255764489

255764489

stationary phase survival protein SurE

GeneID in NCBI database:8209685Locus tag:CLIBASIA_02840
Protein GI in NCBI database:255764489Protein Accession:YP_003065094.2
Gene range:-(586298, 587050)Protein Length:250aa
Gene description:stationary phase survival protein SurE
COG prediction:[R] Predicted acid phosphatase
KEGG prediction:surE; stationary phase survival protein SurE (EC:3.6.1.11); K03787 5'-nucleotidase [EC:3.1.3.5]
SEED prediction:5-nucleotidase SurE (EC 3.1.3.5)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Pyrimidine metabolism [PATH:las00240]
Nicotinate and nicotinamide metabolism [PATH:las00760]
Subsystem involved in SEED:Housecleaning nucleoside triphosphate pyrophosphatases
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250
MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISKKRFAVHGTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIRSFALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTVVTAQGKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVTPITTDLTDYNSQQYISLSLET
cEEEEEccccccccHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccccEEEEcccHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHcccEEEEEcccccccccccccccccccEEEEEcccccccccccccHHHHHHcccEEEEEEccccccHHHHHHHHHHHcc
cEEEEEcccccccHHHHHHHHHHHHHcccEEEEcccccccccccccccccccEEEEccccEEEEcccHHHHHHHHHHHcccccccEEEEEEEEccccHHHHHHcHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHcccccccEEEEccccccHHHHccEEEEcccccccccccEEcccccccEEEEEccccccccccccccHHHHHcccEEEccccccccHHHHHHHHHHHHcc
mrilltnddgikskgLITLENIARSISddiwicapemdqsclansltMSRNIACRTiskkrfavhgtpVDCVVIALQKmsdkkpdlilsgvnvgtntsnhvaysGTLAAAFEGSLQGIRSFALSQAytyenmipwevsethAPRVLRQLLKtqipnttlcninfprcspeeVQKTVVtaqgkpcfsidakqistndnmshyCLTFGDHLKNLCEKSDAFAIQHnmisvtpittdltdynsqqyISLSLET
mrilltnddgikskglITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTiskkrfavhgTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIRSFALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTVVTAQGKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVtpittdltdynsqQYISLSLET
MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISKKRFAVHGTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIRSFALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTVVTAQGKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVTPITTDLTDYNSQQYISLSLET
MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISKKRFAVHGTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIRSFALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTVVTAQGKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVTPITTDLTDYNSQQYISLSLE*
MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISKKRFAVHGTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIRSFALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTVVTAQGKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVTPITTDLTDYNSQQYISLSLET
MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISKKRFAVHGTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIRSFALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTVVTAQGKPCFSIDAKQISTNDNMSHYCLTFGDHLKN*CEKSDAFAIQHNMISVTPITTDLTDYNSQQYISLSLET
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISKKRFAVHGTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIRSFALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTVVTAQGKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVTPITTDLTDYNSQQYISLSLET
MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISKKRFAVHGTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIRSFALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTVVTAQGKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVTPITTDLTDYNSQQYISLSLET
MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISKKRFAVHGTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIRSFALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTVVTAQGKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVTPITTDLTDYNSQQYISLSLET

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target250 stationary phase survival protein SurE [Candidatus Libe
315122208250 stationary phase survival protein SurE [Candidatus Libe 1 1e-116
325293087256 stationary phase survival protein SurE [Agrobacterium s 1 4e-74
241204419257 stationary phase survival protein SurE [Rhizobium legum 1 4e-73
190891516257 5'-nucleotidase (stationary-phase survival protein) [Rh 1 1e-72
86357455257 stationary phase survival protein SurE [Rhizobium etli 1 1e-72
209549092257 stationary phase survival protein SurE [Rhizobium legum 1 3e-72
116251810257 stationary phase survival protein SurE [Rhizobium legum 1 3e-72
15889009256 stationary phase survival protein SurE [Agrobacterium t 1 4e-72
307317050256 stationary-phase survival protein SurE [Sinorhizobium m 1 1e-70
222085789257 5'/3'-nucleotidase SurE [Agrobacterium radiobacter K84] 1 1e-70
>gi|315122208|ref|YP_004062697.1| stationary phase survival protein SurE [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 250 Back     alignment and organism information
 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 200/249 (80%), Positives = 226/249 (90%)

Query: 1   MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISKK 60
           MRILLTNDDGI+SKGLI LE+IARSIS+DIWICAPEMDQSCLANSLT+SR++ACRTIS+K
Sbjct: 1   MRILLTNDDGIQSKGLIALEDIARSISNDIWICAPEMDQSCLANSLTVSRSLACRTISEK 60

Query: 61  RFAVHGTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIRS 120
           RFA+HGTPVDCVV+ALQK+  KKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIRS
Sbjct: 61  RFAIHGTPVDCVVVALQKIPGKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIRS 120

Query: 121 FALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTVVTAQ 180
           FALSQAYTYENMIPW V++THAP++L+QLLK  IPN+TL NINFPRCSP+ V+  VVTAQ
Sbjct: 121 FALSQAYTYENMIPWGVAKTHAPKILQQLLKANIPNSTLFNINFPRCSPQNVRGAVVTAQ 180

