD-ATRVEFVIEFAFKSALLDAMLAANVDRAAGKLIACFEARAQQLHGA  148 (148)
T ss_dssp             EEESSTTSSCEEEEEEEEEETT-EEEEEEEEEECCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_pred             EECCCCHHHHCCCCEEECCCCC-CEEEEEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9606716652266146426899-5699999999987799999999999999999999999999997394



>d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pcsa1 d.129.3.10 (A:1-147) Hypothetical protein GKP20 {Geobacillus kaustophilus [TaxId: 1462]} Back     information, alignment and structure
>d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} Back     information, alignment and structure
>d2ns9a1 d.129.3.10 (A:10-156) Hypothetical protein APE2225 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d3cnwa1 d.129.3.8 (A:3-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2qpva1 d.129.3.8 (A:1-133) Uncharacterized protein Atu1531 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xuva_ d.129.3.5 (A:) Hypothetical protein MM0500 {Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Back     information, alignment and structure
>d1xfsa_ d.129.3.5 (A:) Hypothetical protein NE0264 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1zxfa1 d.129.3.5 (A:1-155) Calicheamicin gene cluster protein CalC {Micromonospora echinospora [TaxId: 1877]} Back     information, alignment and structure
>d2bk0a1 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery (Apium graveolens) [TaxId: 4045]} Back     information, alignment and structure
>d1txca1 d.129.3.1 (A:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]} Back     information, alignment and structure
>d1xdfa1 d.129.3.1 (A:1-157) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Back     information, alignment and structure
>d1fm4a_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]} Back     information, alignment and structure
>d2il5a1 d.129.3.5 (A:5-168) Hypothetical protein SA2116 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xn5a_ d.129.3.5 (A:) Hypothetical protein BH1534 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1z94a1 d.129.3.5 (A:2-144) Hypothetical protein CV1439 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]} Back     information, alignment and structure
>d1xn6a_ d.129.3.5 (A:) Hypothetical protein BC4709 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d3elia1 d.129.3.5 (A:2-144) Uncharacterized protein SPO3351 {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d2nn5a1 d.129.3.5 (A:1-160) Hypothetical protein EF2215 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2k5ga1 d.129.3.5 (A:1-183) Uncharacterized protein BPP1335 {Bordetella parapertussis [TaxId: 519]} Back     information, alignment and structure
>d1vjha_ d.129.3.1 (A:) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x53a1 d.129.3.5 (A:8-139) Activator of 90 kda heat shock protein ATPase homolog 1, AHSA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 152 hypothetical protein CLIBASIA_02820 [Candidatus Li
1t17_A_148 (A:) Conserved hypothetical protein; beta-alpha-be 4e-20
2rer_A_173 (A:) Multifunctional cyclase-dehydratase-3-O-methy 3e-17
3k3k_A_44-211168 (A:44-211) Abscisic acid receptor PYR1; ABA recept 4e-17
2d4r_A_147 (A:) Hypothetical protein TTHA0849; start domain, 2e-16
3ggn_A_155 (A:) Uncharacterized protein DR_A0006; structural 7e-16
3ijt_A_155 (A:) SMU.440, putative uncharacterized protein; hy 2e-14
2kf2_A_167 (A:) Putative polyketide cyclase; aromatase/cyclas 7e-14
2pcs_A_162 (A:) Conserved protein; structural genomics, unkno 1e-13
3f08_A_146 (A:) Uncharacterized protein Q6HG14; NESG Q6HG14_b 2e-13
3jrs_A_48-208161 (A:48-208) PYL1, putative uncharacterized protein 9e-13
2ns9_A_157 (A:) Hypothetical protein APE2225; uncharacterized 3e-12
3kdh_A_29-190162 (A:29-190) PYL2, putative uncharacterized protein 6e-10
2qpv_A_156 (A:) Uncharacterized protein ATU1531; structural g 2e-05
>1t17_A (A:) Conserved hypothetical protein; beta-alpha-beta-BETA-beta-BETA-beta-BETA-helix, structural genomics, protein structure initiative; NMR {Caulobacter crescentus CB15}Length = 148 Back     alignment and structure
 Score = 91.7 bits (227), Expect = 4e-20
 Identities = 37/147 (25%), Positives = 69/147 (46%), Gaps = 1/147 (0%)

Query: 1   MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYA 60
           M+     +++ ++  Q+  LV D++ YP+FVP    +        G    + A   + ++
Sbjct: 1   MHRHVVTKVLPYTPDQLFELVGDVDAYPKFVPWITGMRTWNGRVDGAVSTVDAEAQVGFS 60

Query: 61  CMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLF 120
            ++ +F T+VR ++    I V  +   F  L N W F    ++  +V F I++  K+ L 
Sbjct: 61  FLREKFATRVRRDKDARSIDVSLLYGPFKRLNNGWRFMPEGDA-TRVEFVIEFAFKSALL 119

