254780680

254780680

seryl-tRNA synthetase

GeneID in NCBI database:8209684Locus tag:CLIBASIA_02835
Protein GI in NCBI database:254780680Protein Accession:YP_003065093.1
Gene range:-(587054, 588346)Protein Length:430aa
Gene description:seryl-tRNA synthetase
COG prediction:[J] Seryl-tRNA synthetase
KEGG prediction:serS; seryl-tRNA synthetase (EC:6.1.1.11); K01875 seryl-tRNA synthetase [EC:6.1.1.11]
SEED prediction:Seryl-tRNA synthetase (EC 6.1.1.11)
Pathway involved in KEGG:Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:Glycine and Serine Utilization;
tRNA aminoacylation, Ser
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430
MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIKKEHILE
cccHHHHHccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEcccccccccccHHHHHHHHHcccccHHHHHcccccccEEEccHHHHHHHHHHHHHHHHHHHHcccEEEccccEEcHHHHHHcccccccHHHHEEccccEEEEcccHHHHHHHHHcccccHHHccEEEEEEEcEEccccccccccccccEEEEEEEEccEEEEEcHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccEEEEHHHHHHHcHHHHHHHHHHHHHHHHHHHccccccccccccccEEEcccccccccHHEEEEEEEccccccccccccHHHHHHHcccEEEccccccc
cccHHHHHHcHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHccEEEEEccccccccccccccccHHHHcccccHHHHHHHccccEEEEccHHHHHHHHHHHHHHHHcHHHcccEEEcccccEccHHccccccccccHHHHcccccccEEccccHHHHHHcccccEEEHHHccEEEEEEEEEEccccccccccccccccccEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccEEEEEEEEEHHHcEEEEEEEEEEEEcccHHHHccEEEccccccccEEEEcccccHHHHHHHHHHHHHHccccccEEEcHHHcHHccccEEEccccccc
mldiqwirqnPEHLDIALKkrhlepqseyILSLDEKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLIscipnvpleevpigtsaneNILIRsvgkkpsaihlsREHFEIGEalglmdfdratklsgarfSVLTGHLAHLERALGQFMIDlhtsehgytevsapllvrdeamygtgqipkfaddmfcttdgrwliptsevsltnlysheiieskslplrfttlapsfrseagsagrdtrgmlrQHQFWKCELVsitreedsftEHERMLSCAEEILKRLDLHYRVVSLCtgdlgfsacktYDLEVWLAGQNLYReisscstcgnfqsrrmnsryrdpnskslkfthtlngsgvAVGRCLIAILENYlnadgsvtiptvlrpyMNNLAVIKKEHILE
MLDIQWIRQNPEHLDIAlkkrhlepqseyilsldekNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLYSHeiieskslplrFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLavikkehile
MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIKKEHILE
MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILI***********************************************KEEHEVCSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVI*******
MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFR********DTRGMLRQHQFWKCELVSITR*********RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIKKEHILE
MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIKKE*IL*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLxxxxxxxxxxxxxxxxxxxxxEHEVCSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIKKEHILE
MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIKKEHILE
MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIKKEHILE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target430 seryl-tRNA synthetase [Candidatus Liberibacter asiaticu
254780870 449 prolyl-tRNA synthetase [Candidatus Liberibacter as 0.005
>gi|254780870|ref|YP_003065283.1| prolyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 449 Back     alignment
 Score = 33.9 bits (76), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 58/143 (40%), Gaps = 9/143 (6%)

Query: 191 GYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--GRWLI--PTSEVSLTNLYSHEIIE 246
           G  E+S P L   +    +G+   +  +M    D   + +I  PT E  +T+++   I  
Sbjct: 65  GAIEMSVPTLQSADLWVESGRYDSYGKEMLRLADRNDKAMIYGPTHEEVMTDIFRSHIKS 124

Query: 247 SKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT-REEDSFTEHERMLSC 305
            ++LP  F  +   FR E     R   G++R  +F   +  S     E S   + +M   
Sbjct: 125 YRNLPFTFYQIQLKFRDEL----RPRFGVMRSREFLMKDAYSFDLTPEGSKHSYNKMFVS 180

Query: 306 AEEILKRLDLHYRVVSLCTGDLG 328
              I  RL L    +   +G +G
Sbjct: 181 YLRIFHRLGLKSIPMRAESGPIG 203

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target430 seryl-tRNA synthetase [Candidatus Liberibacter asiaticu
315122209432 seryl-tRNA synthetase [Candidatus Liberibacter solanace 1 0.0
159184878427 seryl-tRNA synthetase [Agrobacterium tumefaciens str. C 1 1e-172
325293088427 Seryl-tRNA synthetase [Agrobacterium sp. H13-3] Length 1 1e-172
222148967427 seryl-tRNA synthetase [Agrobacterium vitis S4] Length = 1 1e-172
241204418427 seryl-tRNA synthetase [Rhizobium leguminosarum bv. trif 1 1e-170
116251809427 seryl-tRNA synthetase [Rhizobium leguminosarum bv. vici 1 1e-169
86357454427 seryl-tRNA synthetase [Rhizobium etli CFN 42] Length = 1 1e-167
327189128427 seryl-tRNA synthetase [Rhizobium etli CNPAF512] Length 1 1e-167
190891515427 seryl-tRNA synthetase [Rhizobium etli CIAT 652] Length 1 1e-166
222085788427 seryl-tRNA synthetase (serine-tRNA ligase) protein [Agr 1 1e-166
>gi|315122209|ref|YP_004062698.1| seryl-tRNA synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 432 Back     alignment and organism information
 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/425 (80%), Positives = 385/425 (90%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQWIRQNP+  DIALKKR+LEPQSE ILSLD + R LI++IE IRA+RNS S QIGQ
Sbjct: 1   MLDIQWIRQNPDTFDIALKKRNLEPQSECILSLDTQYRSLIRQIEKIRAQRNSKSEQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           AIA+GNL L D +K E ST+KEQLP+LE +E+E+ SSL +++SCIPN+PLE+VPIG +  
Sbjct: 61  AIAKGNLLLADTIKAEVSTIKEQLPLLEAKENEIKSSLNQILSCIPNIPLEDVPIGANEK 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           ENILIRSVG KP+AIHLS+EHFEIGE LGLMDFDR+ KLSGARFS+L  HLA LERALGQ
Sbjct: 121 ENILIRSVGNKPNAIHLSKEHFEIGEELGLMDFDRSAKLSGARFSILASHLALLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHTSEHGYTEVSAPLLVRDEAMYGTGQ+PKFA+DMFCTTDGRWLIPTSEVSLTN++
Sbjct: 181 FMLDLHTSEHGYTEVSAPLLVRDEAMYGTGQLPKFANDMFCTTDGRWLIPTSEVSLTNIF 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S+EII+   LPLR   LAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT+EE+S  EHE
Sbjct: 241 SNEIIDFNLLPLRLVALAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITKEEESHIEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RMLSCAE++LK+LDLHYR+VSLC+GDLGFSACKTYDLEVWL GQNLYREISSCS CG+FQ
Sbjct: 301 RMLSCAEKVLKKLDLHYRIVSLCSGDLGFSACKTYDLEVWLPGQNLYREISSCSNCGSFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           SRRMNSRYRD  +KSLKFTHTLNGSGVAVGRCLIAILENYLN DGSVTIPT+LRPYM+NL
Sbjct: 361 SRRMNSRYRDSFNKSLKFTHTLNGSGVAVGRCLIAILENYLNKDGSVTIPTILRPYMHNL 420

