254780690

254780690

flagellar biosynthesis protein FlhB

GeneID in NCBI database:8209694Locus tag:CLIBASIA_02885
Protein GI in NCBI database:254780690Protein Accession:YP_003065103.1
Gene range:-(577425, 578489)Protein Length:354aa
Gene description:flagellar biosynthesis protein FlhB
COG prediction:[N] [U] Flagellar biosynthesis pathway, component FlhB
KEGG prediction:flhB; flagellar biosynthesis protein FlhB; K02401 flagellar biosynthetic protein FlhB
SEED prediction:Flagellar biosynthesis protein FlhB
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM4 TM-Helix
TOPPRED4 TM-Helix
HMMTOP6 TM-Helix
MEMSAT3 TM-Helix
MEMSAT_SVM4 TM-Helix
PHOBIUS4 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350----
MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI
cccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHcccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccEEEEEEEEccccccccEEEEEcccHHHHHHHHHHHHccccEEEcHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccc
cccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEccHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccEEEEccccEEEEEEEccccccccEEEEccHHHHHHHHHHHHHHccccEccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcc
msendapdnkteapssKKIEDALnegnapisrEASLFSSILACLIYLLFffspgiysvTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSyliqripvlnlnhvkpsfkrvSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDfisanphsilYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKqsygnpiiknRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIqtendapvlVAKGQNLIAKKMRKIAYehnipifeepslarslfkqvpinsaippVFYKAVAQLIYKIYHKKI
msendapdnkteapsskKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIkqsygnpiiknrqksiarSRIRHKMMeatsratiiiTNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI
MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI
******P********************APISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQE************************************ATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI
****************KKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI
*******************E****E*NAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiii
oooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI
MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI
MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKKI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target354 flagellar biosynthesis protein FlhB [Candidatus Liberib
315121857354 flagellar biosynthesis protein FlhB [Candidatus Liberib 1 1e-147
222147560361 flagellar biosynthesis protein FlhB [Agrobacterium viti 1 3e-91
222084854358 flagellar biosynthesis transmembrane protein [Agrobacte 1 1e-90
241203095359 flagellar biosynthesis protein FlhB [Rhizobium legumino 1 5e-89
15964403360 flagellar biosynthesis protein FlhB [Sinorhizobium meli 1 5e-89
15887910360 flagellar biosynthesis protein FlhB [Agrobacterium tume 1 1e-88
2916784360 flhB protein [Sinorhizobium meliloti] Length = 360 1 1e-88
150395473360 flagellar biosynthesis protein FlhB [Sinorhizobium medi 1 3e-88
116250471365 flagellar biosynthesis protein FlhB [Rhizobium legumino 1 3e-88
227820846360 flagellar biosynthesis protein FlhB [Sinorhizobium fred 1 4e-88
>gi|315121857|ref|YP_004062346.1| flagellar biosynthesis protein FlhB [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 354 Back     alignment and organism information
 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 261/352 (74%), Positives = 312/352 (88%)

Query: 1   MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLIYLLFFFSPGIYSVTS 60
           MSEND P+NKTE+PSSKKIEDAL++GNAP+SRE  LFSS LACLIYLLFF SPGI+ +T 
Sbjct: 1   MSENDNPENKTESPSSKKIEDALSKGNAPVSREVYLFSSTLACLIYLLFFVSPGIHDLTY 60

Query: 61  DLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMMFGIGSYLIQRIPVLNL 120
           D  + LAS TQ KL+ +SH+VFLL  L  S S+L+IPGLLLFM+FG+GSYLIQRIP  NL
Sbjct: 61  DFRMFLASVTQWKLDSVSHLVFLLVTLGFSTSKLLIPGLLLFMIFGVGSYLIQRIPSFNL 120