Query: 121 DMMLKAIFDPSFLSFAKAFEERAHKIY 147
           D ML A  D +       FE RA +++
Sbjct: 120 DAMLAANVDRAAGKLIACFEARAQQLH 146


>2rer_A (A:) Multifunctional cyclase-dehydratase-3-O-methyl transferase TCMN; aromatase, polyketide, helix-GRIP, anticancer, antibiotic; 1.90A {Streptomyces glaucescens}Length = 173 Back     alignment and structure
>3k3k_A (A:44-211) Abscisic acid receptor PYR1; ABA receptor, plant hormone receptor, ABA, ABA sensor, drought tolerance, plant development, SEED dormancy; HET: A8S; 1.70A {Arabidopsis thaliana} PDB: 3k90_A* 3jrq_B* 3kdj_A*Length = 168 Back     alignment and structure
>2d4r_A (A:) Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus HB8}Length = 147 Back     alignment and structure
>3ggn_A (A:) Uncharacterized protein DR_A0006; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Deinococcus radiodurans R1} PDB: 2kcz_ALength = 155 Back     alignment and structure
>3ijt_A (A:) SMU.440, putative uncharacterized protein; hypothetical protein, unknown function; 2.38A {Streptococcus mutans} PDB: 2b79_ALength = 155 Back     alignment and structure
>2kf2_A (A:) Putative polyketide cyclase; aromatase/cyclase, ARO/CYC, structural genomics, PSI-2, protein structure initiative; NMR {Streptomyces coelicolor A3}Length = 167 Back     alignment and structure
>2pcs_A (A:) Conserved protein; structural genomics, unknown function, ligand binding, PSI- 2, protein structure initiative; HET: UNL; 2.40A {Geobacillus kaustophilus HTA426}Length = 162 Back     alignment and structure
>3f08_A (A:) Uncharacterized protein Q6HG14; NESG Q6HG14_bachk Q6HG14 BUR153, structural genomics, PSI-2; 2.20A {Bacillus thuringiensis serovarkonkukian} PDB: 3cnw_ALength = 146 Back     alignment and structure
>3jrs_A (A:48-208) PYL1, putative uncharacterized protein AT5G46790; plant hormone receptor, abscisic acid; HET: A8S; 2.05A {Arabidopsis thaliana}Length = 161 Back     alignment and structure
>2ns9_A (A:) Hypothetical protein APE2225; uncharacterized conserved protein, structural genomics, PSI, protein structure initiative; 1.80A {Aeropyrum pernix}Length = 157 Back     alignment and structure
>3kdh_A (A:29-190) PYL2, putative uncharacterized protein AT2G26040; hormone receptor; 1.65A {Arabidopsis thaliana} PDB: 3kdi_A*Length = 162 Back     alignment and structure
>2qpv_A (A:) Uncharacterized protein ATU1531; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.35A {Agrobacterium tumefaciens str}Length = 156 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target152 hypothetical protein CLIBASIA_02820 [Candidatus Liberib
1t17_A_148 Conserved hypothetical protein; beta-alpha-beta-BE 99.87
2d4r_A_147 Hypothetical protein TTHA0849; start domain, struc 99.78
2kf2_A_167 Putative polyketide cyclase; aromatase/cyclase, AR 99.76
2rer_A_173 Multifunctional cyclase-dehydratase-3-O-methyl tra 99.73
3jrs_A_48-208161 PYL1, putative uncharacterized protein AT5G46790; 99.69
2pcs_A_162 Conserved protein; structural genomics, unknown fu 99.69
3ggn_A_155 Uncharacterized protein DR_A0006; structural genom 99.67
3k3k_A_44-211168 Abscisic acid receptor PYR1; ABA receptor, plant h 99.65
3kdh_A_29-190162 PYL2, putative uncharacterized protein AT2G26040; 99.64
3f08_A_146 Uncharacterized protein Q6HG14; NESG Q6HG14_bachk 99.62
3ijt_A_155 SMU.440, putative uncharacterized protein; hypothe 99.61
2ns9_A_157 Hypothetical protein APE2225; uncharacterized cons 99.59
2qpv_A_156 Uncharacterized protein ATU1531; structural genomi 99.49
1xuv_A_178 Hypothetical protein MM0500; alpha-beta protein, n 99.44
2vq5_A_201 S-norcoclaurine synthase; lyase, S- norcoclaurine 99.37
2flh_A_155 Cytokinin-specific binding protein; zeatin, pathog 99.31
1z94_A_147 Conserved hypothetical protein; NESG, CV1439, stru 99.26
1icx_A_155 Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, 99.15
1jss_A_224 Stard4, cholesterol-regulated start protein 4; sta 99.06
2kew_A_152 Uncharacterized protein YNDB; start domain, resona 99.01
2qim_A_158 PR10.2B; trans-zeatin, cytokinin, plant hormones, 98.99
1xn6_A_143 Hypothetical protein BC4709; structural genomics, 98.84
1xfs_A_178 NC_840354, conserved hypothetical protein; structu 98.78
3eli_A_152 AHSA1, AHA1 domain protein; alpha-beta protein, st 98.69
3fo5_A_258 Thioesterase, adipose associated, isoform BFIT2; o 98.67
2r55_A_231 STAR-related lipid transfer protein 5; alpha and b 98.67
1ln1_A_214 PC-TP, phosphatidylcholine transfer protein; start 98.66
1e09_A_159 PRU AV 1; allergen, major cherry allergen, pathoge 98.63
2e3n_A_255 Lipid-transfer protein CERT; ceramide transfer, li 98.5
1em2_A_229 MLN64 protein; beta barrel, lipid binding protein; 98.49
2pso_A_51-237187 STAR-related lipid transfer protein 13; alpha and 98.43
2nn5_A_184 Hypothetical protein EF_2215; structural genomics, 98.39
1zxf_A_155 CALC; SELF-sacrificing resistance protein, structu 97.93
1x53_A_145 Activator of 90 kDa heat shock protein ATPase homo 97.86
2il5_A_171 Hypothetical protein; structural genomics, APC2365 99.12
1tw0_A_157 Pathogenesis-related class 10 protein SPE-16; seve 99.02
2vjg_A_154 Major allergen DAU C 1; major carrot allergen, pat 98.95
2i9y_A_166 Major latex protein-like protein 28 or MLP-like pr 98.94
1fm4_A_159 Major pollen allergen BET V 1-L; alpha-beta: 6 ant 98.79
1xn5_A_146 BH1534 unknown conserved protein; structural genom 98.66
3ie5_A_165 Phenolic oxidative coupling protein HYP-1; hyperic 98.61
2k5g_A_191 Uncharacterized protein; structural genomiccs, pro 98.32
>1t17_A (A:) Conserved hypothetical protein; beta-alpha-beta-BETA-beta-BETA-beta-BETA-helix, structural genomics, protein structure initiative; NMR {Caulobacter crescentus CB15} Back     alignment and structure
Probab=99.87  E-value=1.5e-20  Score=151.30  Aligned_cols=148  Identities=25%  Similarity=0.442  Sum_probs=138.8