Query: 421 AVIKK 425
            VIKK
Sbjct: 421 EVIKK 425


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159184878|ref|NP_354691.2| seryl-tRNA synthetase [Agrobacterium tumefaciens str. C58] Length = 427 Back     alignment and organism information
>gi|325293088|ref|YP_004278952.1| Seryl-tRNA synthetase [Agrobacterium sp. H13-3] Length = 427 Back     alignment and organism information
>gi|222148967|ref|YP_002549924.1| seryl-tRNA synthetase [Agrobacterium vitis S4] Length = 427 Back     alignment and organism information
>gi|241204418|ref|YP_002975514.1| seryl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 427 Back     alignment and organism information
>gi|116251809|ref|YP_767647.1| seryl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841] Length = 427 Back     alignment and organism information
>gi|86357454|ref|YP_469346.1| seryl-tRNA synthetase [Rhizobium etli CFN 42] Length = 427 Back     alignment and organism information
>gi|327189128|gb|EGE56313.1| seryl-tRNA synthetase [Rhizobium etli CNPAF512] Length = 427 Back     alignment and organism information
>gi|190891515|ref|YP_001978057.1| seryl-tRNA synthetase [Rhizobium etli CIAT 652] Length = 427 Back     alignment and organism information
>gi|222085788|ref|YP_002544318.1| seryl-tRNA synthetase (serine-tRNA ligase) protein [Agrobacterium radiobacter K84] Length = 427 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target430 seryl-tRNA synthetase [Candidatus Liberibacter asiaticu
PRK05431425 PRK05431, PRK05431, seryl-tRNA synthetase; Provisional 0.0
TIGR00414418 TIGR00414, serS, seryl-tRNA synthetase 1e-137
KOG2509455 KOG2509, KOG2509, KOG2509, Seryl-tRNA synthetase [Trans 3e-82
PLN02320502 PLN02320, PLN02320, seryl-tRNA synthetase 3e-70
PLN02678448 PLN02678, PLN02678, seryl-tRNA synthetase 2e-68
COG0172429 COG0172, SerS, Seryl-tRNA synthetase [Translation, ribo 1e-151
cd00770297 cd00770, SerRS_core, Seryl-tRNA synthetase (SerRS) clas 1e-118
pfam00587170 pfam00587, tRNA-synt_2b, tRNA synthetase class II core 6e-43
TIGR00409 568 TIGR00409, proS_fam_II, prolyl-tRNA synthetase, family 4e-07
PRK00960517 PRK00960, PRK00960, seryl-tRNA synthetase; Provisional 2e-05
TIGR00415520 TIGR00415, serS_MJ, seryl-tRNA synthetase, Methanococcu 2e-04
pfam02403108 pfam02403, Seryl_tRNA_N, Seryl-tRNA synthetase N-termin 1e-21
cd00670235 cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro_Ser_ 8e-20
cd00768211 cd00768, class_II_aaRS-like_core, Class II tRNA amino-a 3e-14
COG0442 500 COG0442, ProS, Prolyl-tRNA synthetase [Translation, rib 4e-13
cd00779255 cd00779, ProRS_core_prok, Prolyl-tRNA synthetase (ProRS 6e-11
KOG2324 457 KOG2324, KOG2324, KOG2324, Prolyl-tRNA synthetase [Tran 6e-07
cd00772264 cd00772, ProRS_core, Prolyl-tRNA synthetase (ProRS) cla 6e-05
COG0441 589 COG0441, ThrS, Threonyl-tRNA synthetase [Translation, r 2e-06
cd00771298 cd00771, ThrRS_core, Threonyl-tRNA synthetase (ThrRS) c 3e-06
TIGR00418 563 TIGR00418, thrS, threonyl-tRNA synthetase 3e-06
cd00778261 cd00778, ProRS_core_arch_euk, Prolyl-tRNA synthetase (P 0.001
>gnl|CDD|180077 PRK05431, PRK05431, seryl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|161867 TIGR00414, serS, seryl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|37720 KOG2509, KOG2509, KOG2509, Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177954 PLN02320, PLN02320, seryl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|178282 PLN02678, PLN02678, seryl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|30521 COG0172, SerS, Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|29815 cd00770, SerRS_core, Seryl-tRNA synthetase (SerRS) class II core catalytic domain Back     alignment and domain information
>gnl|CDD|144252 pfam00587, tRNA-synt_2b, tRNA synthetase class II core domain (G, H, P, S and T) Back     alignment and domain information
>gnl|CDD|161864 TIGR00409, proS_fam_II, prolyl-tRNA synthetase, family II Back     alignment and domain information
>gnl|CDD|179183 PRK00960, PRK00960, seryl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|129509 TIGR00415, serS_MJ, seryl-tRNA synthetase, Methanococcus jannaschii family Back     alignment and domain information
>gnl|CDD|145510 pfam02403, Seryl_tRNA_N, Seryl-tRNA synthetase N-terminal domain Back     alignment and domain information
>gnl|CDD|29810 cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>gnl|CDD|29813 cd00768, class_II_aaRS-like_core, Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>gnl|CDD|30791 COG0442, ProS, Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|73229 cd00779, ProRS_core_prok, Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>gnl|CDD|37535 KOG2324, KOG2324, KOG2324, Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|58340 cd00772, ProRS_core, Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>gnl|CDD|30790 COG0441, ThrS, Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|29816 cd00771, ThrRS_core, Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>gnl|CDD|161870 TIGR00418, thrS, threonyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|29823 cd00778, ProRS_core_arch_euk, Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 430 seryl-tRNA synthetase [Candidatus Liberibacter asiaticu
PRK05431422 seryl-tRNA synthetase; Provisional 100.0
COG0172429 SerS Seryl-tRNA synthetase [Translation, ribosomal stru 100.0
KOG2509455 consensus 100.0
TIGR00414460 serS seryl-tRNA synthetase; InterPro: IPR002317 The ami 100.0
cd00770297 SerRS_core Seryl-tRNA synthetase (SerRS) class II core 100.0
cd00779255 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II 100.0
cd00771298 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II co 99.97
cd00772264 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core 99.93
cd00778261 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) clas 99.89
PRK12325438 prolyl-tRNA synthetase; Provisional 99.89
PRK12305576 thrS threonyl-tRNA synthetase; Reviewed 99.88