Query: 121 NHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIITISLTENYFTMLDFISAN 180
           N+++PS KR+SLREGIKRIYS NNLVNF KS  KI++VGT+I ISL +N+ TML+ I++N
Sbjct: 121 NNIRPSLKRISLREGIKRIYSTNNLVNFTKSSFKIVIVGTLIAISLKDNHLTMLESITSN 180

Query: 181 PHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKLKMSKQEIKDEIKQSYGNP 240
           P  IL+H FFT+RK+LI+ILLFIA LT++DIGW+Y+QWYSKLKMSKQE+KDEIKQSYGNP
Sbjct: 181 PQIILHHIFFTIRKILIIILLFIAILTIIDIGWTYYQWYSKLKMSKQEVKDEIKQSYGNP 240

Query: 241 IIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNLIA 300
           +IK+RQKSIARSRIRHKM+EATSRAT++ITNPTHYALALRY+ TEND P+++AKGQNLIA
Sbjct: 241 MIKSRQKSIARSRIRHKMIEATSRATLVITNPTHYALALRYVPTENDVPIMIAKGQNLIA 300

Query: 301 KKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHK 352
            K+RKIA E NIPIFE+P LARSLF+QVPINS+IPPVFYKA+AQLI+KIY K
Sbjct: 301 SKIRKIASEKNIPIFEDPLLARSLFRQVPINSSIPPVFYKAIAQLIHKIYSK 352