Q ss_pred             CCCEEEEEEECCCHHHHHHHHHHHHHCHHHCCCCCEEEEEECCCCCCCEEEEEEEEECCCEEEEEEEEEEECCCCCEEEE
Q ss_conf             97248999835987999999875742310187520579997268888419999999623126899988861576620896
Q gi|254780677|r    1 MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQREFMTQVRINQKEHYIA   80 (152)
Q Consensus         1 M~~~~~~~~i~~~~e~i~~iV~Dve~YpeFlP~c~~~~v~~r~~~~~~~~~~a~l~v~~~~~~~~~~s~~~~~~~~~~i~   80 (152)
                      |++++.+.+|++||+++|++++|+++|++|+|+|.+++++...++..+......+.+...+...++..++....++..+.
T Consensus         1 M~~~~~~~~i~ap~e~vw~~~~d~~~~~~w~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~   80 (148)
T 1t17_A            1 MHRHVVTKVLPYTPDQLFELVGDVDAYPKFVPWITGMRTWNGRVDGAVSTVDAEAQVGFSFLREKFATRVRRDKDARSID   80 (148)
T ss_dssp             CCEEEEEEEESSCTHHHHHHHTTTTCCSSCCSSCCCCCEEEEEEETTEEEEEEEEECSTTSSCCEEEEEEEEETTTCEEE
T ss_pred             CCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCEEEEEEEECCCEEEEEEEECCCCCEEEE
T ss_conf             98327899817999999999998865556563427646875466445543100567776100006999853147734899


Q ss_pred             EECCCCCEEEEEEEEEEEECCCCCEEEEEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             312454102113799999879981899999998508878999999999999999999999999977089
Q gi|254780677|r   81 VKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLFDMMLKAIFDPSFLSFAKAFEERAHKIYHL  149 (152)
Q Consensus        81 ~~~~~g~f~~~~g~W~f~~~~~~~t~V~~~l~fe~~~~~~~~~~~~~~~~~~~~~i~aF~~Ra~~~yg~  149 (152)
                      +....+++..+.+.|+|++.+ ++|+|++.+++++++++.+.++..+++....+++++|++++++++|-
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~-~gT~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~e~~~~~  148 (148)
T 1t17_A           81 VSLLYGPFKRLNNGWRFMPEG-DATRVEFVIEFAFKSALLDAMLAANVDRAAGKLIACFEARAQQLHGA  148 (148)
T ss_dssp             EEESSTTSSCEEEEEEEEEET-TEEEEEEEEEECCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_pred             EECCCCHHHHCCCCEEECCCC-CCEEEEEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             960660665236505532588-84499999999757589999999999999999999999999997393