PRK12444639 threonyl-tRNA synthetase; Reviewed 99.87
PRK03772642 threonyl-tRNA synthetase; Validated 99.87
PRK00413639 thrS threonyl-tRNA synthetase; Reviewed 99.86
PRK04483634 threonyl-tRNA synthetase; Validated 99.86
PRK03991613 threonyl-tRNA synthetase; Validated 99.85
PRK12304604 thrS threonyl-tRNA synthetase; Reviewed 99.85
COG0441589 ThrS Threonyl-tRNA synthetase [Translation, ribosomal s 99.73
PRK08661 478 prolyl-tRNA synthetase; Provisional 99.71
COG0442 500 ProS Prolyl-tRNA synthetase [Translation, ribosomal str 99.69
KOG2324 457 consensus 99.61
PRK00960516 seryl-tRNA synthetase; Provisional 99.59
KOG1637560 consensus 99.55
TIGR00408 533 proS_fam_I prolyl-tRNA synthetase; InterPro: IPR004499 99.29
TIGR00415520 serS_MJ seryl-tRNA synthetase; InterPro: IPR004503 The 98.99
KOG4163 551 consensus 97.7
cd00670235 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA s 100.0
cd00768211 class_II_aaRS-like_core Class II tRNA amino-acyl synthe 100.0
PRK04173460 glycyl-tRNA synthetase; Provisional 99.39
TIGR00409 620 proS_fam_II prolyl-tRNA synthetase; InterPro: IPR004500 99.07
COG0423558 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ri 99.04
PRK09537420 pylS pyrolysyl-tRNA synthetase; Reviewed 98.26
COG0016335 PheS Phenylalanyl-tRNA synthetase alpha subunit [Transl 97.99
pfam01409243 tRNA-synt_2d tRNA synthetases class II core domain (F). 97.37
PRK00488338 pheS phenylalanyl-tRNA synthetase subunit alpha; Valida 97.27
cd00496218 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) a 97.23
PRK07080318 hypothetical protein; Validated 97.11
PRK04172501 pheS phenylalanyl-tRNA synthetase subunit alpha; Provis 96.77
PTZ00326505 phenylalanyl-tRNA synthetase; Provisional 96.0
pfam00587170 tRNA-synt_2b tRNA synthetase class II core domain (G, H 100.0
PRK00037 417 hisS histidyl-tRNA synthetase; Reviewed 98.66
cd00774254 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like cla 98.42
TIGR02367453 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 Py 98.4
COG0124 429 HisS Histidyl-tRNA synthetase [Translation, ribosomal s 97.85
TIGR00389 606 glyS_dimeric glycyl-tRNA synthetase; InterPro: IPR00231 97.78
PRK12293281 hisZ ATP phosphoribosyltransferase regulatory subunit; 97.5
PRK12295 373 hisZ ATP phosphoribosyltransferase regulatory subunit; 97.39
PRK12421 391 ATP phosphoribosyltransferase regulatory subunit; Provi 96.69
TIGR00442 446 hisS histidyl-tRNA synthetase; InterPro: IPR015807 The 96.23
TIGR00457495 asnS asparaginyl-tRNA synthetase; InterPro: IPR004522 T 95.67
TIGR00418595 thrS threonyl-tRNA synthetase; InterPro: IPR002320 The 99.82
pfam02403108 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain. T 99.82
TIGR00019373 prfA peptide chain release factor 1; InterPro: IPR00437 95.64
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. This m 93.41
pfam07106169 TBPIP Tat binding protein 1(TBP-1)-interacting protein 92.99
PRK00591360 prfA peptide chain release factor 1; Validated 92.86
TIGR02231558 TIGR02231 conserved hypothetical protein; InterPro: IPR 92.05
PRK09194 570 prolyl-tRNA synthetase; Provisional 99.8
PRK00476 587 aspS aspartyl-tRNA synthetase; Validated 97.2
COG0173 585 AspS Aspartyl-tRNA synthetase [Translation, ribosomal s 96.04
PRK12420 421 histidyl-tRNA synthetase; Provisional 98.0
CHL00201 424 syh histidine-tRNA synthetase; Provisional 97.75
PRK12292 388 hisZ ATP phosphoribosyltransferase regulatory subunit; 97.73
cd00773261 HisRS-like_core Class II Histidinyl-tRNA synthetase (Hi 97.48
PRK05159434 aspC aspartyl-tRNA synthetase; Provisional 97.11
PRK03932462 asnC asparaginyl-tRNA synthetase; Validated 97.1
PRK09350325 lysyl-tRNA synthetase; Provisional 96.85
cd00775329 LysRS_core Lys_tRNA synthetase (LysRS) class II core do 96.78
PRK00484491 lysS lysyl-tRNA synthetase; Reviewed 96.62
cd00776322 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II c 96.55
PRK06462332 asparagine synthetase A; Reviewed 96.37
cd00777280 AspRS_core Asp tRNA synthetase (aspRS) class II core do 96.33
PRK12820 706 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl 95.9
PRK12445505 lysyl-tRNA synthetase; Reviewed 95.23
pfam00152341 tRNA-synt_2 tRNA synthetases class II (D, K and N). 95.2
PRK029831099 lysS lysyl-tRNA synthetase; Provisional 95.11
COG3705 390 HisZ ATP phosphoribosyltransferase involved in histidin 92.03
COG0017435 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation 96.54
PRK06253 527 O-phosphoseryl-tRNA synthetase; Reviewed 96.25
TIGR00468362 pheS phenylalanyl-tRNA synthetase, alpha subunit; Inter 92.95
cd00669269 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class I 96.23
KOG0555545 consensus 95.26
KOG2298 599 consensus 95.03
PRK00226157 greA transcription elongation factor GreA; Reviewed 93.57
COG3883265 Uncharacterized protein conserved in bacteria [Function 92.34
pfam03961450 DUF342 Protein of unknown function (DUF342). This famil 92.06
TIGR00409620 proS_fam_II prolyl-tRNA synthetase; InterPro: IPR004500 91.27
PRK11637404 hypothetical protein; Provisional 90.29
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0172 SerS Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2509 consensus Back     alignment and domain information
>TIGR00414 serS seryl-tRNA synthetase; InterPro: IPR002317 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain Back     alignment and domain information
>cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>PRK12325 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12305 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12444 threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK03772 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK00413 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK04483 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK03991 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK12304 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08661 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2324 consensus Back     alignment and domain information