Query: 181 GKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVTPITTDLTDYNS 240
           GKP FSIDAKQIS + N+SHY L F D  + +CEKSD FAIQ++MISVTPI TDLTDY+S
Sbjct: 181 GKPYFSIDAKQISEDGNLSHYSLDFRDRSETMCEKSDVFAIQNDMISVTPIKTDLTDYDS 240

Query: 241 QQYISLSLE 249
           Q+ ISLS E
Sbjct: 241 QKCISLSFE 249


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325293087|ref|YP_004278951.1| stationary phase survival protein SurE [Agrobacterium sp. H13-3] Length = 256 Back     alignment and organism information
>gi|241204419|ref|YP_002975515.1| stationary phase survival protein SurE [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 257 Back     alignment and organism information
>gi|190891516|ref|YP_001978058.1| 5'-nucleotidase (stationary-phase survival protein) [Rhizobium etli CIAT 652] Length = 257 Back     alignment and organism information
>gi|86357455|ref|YP_469347.1| stationary phase survival protein SurE [Rhizobium etli CFN 42] Length = 257 Back     alignment and organism information
>gi|209549092|ref|YP_002281009.1| stationary phase survival protein SurE [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 257 Back     alignment and organism information
>gi|116251810|ref|YP_767648.1| stationary phase survival protein SurE [Rhizobium leguminosarum bv. viciae 3841] Length = 257 Back     alignment and organism information
>gi|15889009|ref|NP_354690.1| stationary phase survival protein SurE [Agrobacterium tumefaciens str. C58] Length = 256 Back     alignment and organism information
>gi|307317050|ref|ZP_07596491.1| stationary-phase survival protein SurE [Sinorhizobium meliloti AK83] Length = 256 Back     alignment and organism information
>gi|222085789|ref|YP_002544319.1| 5'/3'-nucleotidase SurE [Agrobacterium radiobacter K84] Length = 257 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target250 stationary phase survival protein SurE [Candidatus Libe
PRK00346250 PRK00346, surE, 5'(3')-nucleotidase/polyphosphatase; Pr 6e-65
PRK13931261 PRK13931, PRK13931, stationary phase survival protein S 1e-44
TIGR00087244 TIGR00087, surE, 5'/3'-nucleotidase SurE 1e-40
PRK13932257 PRK13932, PRK13932, stationary phase survival protein S 6e-40
PRK13935253 PRK13935, PRK13935, stationary phase survival protein S 8e-34
PRK13933253 PRK13933, PRK13933, stationary phase survival protein S 2e-31
PRK13934266 PRK13934, PRK13934, stationary phase survival protein S 3e-23
COG0496252 COG0496, SurE, Predicted acid phosphatase [General func 8e-62
pfam01975190 pfam01975, SurE, Survival protein SurE 3e-53
>gnl|CDD|178982 PRK00346, surE, 5'(3')-nucleotidase/polyphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|184405 PRK13931, PRK13931, stationary phase survival protein SurE; Provisional Back     alignment and domain information
>gnl|CDD|161700 TIGR00087, surE, 5'/3'-nucleotidase SurE Back     alignment and domain information
>gnl|CDD|172445 PRK13932, PRK13932, stationary phase survival protein SurE; Provisional Back     alignment and domain information
>gnl|CDD|184407 PRK13935, PRK13935, stationary phase survival protein SurE; Provisional Back     alignment and domain information
>gnl|CDD|184406 PRK13933, PRK13933, stationary phase survival protein SurE; Provisional Back     alignment and domain information
>gnl|CDD|139993 PRK13934, PRK13934, stationary phase survival protein SurE; Provisional Back     alignment and domain information
>gnl|CDD|30842 COG0496, SurE, Predicted acid phosphatase [General function prediction only] Back     alignment and domain information
>gnl|CDD|145253 pfam01975, SurE, Survival protein SurE Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 250 stationary phase survival protein SurE [Candidatus Libe
PRK13933253 stationary phase survival protein SurE; Provisional 100.0
PRK00346246 surE stationary phase survival protein SurE; Provisiona 100.0
PRK13935255 stationary phase survival protein SurE; Provisional 100.0
PRK13932258 stationary phase survival protein SurE; Provisional 100.0
PRK13931261 stationary phase survival protein SurE; Provisional 100.0
PRK13934266 stationary phase survival protein SurE; Provisional 100.0
COG0496252 SurE Predicted acid phosphatase [General function predi 100.0
TIGR00087326 surE 5'/3'-nucleotidase SurE; InterPro: IPR002828 This 100.0
LOAD_surE192 consensus 100.0
pfam01975190 SurE Survival protein SurE. E. coli cells with the surE 100.0
cd03784 401 GT1_Gtf_like This family includes the Gtfs, a group of 96.19
pfam04007335 DUF354 Protein of unknown function (DUF354). Members of 95.91
PRK10307 415 predicted glycosyl transferase; Provisional 95.78
cd03802335 GT1_AviGT4_like This family is most closely related to 94.26
PRK09191261 two-component response regulator; Provisional 91.6
>PRK13933 stationary phase survival protein SurE; Provisional Back     alignment and domain information
>PRK00346 surE stationary phase survival protein SurE; Provisional Back     alignment and domain information
>PRK13935 stationary phase survival protein SurE; Provisional Back     alignment and domain information
>PRK13932 stationary phase survival protein SurE; Provisional Back     alignment and domain information
>PRK13931 stationary phase survival protein SurE; Provisional Back     alignment and domain information
>PRK13934 stationary phase survival protein SurE; Provisional Back     alignment and domain information
>COG0496 SurE Predicted acid phosphatase [General function prediction only] Back     alignment and domain information
>TIGR00087 surE 5'/3'-nucleotidase SurE; InterPro: IPR002828 This entry represents a SurE-like structural domain with a 3-layer alpha/bete/alpha topology that bears some topological similarity to the N-terminal domain of the glutaminase/asparaginase family Back     alignment and domain information
>LOAD_surE consensus Back     alignment and domain information
>pfam01975 SurE Survival protein SurE Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>pfam04007 DUF354 Protein of unknown function (DUF354) Back     alignment and domain information
>PRK10307 predicted glycosyl transferase; Provisional Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK09191 two-component response regulator; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target250 stationary phase survival protein SurE [Candidatus Libe
2v4o_A267 Crystal Structure Of Salmonella Typhimurium Sure At 4e-65
2v4n_A254 Crystal Structure Of Salmonella Typhimurium Sure At 4e-65
2wqk_A251 Crystal Structure Of Sure Protein From Aquifex Aeol 1e-63
1j9j_A247 Crystal Structure Analysis Of Sure Protein From T.M 1e-55
1ilv_A247 Crystal Structure Analysis Of The Tm107 Length = 24 8e-53
2e69_A244 Crystal Structure Of The Stationary Phase Survival 3e-51
2e6h_A244 Crystal Structure Of E37a Mutant Of The Stationary 2e-50
1l5x_A280 The 2.0-Angstrom Resolution Crystal Structure Of A 3e-40
>gi|217035237|pdb|2V4O|A Chain A, Crystal Structure Of Salmonella Typhimurium Sure At 2.75 Angstrom Resolution In Monoclinic Form Length = 267 Back     alignment and structure
 Score =  252 bits (643), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 72/251 (28%), Positives = 122/251 (48%), Gaps = 6/251 (2%)