>2d4r_A (A:) Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus HB8} Back     alignment and structure
>2kf2_A (A:) Putative polyketide cyclase; aromatase/cyclase, ARO/CYC, structural genomics, PSI-2, protein structure initiative; NMR {Streptomyces coelicolor A3} Back     alignment and structure
>2rer_A (A:) Multifunctional cyclase-dehydratase-3-O-methyl transferase TCMN; aromatase, polyketide, helix-GRIP, anticancer, antibiotic; 1.90A {Streptomyces glaucescens} Back     alignment and structure
>3jrs_A (A:48-208) PYL1, putative uncharacterized protein AT5G46790; plant hormone receptor, abscisic acid; HET: A8S; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>2pcs_A (A:) Conserved protein; structural genomics, unknown function, ligand binding, PSI- 2, protein structure initiative; HET: UNL; 2.40A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3ggn_A (A:) Uncharacterized protein DR_A0006; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Deinococcus radiodurans R1} PDB: 2kcz_A Back     alignment and structure
>3k3k_A (A:44-211) Abscisic acid receptor PYR1; ABA receptor, plant hormone receptor, ABA, ABA sensor, drought tolerance, plant development, SEED dormancy; HET: A8S; 1.70A {Arabidopsis thaliana} PDB: 3k90_A* 3jrq_B* 3kdj_A* Back     alignment and structure
>3kdh_A (A:29-190) PYL2, putative uncharacterized protein AT2G26040; hormone receptor; 1.65A {Arabidopsis thaliana} PDB: 3kdi_A* Back     alignment and structure
>3f08_A (A:) Uncharacterized protein Q6HG14; NESG Q6HG14_bachk Q6HG14 BUR153, structural genomics, PSI-2; 2.20A {Bacillus thuringiensis serovarkonkukian} PDB: 3cnw_A Back     alignment and structure
>3ijt_A (A:) SMU.440, putative uncharacterized protein; hypothetical protein, unknown function; 2.38A {Streptococcus mutans} PDB: 2b79_A Back     alignment and structure
>2ns9_A (A:) Hypothetical protein APE2225; uncharacterized conserved protein, structural genomics, PSI, protein structure initiative; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2qpv_A (A:) Uncharacterized protein ATU1531; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xuv_A (A:) Hypothetical protein MM0500; alpha-beta protein, northeast structural genomics consortium, NESG, structural genomics; 2.10A {Methanosarcina mazei GO1} Back     alignment and structure
>2vq5_A (A:) S-norcoclaurine synthase; lyase, S- norcoclaurine biosynthesis, dopamine, hydroxybenzaldehyde; HET: MSE LDP HBA; 2.09A {Thalictrum flavum} PDB: 2vne_A* Back     alignment and structure
>2flh_A (A:) Cytokinin-specific binding protein; zeatin, pathogenesis-related proteins, multiple- ligand binding, plant protein; HET: ZEA; 1.20A {Vigna radiata} PDB: 3c0v_A* Back     alignment and structure
>1z94_A (A:) Conserved hypothetical protein; NESG, CV1439, structural genomics, PSI, protein structure initiative; 2.10A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1icx_A (A:) Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus} Back     alignment and structure
>1jss_A (A:) Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} Back     alignment and structure
>2kew_A (A:) Uncharacterized protein YNDB; start domain, resonance assignments, lipid binding, structural genomics, unknown function, PSI-2; NMR {Bacillus subtilis subsp} Back     alignment and structure
>2qim_A (A:) PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR- 10 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A Back     alignment and structure
>1xn6_A (A:) Hypothetical protein BC4709; structural genomics, protein structure initiative, PSI, NESG target protein BCR68, alpha + beta; NMR {Bacillus cereus} Back     alignment and structure
>1xfs_A (A:) NC_840354, conserved hypothetical protein; structural genomics, protein structure initiative, NESG, alpha-beta protein, PSI; 1.70A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>3eli_A (A:) AHSA1, AHA1 domain protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>3fo5_A (A:) Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Back     alignment and structure
>2r55_A (A:) STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural genomics, structural genomics consortium, SGC; 2.50A {Homo sapiens} Back     alignment and structure
>1ln1_A (A:) PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} Back     alignment and structure
>1e09_A (A:) PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} Back     alignment and structure
>2e3n_A (A:) Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 2z9z_A* Back     alignment and structure
>1em2_A (A:) MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} Back     alignment and structure
>2pso_A (A:51-237) STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, structural genomics, structural genomics consortium; 2.80A {Homo sapiens} Back     alignment and structure