>PRK00960 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG1637 consensus Back     alignment and domain information
>TIGR00408 proS_fam_I prolyl-tRNA synthetase; InterPro: IPR004499 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00415 serS_MJ seryl-tRNA synthetase; InterPro: IPR004503 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG4163 consensus Back     alignment and domain information
>cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>PRK04173 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00409 proS_fam_II prolyl-tRNA synthetase; InterPro: IPR004500 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG0423 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0016 PheS Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam01409 tRNA-synt_2d tRNA synthetases class II core domain (F) Back     alignment and domain information
>PRK00488 pheS phenylalanyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>cd00496 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain Back     alignment and domain information
>PRK07080 hypothetical protein; Validated Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>PTZ00326 phenylalanyl-tRNA synthetase; Provisional Back     alignment and domain information
>pfam00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T) Back     alignment and domain information
>PRK00037 hisS histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain Back     alignment and domain information
>TIGR02367 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 PylS is the archaeal enzyme responsible for charging the pyrrolysine tRNA, PylT, by ligating a free molecule of pyrrolysine Back     alignment and domain information
>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00389 glyS_dimeric glycyl-tRNA synthetase; InterPro: IPR002315 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>TIGR00442 hisS histidyl-tRNA synthetase; InterPro: IPR015807 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00457 asnS asparaginyl-tRNA synthetase; InterPro: IPR004522 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00418 thrS threonyl-tRNA synthetase; InterPro: IPR002320 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>pfam02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain Back     alignment and domain information
>TIGR00019 prfA peptide chain release factor 1; InterPro: IPR004373 This family describes peptide chain release factor 1 (PrfA, RF-1), and excludes the related peptide chain release factor 2 (PrfB, RF-2) Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>pfam07106 TBPIP Tat binding protein 1(TBP-1)-interacting protein (TBPIP) Back     alignment and domain information
>PRK00591 prfA peptide chain release factor 1; Validated Back     alignment and domain information
>TIGR02231 TIGR02231 conserved hypothetical protein; InterPro: IPR011935 This family consists of proteins over 500 amino acids long in Caenorhabditis elegans and several bacteria (Pseudomonas aeruginosa, Nostoc sp Back     alignment and domain information
>PRK09194 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00476 aspS aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>COG0173 AspS Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12420 histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>CHL00201 syh histidine-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK03932 asnC asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK09350 lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00775 LysRS_core Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>PRK00484 lysS lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00776 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>PRK06462 asparagine synthetase A; Reviewed Back     alignment and domain information
>cd00777 AspRS_core Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>PRK12445 lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>pfam00152 tRNA-synt_2 tRNA synthetases class II (D, K and N) Back     alignment and domain information
>PRK02983 lysS lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG3705 HisZ ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information
>COG0017 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06253 O-phosphoseryl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00468 pheS phenylalanyl-tRNA synthetase, alpha subunit; InterPro: IPR004529 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>KOG0555 consensus Back     alignment and domain information
>KOG2298 consensus Back     alignment and domain information
>PRK00226 greA transcription elongation factor GreA; Reviewed Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam03961 DUF342 Protein of unknown function (DUF342) Back     alignment and domain information
>TIGR00409 proS_fam_II prolyl-tRNA synthetase; InterPro: IPR004500 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK11637 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target430 seryl-tRNA synthetase [Candidatus Liberibacter asiaticu
2dq3_A425 Crystal Structure Of Aq_298 Length = 425 1e-120
2dq0_A455 Crystal Structure Of Seryl-Trna Synthetase From Pyr 1e-101
1sry_A421 Refined Crystal Structure Of The Seryl-Trna Synthet 1e-80
3lsq_A484 Trypanosoma Brucei Seryl-Trna Synthetase Length = 4 5e-78
1wle_A501 Crystal Structure Of Mammalian Mitochondrial Seryl- 1e-73
3err_A536 Microtubule Binding Domain From Mouse Cytoplasmic D 3e-67
1qf6_A 642 Structure Of E. Coli Threonyl-Trna Synthetase Compl 3e-06
1evk_A 401 Crystal Structure Of A Truncated Form Of Threonyl-T 1e-05
>gi|149241134|pdb|2DQ3|A Chain A, Crystal Structure Of Aq_298 Length = 425 Back     alignment and structure
 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 203/428 (47%), Positives = 280/428 (65%), Gaps = 7/428 (1%)