Query: 1   MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISKK 60
           MRILL+NDDG+ + G+ TL    R  + D+ + AP+ ++S  +NSLT+  ++   T    
Sbjct: 15  MRILLSNDDGVHAPGIQTLAKALREFA-DVQVVAPDRNRSGASNSLTLESSLRTFTFDNG 73

Query: 61  RFAVH-GTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIR 119
             AV  GTP DCV + +  +   +PD+++SG+N G N  + V YSGT+AAA EG   G  
Sbjct: 74  DIAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFP 133

Query: 120 SFALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTVVTA 179
           + A+S          ++ +      +LR L +  +    + N+N P     +V+   VT 
Sbjct: 134 ALAVSL----NGYQHYDTAAAVTCALLRGLSREPLRTGRILNVNVPDLPLAQVKGIRVTR 189

Query: 180 QGKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVTPITTDLTDYN 239
            G    +            + Y +       +    +D  A+    +SVTP+  DLT ++
Sbjct: 190 CGSRHPADKVIPQEDPRGNTLYWIGPPGDKYDAGPDTDFAAVDEGYVSVTPLHVDLTAHS 249

Query: 240 SQQYISLSLET 250
           +   +S  L++
Sbjct: 250 AHDVVSDWLDS 260


>gi|217035236|pdb|2V4N|A Chain A, Crystal Structure Of Salmonella Typhimurium Sure At 1.7 Angstrom Resolution In Orthorhombic Form Length = 254 Back     alignment and structure
>gi|260099805|pdb|2WQK|A Chain A, Crystal Structure Of Sure Protein From Aquifex Aeolicus Length = 251 Back     alignment and structure
gi|15988428|pdb|1J9J|A Chain A, Crystal Structure Analysis Of Sure Protein From T.Maritima Length = 247 Back     alignment and structure
>gi|16975331|pdb|1ILV|A Chain A, Crystal Structure Analysis Of The Tm107 Length = 247 Back     alignment and structure
gi|158428248|pdb|2E69|A Chain A, Crystal Structure Of The Stationary Phase Survival Protein Sure From Thermus Thermophilus Hb8 In Complex With Sulfate Length = 244 Back     alignment and structure
>gi|158428276|pdb|2E6H|A Chain A, Crystal Structure Of E37a Mutant Of The Stationary Phase Survival Protein Sure From Thermus Thermophilus Hb8 Cocrystallized With Manganese And Amp Length = 244 Back     alignment and structure
>gi|28948471|pdb|1L5X|A Chain A, The 2.0-Angstrom Resolution Crystal Structure Of A Survival Protein E (Sure) Homolog From Pyrobaculum Aerophilum Length = 280 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target250 stationary phase survival protein SurE [Candidatus Libe
2v4n_A254 Multifunctional protein SUR E; hydrolase, surviVal prot 5e-55
1j9j_A247 Stationary phase surviVal protein; SURE protein, unknow 9e-50
1l5x_A280 SurviVal protein E; structural genomics, putative acid 4e-48
2phj_A251 5'-nucleotidase SURE; SURE protein, putative acid phosp 3e-45
2e6c_A244 5'-nucleotidase SURE; SURE protein, cowith manganese IO 6e-41
>2v4n_A Multifunctional protein SUR E; hydrolase, surviVal protein, stationary phase, phosphatase, mononucleotidase, divalent metal ION; 1.7A {Salmonella typhimurium} PDB: 2v4o_A Length = 254 Back     alignment and structure
 Score =  209 bits (533), Expect = 5e-55
 Identities = 72/251 (28%), Positives = 122/251 (48%), Gaps = 6/251 (2%)