Query: 2   LDIQWIRQNPEHLDIALKKRHLEP--QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           +DI  IR+ P+++   L  R  E     + +L LD++ R +IK++E +R+ RN  S +IG
Sbjct: 2   IDINLIREKPDYVKERLATRDKELVSLVDKVLELDKRRREIIKRLEALRSERNKLSKEIG 61

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           +   EG  +    ++N    LKE++  LE+E  +V   LK  +  IPN+P   VP+G   
Sbjct: 62  KLKREGKDT--TEIQNRVKELKEEIDRLEEELRKVEEELKNTLLWIPNLPHPSVPVGEDE 119

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +N+ +R  G+        + H+EIGE LG++DF R  KLSG+RF+V+ G  A LERAL 
Sbjct: 120 KDNVEVRRWGEPRKFDFEPKPHWEIGERLGILDFKRGAKLSGSRFTVIAGWGARLERALI 179

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLTN 238
            F +DLHT + GY E+  P LV+ E + GTGQ+PKF +D++ C  D  +LIPT+EV LTN
Sbjct: 180 NFXLDLHT-KKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKCERDNLYLIPTAEVPLTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           LY  EI++ ++LP+  T   P +R EAG+ G+D RG++RQHQF K ELV I   + S+ E
Sbjct: 239 LYREEILKEENLPIYLTAYTPCYRREAGAYGKDIRGIIRQHQFDKVELVKIVHPDTSYDE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+++  AEE+L+ L L YRVV LCTGDLGFSA KTYD+EVW   QN YREISSCS C +
Sbjct: 299 LEKLVKDAEEVLQLLGLPYRVVELCTGDLGFSAAKTYDIEVWFPSQNKYREISSCSNCED 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N+R++D  +   +F HTLNGSG+AVGR L AILENY   DGSV +P VLR Y+ 
Sbjct: 359 FQARRXNTRFKDSKTGKNRFVHTLNGSGLAVGRTLAAILENYQQEDGSVVVPEVLRDYV- 417

Query: 419 NLAVIKKE 426
              VI+ E
Sbjct: 418 GTDVIRPE 425


gi|149241121|pdb|2DQ0|A Chain A, Crystal Structure Of Seryl-Trna Synthetase From Pyrococcus Horikoshii Complexed With A Seryl-Adenylate Analog Length = 455 Back     alignment and structure
gi|494615|pdb|1SRY|A Chain A, Refined Crystal Structure Of The Seryl-Trna Synthetase From Thermus Thermophilus At 2.5 Angstroms Resolution Length = 421 Back     alignment and structure
>gi|290560564|pdb|3LSQ|A Chain A, Trypanosoma Brucei Seryl-Trna Synthetase Length = 484 Back     alignment and structure
>gi|75765332|pdb|1WLE|A Chain A, Crystal Structure Of Mammalian Mitochondrial Seryl-Trna Synthetase Complexed With Seryl-Adenylate Length = 501 Back     alignment and structure
>gi|215261312|pdb|3ERR|A Chain A, Microtubule Binding Domain From Mouse Cytoplasmic Dynein As A Fusion With Seryl-Trna Synthetase Length = 536 Back     alignment and structure
gi|5107656|pdb|1QF6|A Chain A, Structure Of E. Coli Threonyl-Trna Synthetase Complexed With Its Cognate Trna Length = 642 Back     alignment and structure
>gi|9955215|pdb|1EVK|A Chain A, Crystal Structure Of A Truncated Form Of Threonyl-Trna Synthetase With The Ligand Threonine Length = 401 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target430 seryl-tRNA synthetase [Candidatus Liberibacter asiaticu
3lss_A484 Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA 1e-115
2dq0_A455 Seryl-tRNA synthetase; coiled-coil, homodimer, structur 1e-113
2dq3_A425 Seryl-tRNA synthetase; coiled-coil, homodimer, structur 1e-112
1wle_A501 Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos tau 1e-103
1ses_A421 Seryl-tRNA synthetase; ligase(synthetase); HET: AHX AMP 2e-85
3err_A536 Fusion protein of microtubule binding domain from mouse 1e-104
2cja_A522 Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2e-64
3mf2_A346 BLL0957 protein; aminoacyl-tRNA synthetase, seryl-tRNA 5e-62
3ial_A 518 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA 2e-35
1nj8_A 459 Proline-tRNA synthetase, proline--tRNA ligase; class-II 3e-21
1nyr_A645 Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET 3e-16
1nj1_A 501 Proline-tRNA synthetase, proline--tRNA ligase; protein- 3e-35
1evl_A 401 Threonyl-tRNA synthetase; amino acid recognition, zinc 6e-31
1qf6_A 642 THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, zinc, 3e-11
1hc7_A 477 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP 9e-16
2j3l_A 572 Prolyl-tRNA synthetase; class II aminoacyl- tRNA synthe 1e-11
2zin_A291 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 8e-06
2i4l_A 458 Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseudomona 1e-04
3a32_A 471 Probable threonyl-tRNA synthetase 1; aeropyrum pernix K 7e-09
>3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* Length = 484 Back     alignment and structure
 Score =  409 bits (1051), Expect = e-115
 Identities = 138/468 (29%), Positives = 213/468 (45%), Gaps = 46/468 (9%)

Query: 1   MLDIQWIRQNPEHLDI--ALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQ 57
           +LDIQ  R       I  + ++R  +P   + I+  D+K R      E  +   N  S  
Sbjct: 7   VLDIQLFRDETGANIIRESQRRRFADPDIVDAIIEADKKWRRTQFLTEASKKLINICSKA 66

Query: 58  IGQAIAEGNLS---------------------------LVDALKNETSTLKEQLPILEKE 90
           +G                                     V  LK  +  L +Q+  L KE
Sbjct: 67  VGAKKKAKEADGDTSEIPPQVKEAYENGTLKGEQVEQLCVLQLKQLSKDLSDQVAGLAKE 126

Query: 91  EHEVCSSLKKLISCIPNVPLEEVPIGTSANEN-ILIRSVGKKPSAIHLSREHFEIGEALG 149
             ++     KL+  + N+  E VPI         ++R+ G       L+  H  I E LG
Sbjct: 127 AQQLEEERDKLMLNVGNILHESVPIAQDEETGNTVVRTFGNTTKRAKLN--HVSIMERLG 184

Query: 150 LMDFDR-ATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYG 208
           +MD  +  T ++G R  VL G L  L+ AL  + +D    + GYT    P  +  + M  
Sbjct: 185 MMDTSKAVTSMAGGRSYVLKGGLVQLQVALVSYSLD-FLVKRGYTPFYPPFFLNRDVMGE 243

Query: 209 TGQIPKFADDMFCTT---DGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEA 265
             Q+ +F ++++  +   D ++LI TSE+ +   +          PL++  ++  FR EA
Sbjct: 244 VAQLSQFDEELYQVSGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEA 303

Query: 266 GSAGRDTRGMLRQHQFWKCELVSITREE--DSFTEHERMLSCAEEILKRLDLHYRVVSLC 323
           G+ GRDT G+ R HQF K E   +      +S+   E M++ +EE  K L L YRVV++C
Sbjct: 304 GAHGRDTLGIFRVHQFDKIEQFVVCSPRQEESWRHLEDMITTSEEFNKSLGLPYRVVNIC 363

Query: 324 TGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNS-----KSLKF 378
           +G L  +A K YDLE W      +RE+ SCS C ++QS+ +N RY             ++
Sbjct: 364 SGALNNAAAKKYDLEAWFPASGAFRELVSCSNCTDYQSQSVNCRYGPNLRGTAAQNVKEY 423

Query: 379 THTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIKKE 426
            H LNG+  A+ R +  I ENY   +G V IP VLRPYM  + +I+ E
Sbjct: 424 CHMLNGTLCAITRTMCCICENYQTEEG-VVIPDVLRPYMMGIEMIRFE 470


>2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A Length = 455 Back     alignment and structure
>2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus VF5} Length = 425 Back     alignment and structure
>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Length = 501 Back     alignment and structure
>1ses_A Seryl-tRNA synthetase; ligase(synthetase); HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A Length = 421 Back     alignment and structure
>3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} Length = 536 Back     alignment and structure
>2cja_A Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2.2A {Methanosarcina barkeri} PDB: 2cim_A* 2cj9_A* 2cjb_A Length = 522 Back     alignment and structure
>3mf2_A BLL0957 protein; aminoacyl-tRNA synthetase, seryl-tRNA synthetase, zinc ION, amino acid:[carrier protein] ligase; HET: AMP; 2.15A {Bradyrhizobium japonicum} PDB: 3mey_A* 3mf1_A* Length = 346 Back     alignment and structure
>3ial_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, prors, cysrs, Pro(Cys)RS, translation, ATP-binding; HET: PR8; 2.20A {Giardia lamblia atcc 50803} Length = 518 Back     alignment and structure
>1nj8_A Proline-tRNA synthetase, proline--tRNA ligase; class-II tRNA synthetase; 3.20A {Methanocaldococcus jannaschii} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 Length = 459 Back     alignment and structure
>1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 PDB: 1nyq_A* Length = 645 Back     alignment and structure
>1nj1_A Proline-tRNA synthetase, proline--tRNA ligase; protein-aminoacyladenylate complex class-II tRNA synthetase; HET: 5CA; 2.55A {Methanothermobacterthermautotrophicus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1nj2_A 1nj5_A* 1nj6_A* Length = 501 Back     alignment and structure
>1evl_A Threonyl-tRNA synthetase; amino acid recognition, zinc ION, adenylate analog, deletion mutant, ligase; HET: TSB; 1.55A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1evk_A* 1fyf_A* 1kog_A* Length = 401 Back     alignment and structure
>1qf6_A THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, zinc, mRNA, aminoacylation, translational regulation, protein/RNA, ligase/RNA complex; HET: H2U AET G7M 5MU PSU AMP; 2.90A {Escherichia coli} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 Length = 642 Back     alignment and structure
>1hc7_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP + L-proline + tRNA(Pro) AMP + PPI + L-prolyl-tRNA(Pro); 2.43A {Thermus thermophilus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1h4q_A* 1h4t_A 1h4s_A Length = 477 Back     alignment and structure
>2j3l_A Prolyl-tRNA synthetase; class II aminoacyl- tRNA synthetase, editing, translation; HET: P5A; 2.3A {Enterococcus faecalis} PDB: 2j3m_A* Length = 572 Back     alignment and structure
>2zin_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, pyrrolysine, ATP analogue, non-natural amino acid, unnatural amino acid, ATP-binding; HET: ANP LBY; 1.79A {Methanosarcina mazei} PDB: 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* Length = 291 Back     alignment and structure
>2i4l_A Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseudomonas palustris} PDB: 2i4m_A* 2i4n_A* 2i4o_A* Length = 458 Back     alignment and structure
>3a32_A Probable threonyl-tRNA synthetase 1; aeropyrum pernix K1, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; 2.30A {Aeropyrum pernix} PDB: 3a31_A Length = 471 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target430 seryl-tRNA synthetase [Candidatus Liberibacter asiaticu
2dq0_A455 Seryl-tRNA synthetase; coiled-coil, homodimer, structur 100.0
1wle_A501 Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos tau 100.0
3lss_A484 Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA 100.0
2dq3_A425 Seryl-tRNA synthetase; coiled-coil, homodimer, structur 100.0
1ses_A421 Seryl-tRNA synthetase; ligase(synthetase); HET: AHX AMP 100.0
3err_A536 Fusion protein of microtubule binding domain from mouse 100.0
2cja_A522 Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 100.0
3mf2_A346 BLL0957 protein; aminoacyl-tRNA synthetase, seryl-tRNA 100.0
1nj1_A 501 Proline-tRNA synthetase, proline--tRNA ligase; protein- 100.0
3ial_A 518 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA 99.93
1hc7_A 477 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP 99.92
1nj8_A 459 Proline-tRNA synthetase, proline--tRNA ligase; class-II 99.92
1nyr_A645 Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET 99.91
1qf6_A642 THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, zinc, 99.91
1evl_A401 Threonyl-tRNA synthetase; amino acid recognition, zinc 99.85
2i4l_A458 Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseudomona 99.81
3a32_A 471 Probable threonyl-tRNA synthetase 1; aeropyrum pernix K 99.78
2zt5_A 693 Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP, Gly 99.18
3ikl_A459 DNA polymerase subunit gamma-2, mitochondrial; transfer 99.09
1ati_A505 Glycyl-tRNA synthetase; protein biosynthesis, ligase, a 98.83
2j3l_A 572 Prolyl-tRNA synthetase; class II aminoacyl- tRNA synthe 99.74
1qe0_A 420 Histidyl-tRNA synthetase; class II tRNA synthetase, bet 99.06
3net_A 465 Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, li 98.92
1h4v_B 421 Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synt 98.79
1htt_A 423 Histidyl-tRNA synthetase; complex (tRNA synthetase/His- 98.69
3lc0_A 456 Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA s 98.2
1wu7_A 434 Histidyl-tRNA synthetase; ligase, structural genomics, 98.13
3od1_A 400 ATP phosphoribosyltransferase regulatory subunit; struc 97.99
3a5y_A345 GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA sy 97.01
3dsq_A288 Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA s 99.61
2zin_A291 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 99.06
1eov_A487 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthet 96.34
1g5h_A 454 Mitochondrial DNA polymerase accessory subunit; intermo 98.68
1z7m_A344 ATP phosphoribosyltransferase regulatory subunit; ATP-P 97.68
3bju_A 521 Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- 97.05
1e1o_A504 Lysyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetas 96.8
3i7f_A548 Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding 96.74
3a74_A493 Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligas 96.73
1usy_A275 ATP phosphoribosyltransferase regulatory subunit; amino 96.47
1x54_A434 Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, 96.47
1wyd_A429 Hypothetical aspartyl-tRNA synthetase; archaea, ligase; 96.37
3m4p_A456 Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoac 96.25
1nnh_A294 Asparaginyl-tRNA synthetase-related peptide; structural 95.78
1c0a_A 585 Aspartyl tRNA synthetase; protein-RNA complex, ligase/R 95.49
1l0w_A 580 Aspartyl-tRNA synthetase; space-grown crystal, dimeric 95.41
1n9w_A422 Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A 95.01
2rhq_A294 Phenylalanyl-tRNA synthetase alpha chain; heterotetrame 97.63
1b7y_A350 Phers, protein (phenylalanyl-tRNA synthetase); enzyme, 96.94
2odr_A 665 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 97.58
2odr_C 701 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 97.39
2odr_B 648 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 97.31
2odr_D 685 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 97.2
3l4g_A508 Phenylalanyl-tRNA synthetase alpha chain; aminoacylatio 97.07
2du7_A 549 O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase 97.5
2du3_A 534 O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase 96.81
1m1j_B464 Fibrinogen beta chain; coiled coils, disulfide rings, f 95.76
1m1j_B464 Fibrinogen beta chain; coiled coils, disulfide rings, f 95.58
3ghg_B461 Fibrinogen beta chain; triple-stranded coiled coil, bet 91.45
3nem_A438 Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligas 95.7
1m1j_C409 Fibrinogen gamma chain; coiled coils, disulfide rings, 93.79
3ghg_A562 Fibrinogen alpha chain; triple-stranded coiled coil, be 93.39
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coil, be 90.55
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clotting; 90.32
1gqe_A365 Release factor 2, RF2; protein synthesis, ribosome, mac 92.29
>2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A Back     alignment and structure
Probab=100.00  E-value=0  Score=1246.04  Aligned_cols=424  Identities=38%  Similarity=0.636  Sum_probs=412.1