Query: 1   MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISKK 60
           MRILL+NDDG+ + G+ TL    R  +D + + AP+ ++S  +NSLT+  ++   T    
Sbjct: 2   MRILLSNDDGVHAPGIQTLAKALREFAD-VQVVAPDRNRSGASNSLTLESSLRTFTFDNG 60

Query: 61  RFAVH-GTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIR 119
             AV  GTP DCV + +  +   +PD+++SG+N G N  + V YSGT+AAA EG   G  
Sbjct: 61  DIAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFP 120

Query: 120 SFALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTVVTA 179
           + A+S          ++ +      +LR L +  +    + N+N P     +V+   VT 
Sbjct: 121 ALAVSLNGYQ----HYDTAAAVTCALLRGLSREPLRTGRILNVNVPDLPLAQVKGIRVTR 176

Query: 180 QGKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVTPITTDLTDYN 239
            G    +            + Y +       +    +D  A+    +SVTP+  DLT ++
Sbjct: 177 CGSRHPADKVIPQEDPRGNTLYWIGPPGDKYDAGPDTDFAAVDEGYVSVTPLHVDLTAHS 236

Query: 240 SQQYISLSLET 250
           +   +S  L++
Sbjct: 237 AHDVVSDWLDS 247


>1j9j_A Stationary phase surviVal protein; SURE protein, unknown function; 1.90A {Thermotoga maritima} SCOP: c.106.1.1 PDB: 1ilv_A 1j9k_A* 1j9l_A* Length = 247 Back     alignment and structure
>1l5x_A SurviVal protein E; structural genomics, putative acid phosphatase, mixed alpha/beta protein, N-terminal rossmann-fold like; 2.00A {Pyrobaculum aerophilum} SCOP: c.106.1.1 Length = 280 Back     alignment and structure
>2e6c_A 5'-nucleotidase SURE; SURE protein, cowith manganese ION and AMP, hydrolase; 2.05A {Thermus thermophilus HB8} PDB: 2e6b_A 2e69_A 2e6e_A 2e6g_A 2e6h_A Length = 244 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target250 stationary phase survival protein SurE [Candidatus Libe
2v4n_A254 Multifunctional protein SUR E; hydrolase, surviVal prot 100.0
1j9j_A247 Stationary phase surviVal protein; SURE protein, unknow 100.0
2phj_A251 5'-nucleotidase SURE; SURE protein, putative acid phosp 100.0
1l5x_A280 SurviVal protein E; structural genomics, putative acid 100.0
2e6c_A244 5'-nucleotidase SURE; SURE protein, cowith manganese IO 100.0
2gek_A 406 Phosphatidylinositol mannosyltransferase (PIMA); GT4 gl 95.11
3fro_A 439 GLGA glycogen synthase; glycosyltransferase family, UDP 94.41
2iuy_A342 Avigt4, glycosyltransferase; antibiotics, family GT-4, 93.08
2p6p_A 384 Glycosyl transferase; GT-B family, X-RAY-diffraction,ur 90.71
1rzu_A 485 Glycogen synthase 1; glycosyl-transferase, GT-B fold, r 90.69
2iyf_A 430 OLED, oleandomycin glycosyltransferase; antibiotic resi 93.44
>2v4n_A Multifunctional protein SUR E; hydrolase, surviVal protein, stationary phase, phosphatase, mononucleotidase, divalent metal ION; 1.7A {Salmonella typhimurium} PDB: 2v4o_A Back     alignment and structure
Probab=100.00  E-value=0  Score=578.26  Aligned_cols=245  Identities=29%  Similarity=0.430  Sum_probs=232.3

Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCCEEEEECCCCCEEEEEEEEE-EEEECCCHHHHHHHHHHHC
Q ss_conf             926882689868856999999998548919998179985650320224897058897110-4763272799999998750
Q gi|255764489|r    1 MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISKK-RFAVHGTPVDCVVIALQKM   79 (250)
Q Consensus         1 m~ILitNDDG~~a~gl~~l~~~l~~~~~~v~vvAP~~~~S~~~~ait~~~~~~~~~~~~~-~~~v~GtPaDcv~~~l~~l   79 (250)
                      |||||||||||+||||++|+++|+++| +|+||||++||||+|||||+++|+++++++.. .|.++|||||||++||+++
T Consensus         2 M~ILltNDDGi~a~gi~~L~~~l~~~g-~V~vvAP~~~~Sg~g~ait~~~~l~~~~~~~~~~~~~~GtPadcv~~al~~l   80 (254)
T 2v4n_A            2 MRILLSNDDGVHAPGIQTLAKALREFA-DVQVVAPDRNRSGASNSLTLESSLRTFTFDNGDIAVQMGTPTDCVYLGVNAL   80 (254)
T ss_dssp             CEEEEECSSCTTCHHHHHHHHHHTTTS-EEEEEEESSCCTTCTTCCCCSSCCEEEECTTSCEEEETCCHHHHHHHHHHTT
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHCC-CEEEEECCCCCCCCCCCCCCCCCCEEEEECCCEEEEECCCCHHHHHHHHCCC
T ss_conf             679998079889888999999998669-9999931999863614656899826899547248996388156798864200


Q ss_pred             CCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             46454199971488853102333457778998898718985322200135676614788888499999998677866735
Q gi|255764489|r   80 SDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIRSFALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTL  159 (250)
Q Consensus        80 ~~~~pDlViSGiN~G~N~g~~v~ySGTvgAA~ea~~~GipsIAiS~~~~~~~~~~~~~a~~~~~~ii~~l~~~~~p~~~v  159 (250)
                      ++++|||||||||+|.|+|.|++|||||||||||+++||||||+|++.    ...|+.+++++.++++++.++.+|.+.+
T Consensus        81 ~~~~pDLVvSGIN~G~N~g~~v~ySGTVgAA~ea~~~GipsIAvS~~~----~~~~~~~~~~~~~i~~~l~~~~~p~~~~  156 (254)
T 2v4n_A           81 MRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPALAVSLNG----YQHYDTAAAVTCALLRGLSREPLRTGRI  156 (254)
T ss_dssp             SSSCCSEEEEEEEESCCCGGGGGGCHHHHHHHTTTTSSSCEEEEEESS----SSCHHHHHHHHHHHHHHHHHSCCCSCSE
T ss_pred             CCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEECC----CCCHHHHHHHHHHHHHHHHHCCCCCCEE
T ss_conf             579999899797389747736231188999999997499834897036----6554688887899998776457654327


Q ss_pred             EECCCCCCCCHHCCCCEEEECCCCCCCCCCEEECCCCCCCEEEEECCCCCCCCCCCCCHHHHHCCCEEEECCCCCCCCHH
Q ss_conf             43145678810158838913766543554278406886516997236777789885507899689889902153564889
Q gi|255764489|r  160 CNINFPRCSPEEVQKTVVTAQGKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVTPITTDLTDYN  239 (250)
Q Consensus       160 lNINiP~~~~~~ikg~k~t~~g~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~~e~TD~~Al~~GyISVTPL~~DlT~~~  239 (250)
                      ||||||.++..++||+|+|+||++.|...+.+..+++++.+||++......+..++||.+||++||||||||++|||+|+
T Consensus       157 LNIN~P~~~~~~~kGik~t~lg~r~~~~~~~~~~d~~g~~~yw~~~~~~~~~~~~~TD~~al~~GyISVTPL~~dlT~~~  236 (254)
T 2v4n_A          157 LNVNVPDLPLAQVKGIRVTRCGSRHPADKVIPQEDPRGNTLYWIGPPGDKYDAGPDTDFAAVDEGYVSVTPLHVDLTAHS  236 (254)
T ss_dssp             EEEEECSSCGGGCCCEEECBCCEESCCCCEEEEECTTSCEEEEECCCCCEEECSTTBHHHHHHTTCEEEEEECSCCCCGG
T ss_pred             EEEECCCCCCCCCCCEEEEEECCCCCCCCCEEEECCCCCEEEEECCCCCCCCCCCCCHHHHHHCCEEEEEEECCCCCCHH
T ss_conf             99866888500278659810067334655212007999749997788777889998799998799289835545674989


Q ss_pred             HHHHHHHHHCC
Q ss_conf             99999987459
Q gi|255764489|r  240 SQQYISLSLET  250 (250)
Q Consensus       240 ~l~~L~~~l~~  250 (250)
                      .|++|++||++
T Consensus       237 ~l~~L~~wl~~  247 (254)
T 2v4n_A          237 AHDVVSDWLDS  247 (254)
T ss_dssp             GHHHHHHHHHH
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999974