Q ss_pred             CCCHHHHHCCHHHHHHHHHHCCCCCC---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHH
Q ss_conf             98844785199999999984698958---899999999999999999999999999999999986449987999999999
Q gi|254780680|r    1 MLDIQWIRQNPEHLDIALKKRHLEPQ---SEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLVDALKNET   77 (430)
Q Consensus         1 MLDik~IRen~e~v~~~l~~R~~~~~---id~il~Ld~~rr~l~~e~e~LraerN~lSKeIg~~k~~~~~~~~~~Lk~e~   77 (430)
                      |||||+||+||+.|++++++||.+.+   +|+++++|++||+++.++++||++||++||+||++++++++  ++++++++
T Consensus         1 MLDik~iRenpe~v~~~l~~R~~~~d~~~vd~ll~ld~~~r~l~~e~e~Lr~~rN~lSK~Ig~~kk~~~~--~~~l~~~~   78 (455)
T 2dq0_A            1 MLDIKLIRENPELVKNDLIKRGELEKVKWVDEILKLDTEWRTKLKEINRLRHERNKIAVEIGKRRKKGEP--VDELLAKS   78 (455)
T ss_dssp             CCCHHHHHHCHHHHHHHHHHHTCGGGTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCC--THHHHHHH
T ss_pred             CCCHHHHHHCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC--HHHHHHHH
T ss_conf             9897887769999999998649963155799999999999999999999999999999999999867997--89999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHCCCCCCCEEEEEECCCCCC--------------------CCC
Q ss_conf             999988644466666778887744310022588112211355540242000156566--------------------566
Q gi|254780680|r   78 STLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPSA--------------------IHL  137 (430)
Q Consensus        78 ~~Lk~eik~le~~~~~le~el~~lll~IPNi~~~~VP~G~de~dNv~i~~~G~~~~f--------------------~f~  137 (430)
                      ++|+++|+.+++++++++++++++++.|||+||++||+|.||+||++|++||++|.|                    +|+
T Consensus        79 ~~lk~~ik~le~~l~~l~~~l~~lll~iPNl~~~~VP~G~de~dN~~ir~~G~~~~f~~~~~~~~~~~~~~~~~~~~~f~  158 (455)
T 2dq0_A           79 REIVKRIGELENEVEELKKKIDYYLWRLPNITHPSVPVGKDENDNVPIRFWGKARVWKGHLERFLEQSQGKMEYEILEWK  158 (455)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHTTSCCCCCTTSCCCSSGGGCEEEEEESCEEEEGGGHHHHHHHHTTCSCEEEESSC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             99999999999999999999999997276777866687888666646785057556555532111234555565667887


Q ss_pred             CCCCCCHHHHCCCCCHHHHHHHCCCCCEEECCHHHHHHHHHHHHHHHHHHHHCCCCEEHHHHHCCHHHHHHHHHCHHHHH
Q ss_conf             62112202211731000112221675301056488999999999998622320320212356202788986551422476
Q gi|254780680|r  138 SREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFAD  217 (430)
Q Consensus       138 ~k~H~elge~l~liDfe~a~kvsGsrF~~Lkg~~A~Le~ALi~y~ld~~~~~~Gy~~v~~P~lv~~~~~~gtG~lp~f~~  217 (430)
                      |++|||||+.+|++||++|+|+||||||||+|+||+|||||+|||||++ .++||++|+||+|||+++|+||||+|+|++
T Consensus       159 ~k~H~el~e~l~liDfe~~akvsGsrf~~Lkg~~A~Le~ALi~f~ld~~-~~~Gy~~v~pP~iV~~~~~~gtGqlp~f~~  237 (455)
T 2dq0_A          159 PKLHVDLLEILGGADFARAAKVSGSRFYYLLNEIVILDLALIRFALDRL-IEKGFTPVIPPYMVRRFVEEGSTSFEDFED  237 (455)
T ss_dssp             CCCHHHHHHHTTCEESHHHHHHTCTTCCEEEHHHHHHHHHHHHHHHHHH-HHTTCEEEECCSEECHHHHHTTSCTTHHHH
T ss_pred             CCCHHHHHHHCCCCCHHHHHCCCCCCEEEECCCHHHHHHHHHHHHHHHH-CCCCCEEECCCCCCCHHHHHHCCCCCCCHH
T ss_conf             6769999877187314333212578647835808899999999999750-001654623861102788734268987601


Q ss_pred             HHHHHH-HCCEECCCCCCHHHHHHHHHCCCHHHHCCEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEEEEEECCCCCCHH
Q ss_conf             776431-0002313454114544534205955504208853221078843355434321222210200212127865014
Q gi|254780680|r  218 DMFCTT-DGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF  296 (430)
Q Consensus       218 ~~y~~~-d~l~Li~TaEvpL~~~~~~~~l~~~~LPik~~~~s~cfR~EaGs~GkdtrGl~RvHQF~KVE~~~~~~pe~S~  296 (430)
                      |+|+++ +|+||||||||||+|||+|++|+.++||+||+|+|||||+||||||||||||||||||+|||||+||+||+|+
T Consensus       238 ~~Y~i~~~dl~Li~TaEvpL~~~~~~eil~~~~LPik~~~~s~cFR~EaGs~GkdtrGl~RvHQF~KVE~~~~~~pe~s~  317 (455)
T 2dq0_A          238 VIYKVEDEDLYLIPTAEHPLAGMHANEILDGKDLPLLYVGVSPCFRKEAGTAGKDTKGIFRVHQFHKVEQFVYSRPEESW  317 (455)
T ss_dssp             TCCBBTTSSCEECSSTHHHHHHTTTTEEEETTTCSEEEEEEEEEECCCTTCSSCSCCSSSSCSEEEEEEEEEEECTTTHH
T ss_pred             CEEEECCCCEEECCCCCCCHHHHHHCCCCCHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHEEECCEEEEEEECCCCCCH
T ss_conf             04785599757436443204444401325787789202465897886555578764012201221426899834897319


Q ss_pred             HHHHHHHHHHHHHHHHHCCHHHHCCCCCHHCCCHHHEEEEEEEECCCCCCEEEEEEECCCCCHHHHHCCCEEECCCCCCC
Q ss_conf             57898999999999984106753037801178443402410110100483323753102100764532684733899841
Q gi|254780680|r  297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSL  376 (430)
Q Consensus       297 ~~~e~~~~~~~~i~~~L~lpyRvv~~~sgdlg~~a~~~~DiE~w~P~~~~y~Ev~S~Snc~D~QsrRl~iry~~~~~~~~  376 (430)
                      ++|++|+.++++||++||||||||+|||||||++|+||||||||||||++|+||||||||||||||||||||+++.++++
T Consensus       318 ~~~e~~~~~~~~i~~~L~lpyrvv~~~s~dlg~~a~~k~DiE~w~P~~~~y~EvsS~Snc~DyQsRRl~iry~~~~~~~~  397 (455)
T 2dq0_A          318 EWHEKIIRNAEELFQELEIPYRVVNICTGDLGYVAAKKYDIEAWMPGQGKFREVVSASNCTDWQARRLNIRFRDRTDEKP  397 (455)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCEEEEECCGGGSCSSCSEEEEEEEEETTTTEEEEEEEEEECTTTTHHHHTEEEESSTTSCC
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCEEEEEEEEECCCCCEEEEEEECCCCCHHHHCCCCEECCCCCCCC
T ss_conf             99999999999999975996589881376678771218999988557786245746615435766133445126899963


Q ss_pred             CEEEEECCCHHHHHHHHHHHHHHCCCCCCCEECCCCCCCCCCCEEEECCCC
Q ss_conf             010420043228999999998834689983865822231018801307334
Q gi|254780680|r  377 KFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIKKEH  427 (430)
Q Consensus       377 ~~~htlNgt~~A~~R~l~ailEn~q~~dg~i~iP~~L~pym~g~~~i~~~~  427 (430)
                      +||||||||||||||+|+||||||||+||+|+||+||||||||.++|++..
T Consensus       398 ~~~HtlNgt~lav~R~l~ailEn~q~~dg~i~iP~~L~pymg~~~~~~~~~  448 (455)
T 2dq0_A          398 RYVHTLNSTAIATSRAIVAILENHQEEDGTVRIPKVLWKYTGFKEIVPVEK  448 (455)
T ss_dssp             EECEEEEEEEEEHHHHHHHHHHHSBCTTSCEECCGGGHHHHSCSEECCCC-
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHCCCCCCCEECCHHHHHHCCCCEEECCCC
T ss_conf             554533064018878999999847389986868854463459958841552



>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Back     alignment and structure
>3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* Back     alignment and structure
>2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus VF5} Back     alignment and structure
>1ses_A Seryl-tRNA synthetase; ligase(synthetase); HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A Back     alignment and structure
>3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} Back     alignment and structure
>2cja_A Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2.2A {Methanosarcina barkeri} PDB: 2cim_A* 2cj9_A* 2cjb_A Back     alignment and structure
>3mf2_A BLL0957 protein; aminoacyl-tRNA synthetase, seryl-tRNA synthetase, zinc ION, amino acid:[carrier protein] ligase; HET: AMP; 2.15A {Bradyrhizobium japonicum} PDB: 3mey_A* 3mf1_A* Back     alignment and structure