>1j9j_A Stationary phase surviVal protein; SURE protein, unknown function; 1.90A {Thermotoga maritima} SCOP: c.106.1.1 PDB: 1ilv_A 1j9k_A* 1j9l_A* Back     alignment and structure
>1l5x_A SurviVal protein E; structural genomics, putative acid phosphatase, mixed alpha/beta protein, N-terminal rossmann-fold like; 2.00A {Pyrobaculum aerophilum} SCOP: c.106.1.1 Back     alignment and structure
>2e6c_A 5'-nucleotidase SURE; SURE protein, cowith manganese ION and AMP, hydrolase; 2.05A {Thermus thermophilus HB8} PDB: 2e6b_A 2e69_A 2e6e_A 2e6g_A 2e6h_A Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, binary complex; HET: GDP; 2.40A {Mycobacterium smegmatis str} PDB: 2gej_A* Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthase, two rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} PDB: 2bis_A* Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>2p6p_A Glycosyl transferase; GT-B family, X-RAY-diffraction,urdamycina- biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 250 stationary phase survival protein SurE [Candidatus Libe
d1j9ja_247 c.106.1.1 (A:) SurE homolog TM1662 {Thermotoga maritima 2e-45
d1l5xa_276 c.106.1.1 (A:) SurE homolog PAE2908 (SurE-alpha) {Archa 1e-42
>d1j9ja_ c.106.1.1 (A:) SurE homolog TM1662 {Thermotoga maritima [TaxId: 2336]} Length = 247 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: SurE-like
superfamily: SurE-like
family: SurE-like
domain: SurE homolog TM1662
species: Thermotoga maritima [TaxId: 2336]
 Score =  176 bits (446), Expect = 2e-45
 Identities = 68/253 (26%), Positives = 125/253 (49%), Gaps = 10/253 (3%)

Query: 1   MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISK- 59
           MRIL+TNDDGI+SKG+I L  +      ++++ AP+ ++S   +S+T+   +  + +   
Sbjct: 1   MRILVTNDDGIQSKGIIVLAELLSEE-HEVFVVAPDKERSATGHSITIHVPLWMKKVFIS 59

Query: 60  ---KRFAVHGTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQ 116
                ++  GTP DCV +A   + DK+ DLI+SGVN G N    + +SGT++ A EG++ 
Sbjct: 60  ERVVAYSTTGTPADCVKLAYNVVMDKRVDLIVSGVNRGPNMGMDILHSGTVSGAMEGAMM 119

Query: 117 GIRSFALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTV 176
            I S A+S A        +E +       L++   + +   T+ NIN P     E++   
Sbjct: 120 NIPSIAISSANY--ESPDFEGAARFLIDFLKEFDFSLLDPFTMLNINVP---AGEIKGWR 174

Query: 177 VTAQGKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVTPITTDLT 236
            T Q +  ++   ++  +     +Y +       +  +  D  A++   +S+TPI   LT
Sbjct: 175 FTRQSRRRWNDYFEERVSPFGEKYYWMMGEVIEDDDRDDVDYKAVREGYVSITPIHPFLT 234

Query: 237 DYNSQQYISLSLE 249
           +    + +    +
Sbjct: 235 NEQCLKKLREVYD 247


>d1l5xa_ c.106.1.1 (A:) SurE homolog PAE2908 (SurE-alpha) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target250 stationary phase survival protein SurE [Candidatus Libe
d1j9ja_247 SurE homolog TM1662 {Thermotoga maritima [TaxId: 2336]} 100.0
d1l5xa_276 SurE homolog PAE2908 (SurE-alpha) {Archaeon Pyrobaculum 100.0
d1pn3a_ 391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis ori 95.27
d1qo0d_189 Positive regulator of the amidase operon AmiR {Pseudomo 93.62
d2bisa1 437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29 91.88
d1rzua_ 477 Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [T 90.05
>d1j9ja_ c.106.1.1 (A:) SurE homolog TM1662 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: SurE-like
superfamily: SurE-like
family: SurE-like
domain: SurE homolog TM1662
species: Thermotoga maritima [TaxId: 2336]
Probab=100.00  E-value=0  Score=577.13  Aligned_cols=243  Identities=28%  Similarity=0.388  Sum_probs=227.9

Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCCEEEEECCCCCEEEEEEEE----EEEEECCCHHHHHHHHH
Q ss_conf             92688268986885699999999854891999817998565032022489705889711----04763272799999998
Q gi|255764489|r    1 MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISK----KRFAVHGTPVDCVVIAL   76 (250)
Q Consensus         1 m~ILitNDDG~~a~gl~~l~~~l~~~~~~v~vvAP~~~~S~~~~ait~~~~~~~~~~~~----~~~~v~GtPaDcv~~~l   76 (250)
                      |||||||||||+||||++|+++|++ +|+|+||||++||||+|||||+++|++++++..    ..|+|+|||||||++||
T Consensus         1 M~ILltNDDGi~s~gl~~L~~~l~~-~~~V~vvAP~~~~S~~g~ait~~~~l~~~~~~~~~~~~~~~v~GTPaDcv~~al   79 (247)
T d1j9ja_           1 MRILVTNDDGIQSKGIIVLAELLSE-EHEVFVVAPDKERSATGHSITIHVPLWMKKVFISERVVAYSTTGTPADCVKLAY   79 (247)
T ss_dssp             CEEEEECSSCTTCHHHHHHHHHHTT-TSEEEEEEESSCCTTCTTCCCCSSCCCEEECCCSSSEEEEEESSCHHHHHHHHH
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHC-CCEEEEEECCCCCCCCCCCCCCCCCCCEEEEECCCCCEEEEECCCHHHHHHHHH
T ss_conf             9599973799897679999999865-991999946998747712566799961388404888228986796289999865


Q ss_pred             HHCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             75046454199971488853102333457778998898718985322200135676614788888499999998677866
Q gi|255764489|r   77 QKMSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIRSFALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPN  156 (250)
Q Consensus        77 ~~l~~~~pDlViSGiN~G~N~g~~v~ySGTvgAA~ea~~~GipsIAiS~~~~~~~~~~~~~a~~~~~~ii~~l~~~~~p~  156 (250)
                      +++++++|||||||||+|.|+|.|++|||||||||||+++||||||+||+..  +..+|+.+++++.++++++++.++|.
T Consensus        80 ~~l~~~~pDlVvSGIN~G~N~g~dv~ySGTVgAA~ea~~~gipsiA~S~~~~--~~~~~~~a~~~~~~li~~l~~~~~p~  157 (247)
T d1j9ja_          80 NVVMDKRVDLIVSGVNRGPNMGMDILHSGTVSGAMEGAMMNIPSIAISSANY--ESPDFEGAARFLIDFLKEFDFSLLDP  157 (247)
T ss_dssp             HTTSTTCCSEEEEEEEESCCCGGGGGGCHHHHHHHHHHHTTCCEEEEEESCS--SSCCHHHHHHHHHHHHHHCCGGGSCT
T ss_pred             HHCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEHHHHH--CCCCHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             0002576557996554787544155667777799999853778412012220--16431677889999999997457764


Q ss_pred             CCEEECCCCCCCCHHCCCCEEEECCCCCCCCCCEEECCCCCCCEEEEECCCCCCCCCCCCCHHHHHCCCEEEECCCCCCC
Q ss_conf             73543145678810158838913766543554278406886516997236777789885507899689889902153564
Q gi|255764489|r  157 TTLCNINFPRCSPEEVQKTVVTAQGKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVTPITTDLT  236 (250)
Q Consensus       157 ~~vlNINiP~~~~~~ikg~k~t~~g~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~~e~TD~~Al~~GyISVTPL~~DlT  236 (250)
                      +.+||||||.   .++||+++|+||++.+...+.+..+++++.+||+.......+..++||.+|+++||||||||++|||
T Consensus       158 ~~~lNVN~P~---~~~kG~k~t~~g~~~~~~~~~~~~~~~g~~~y~~~~~~~~~~~~~~tD~~al~~GyISVTPL~~dlT  234 (247)
T d1j9ja_         158 FTMLNINVPA---GEIKGWRFTRQSRRRWNDYFEERVSPFGEKYYWMMGEVIEDDDRDDVDYKAVREGYVSITPIHPFLT  234 (247)
T ss_dssp             TCEEEEEECS---SCCCEEEECBCCCCEEEEEEEEEECTTSCEEEEEEEEEECCCCCSSBHHHHHHTTEEEEEEECSCCC
T ss_pred             CCCCCCCCCH---HHCCCCEEEEECCCCCCCCCEEEECCCCCEEEEECCCCCCCCCCCCHHHHHHHCCEEEEEECCCCCC
T ss_conf             4201578980---4306843666213234553213007999706996367667889997299999799289803175876


Q ss_pred             CHHHHHHHHHHHC
Q ss_conf             8899999998745
Q gi|255764489|r  237 DYNSQQYISLSLE  249 (250)
Q Consensus       237 ~~~~l~~L~~~l~  249 (250)
                      +++.|++|+++||
T Consensus       235 ~~~~l~~L~~~fd  247 (247)
T d1j9ja_         235 NEQCLKKLREVYD  247 (247)
T ss_dssp             CHHHHHHHHHHCC
T ss_pred             CHHHHHHHHHHHC
T ss_conf             9899999998549



>d1l5xa_ c.106.1.1 (A:) SurE homolog PAE2908 (SurE-alpha) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 250 stationary phase survival protein SurE [Candidatus
2v4n_A_1-233233 (A:1-233) Multifunctional protein SUR E; hydrolase 1e-59
2phj_A_251 (A:) 5'-nucleotidase SURE; SURE protein, putative 4e-56
1j9j_A_1-233233 (A:1-233) Stationary phase surviVal protein; SURE 3e-55
2e6c_A_244 (A:) 5'-nucleotidase SURE; SURE protein, cowith ma 1e-54
1l5x_A_280 (A:) SurviVal protein E; structural genomics, puta 1e-52
>2v4n_A (A:1-233) Multifunctional protein SUR E; hydrolase, surviVal protein, stationary phase, phosphatase, mononucleotidase, divalent metal ION; 1.7A {Salmonella typhimurium} PDB: 2v4o_ALength = 233 Back     alignment and structure
 Score =  224 bits (571), Expect = 1e-59
 Identities = 68/237 (28%), Positives = 112/237 (47%), Gaps = 6/237 (2%)

Query: 1   MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISKK 60
           MRILL+NDDG+ + G+ TL    R  +D + + AP+ ++S  +NSLT+  ++   T    
Sbjct: 2   MRILLSNDDGVHAPGIQTLAKALREFAD-VQVVAPDRNRSGASNSLTLESSLRTFTFDNG 60

Query: 61  RF-AVHGTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIR 119
                 GTP DCV + +  +   +PD+++SG+N G N  + V YSGT+AAA EG   G  
Sbjct: 61  DIAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFP 120

Query: 120 SFALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTVVTA 179
           + A+S          ++ +      +LR L +  +    + N+N P     +V+   VT 
Sbjct: 121 ALAVSLNGY----QHYDTAAAVTCALLRGLSREPLRTGRILNVNVPDLPLAQVKGIRVTR 176

Query: 180 QGKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVTPITTDLT 236
            G    +            + Y +       +    +D  A+    +SVTP+  DLT
Sbjct: 177 CGSRHPADKVIPQEDPRGNTLYWIGPPGDKYDAGPDTDFAAVDEGYVSVTPLHVDLT 233


>1j9j_A (A:1-233) Stationary phase surviVal protein; SURE protein, unknown function; 1.90A {Thermotoga maritima}Length = 233 Back     alignment and structure
>2e6c_A (A:) 5'-nucleotidase SURE; SURE protein, cowith manganese ION and AMP, hydrolase; 2.05A {Thermus thermophilus HB8} PDB: 2e6b_A 2e69_A 2e6e_A 2e6g_A 2e6h_ALength = 244 Back     alignment and structure
>1l5x_A (A:) SurviVal protein E; structural genomics, putative acid phosphatase, mixed alpha/beta protein, N-terminal rossmann-fold like; 2.00A {Pyrobaculum aerophilum}Length = 280 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target250 stationary phase survival protein SurE [Candidatus Libe
2phj_A_251 5'-nucleotidase SURE; SURE protein, putative acid 100.0
2v4n_A_1-233233 Multifunctional protein SUR E; hydrolase, surviVal 100.0
2e6c_A_244 5'-nucleotidase SURE; SURE protein, cowith mangane 100.0
1j9j_A_1-233233 Stationary phase surviVal protein; SURE protein, u 100.0
1l5x_A_280 SurviVal protein E; structural genomics, putative 100.0
1f0k_A_1-171_340-364196 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 95.36
2r60_A_1-234_444-499290 Glycosyl transferase, group 1; rossmann-fold; 1.80 95.26
2p6p_A_1-200_368-384217 Glycosyl transferase; GT-B family, X-RAY-diffracti 94.93
2gek_A_1-197_367-406237 Phosphatidylinositol mannosyltransferase (PIMA); G 94.07
1iir_A_1-222_384-415254 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 93.68
3c48_A_1-222_411-438250 Predicted glycosyltransferases; retaining glycosyl 92.62
1rrv_A_1-221_381-416257 Glycosyltransferase GTFD; GT-B, rossmann fold; HET 91.06
2qzs_A_1-259_461-485284 Glycogen synthase; glycosyl-transferase, GT-B fold 90.85
2iw1_A_1-173_358-374190 Lipopolysaccharide core biosynthesis protein RFAG; 92.36
1rzu_A_1-259_460-485285 Glycogen synthase 1; glycosyl-transferase, GT-B fo 92.31
>2v4n_A (A:1-233) Multifunctional protein SUR E; hydrolase, surviVal protein, stationary phase, phosphatase, mononucleotidase, divalent metal ION; 1.7A {Salmonella typhimurium} PDB: 2v4o_A Back     alignment and structure
>2e6c_A (A:) 5'-nucleotidase SURE; SURE protein, cowith manganese ION and AMP, hydrolase; 2.05A {Thermus thermophilus HB8} PDB: 2e6b_A 2e69_A 2e6e_A 2e6g_A 2e6h_A Back     alignment and structure
>1j9j_A (A:1-233) Stationary phase surviVal protein; SURE protein, unknown function; 1.90A {Thermotoga maritima} Back     alignment and structure
>1l5x_A (A:) SurviVal protein E; structural genomics, putative acid phosphatase, mixed alpha/beta protein, N-terminal rossmann-fold like; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>1f0k_A (A:1-171,A:340-364) MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} Back     alignment and structure
>2r60_A (A:1-234,A:444-499) Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>2p6p_A (A:1-200,A:368-384) Glycosyl transferase; GT-B family, X-RAY-diffraction,urdamycina- biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>2gek_A (A:1-197,A:367-406) Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, binary complex; HET: GDP; 2.40A {Mycobacterium smegmatis str} PDB: 2gej_A* Back     alignment and structure
>1iir_A (A:1-222,A:384-415) Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} Back     alignment and structure
>3c48_A (A:1-222,A:411-438) Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate assisted catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>1rrv_A (A:1-221,A:381-416) Glycosyltransferase GTFD; GT-B, rossmann fold; HET: DVV TYD; 2.00A {Amycolatopsis orientalis} Back     alignment and structure
>2qzs_A (A:1-259,A:461-485) Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>2iw1_A (A:1-173,A:358-374) Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} Back     alignment and structure
>1rzu_A (A:1-259,A:460-485) Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding; HET: ADP; 2.30A {Agrobacterium tumefaciens} Back     alignment and structure