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222147560|ref|YP_002548517.1| flagellar biosynthesis protein FlhB [Agrobacterium vitis S4] Length = 361 Back     alignment and organism information
>gi|222084854|ref|YP_002543383.1| flagellar biosynthesis transmembrane protein [Agrobacterium radiobacter K84] Length = 358 Back     alignment and organism information
>gi|241203095|ref|YP_002974191.1| flagellar biosynthesis protein FlhB [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 359 Back     alignment and organism information
>gi|15964403|ref|NP_384756.1| flagellar biosynthesis protein FlhB [Sinorhizobium meliloti 1021] Length = 360 Back     alignment and organism information
>gi|15887910|ref|NP_353591.1| flagellar biosynthesis protein FlhB [Agrobacterium tumefaciens str. C58] Length = 360 Back     alignment and organism information
>gi|2916784|emb|CAA11951.1| flhB protein [Sinorhizobium meliloti] Length = 360 Back     alignment and organism information
>gi|150395473|ref|YP_001325940.1| flagellar biosynthesis protein FlhB [Sinorhizobium medicae WSM419] Length = 360 Back     alignment and organism information
>gi|116250471|ref|YP_766309.1| flagellar biosynthesis protein FlhB [Rhizobium leguminosarum bv. viciae 3841] Length = 365 Back     alignment and organism information
>gi|227820846|ref|YP_002824816.1| flagellar biosynthesis protein FlhB [Sinorhizobium fredii NGR234] Length = 360 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target354 flagellar biosynthesis protein FlhB [Candidatus Liberib
PRK05702359 PRK05702, flhB, flagellar biosynthesis protein FlhB; Re 3e-90
TIGR00328347 TIGR00328, flhB, flagellar biosynthetic protein FlhB 4e-80
PRK13109358 PRK13109, flhB, flagellar biosynthesis protein FlhB; Re 3e-77
pfam01312343 pfam01312, Bac_export_2, FlhB HrpN YscU SpaS Family 3e-72
TIGR01404342 TIGR01404, FlhB_rel_III, type III secretion protein, Ys 2e-50
PRK12772609 PRK12772, PRK12772, bifunctional flagellar biosynthesis 3e-49
PRK12468386 PRK12468, flhB, flagellar biosynthesis protein FlhB; Re 1e-43
COG4792349 COG4792, EscU, Type III secretory pathway, component Es 2e-43
PRK09108353 PRK09108, PRK09108, type III secretion system protein H 4e-42
PRK12721349 PRK12721, PRK12721, secretion system apparatus protein 2e-36
PRK06298356 PRK06298, PRK06298, type III secretion system protein; 1e-27
PRK12773646 PRK12773, flhB, flagellar biosynthesis protein FlhB; Re 1e-26
PRK08156361 PRK08156, PRK08156, type III secretion system protein S 2e-20
COG1377363 COG1377, FlhB, Flagellar biosynthesis pathway, componen 6e-84
COG225792 COG2257, COG2257, Uncharacterized homolog of the cytopl 1e-13
TIGR0078982 TIGR00789, flhB_rel, flhB C-terminus-related protein 4e-11
>gnl|CDD|180212 PRK05702, flhB, flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>gnl|CDD|129428 TIGR00328, flhB, flagellar biosynthetic protein FlhB Back     alignment and domain information
>gnl|CDD|183864 PRK13109, flhB, flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>gnl|CDD|110325 pfam01312, Bac_export_2, FlhB HrpN YscU SpaS Family Back     alignment and domain information
>gnl|CDD|130471 TIGR01404, FlhB_rel_III, type III secretion protein, YscU/HrpY family Back     alignment and domain information
>gnl|CDD|183736 PRK12772, PRK12772, bifunctional flagellar biosynthesis protein FliR/FlhB; Provisional Back     alignment and domain information
>gnl|CDD|171522 PRK12468, flhB, flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>gnl|CDD|34402 COG4792, EscU, Type III secretory pathway, component EscU [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|181653 PRK09108, PRK09108, type III secretion system protein HrcU; Validated Back     alignment and domain information
>gnl|CDD|183700 PRK12721, PRK12721, secretion system apparatus protein SsaU; Reviewed Back     alignment and domain information
>gnl|CDD|180519 PRK06298, PRK06298, type III secretion system protein; Validated Back     alignment and domain information
>gnl|CDD|183737 PRK12773, flhB, flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>gnl|CDD|181258 PRK08156, PRK08156, type III secretion system protein SpaS; Validated Back     alignment and domain information
>gnl|CDD|31567 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|32438 COG2257, COG2257, Uncharacterized homolog of the cytoplasmic domain of flagellar protein FhlB [Function unknown] Back     alignment and domain information
>gnl|CDD|129871 TIGR00789, flhB_rel, flhB C-terminus-related protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 354 flagellar biosynthesis protein FlhB [Candidatus Liberib
TIGR00328352 flhB flagellar biosynthetic protein FlhB; InterPro: IPR 100.0
PRK13109358 flhB flagellar biosynthesis protein FlhB; Reviewed 100.0
PRK05702352 flhB flagellar biosynthesis protein FlhB; Reviewed 100.0
PRK12772609 bifunctional flagellar biosynthesis protein FliR/FlhB; 100.0
PRK12468383 flhB flagellar biosynthesis protein FlhB; Reviewed 100.0
PRK06298360 type III secretion system protein; Validated 100.0
PRK09108354 type III secretion system protein HrcU; Validated 100.0
COG1377363 FlhB Flagellar biosynthesis pathway, component FlhB [Ce 100.0
PRK12721349 secretion system apparatus protein SsaU; Reviewed 100.0
pfam01312343 Bac_export_2 FlhB HrpN YscU SpaS Family. This family in 100.0
PRK08156367 surface presentation of antigens protein SpaS; Validate 100.0
PRK12773649 flhB flagellar biosynthesis protein FlhB; Reviewed 100.0
TIGR01404346 FlhB_rel_III type III secretion protein, YscU/HrpY fami 100.0
COG4792349 EscU Type III secretory pathway, component EscU [Intrac 100.0
TIGR0078984 flhB_rel FlhB domain protein; InterPro: IPR004683 This 99.75
COG225792 Uncharacterized homolog of the cytoplasmic domain of fl 99.72
COG1377363 FlhB Flagellar biosynthesis pathway, component FlhB [Ce 97.81
PRK13109358 flhB flagellar biosynthesis protein FlhB; Reviewed 97.26
PRK09108354 type III secretion system protein HrcU; Validated 97.04
pfam01312343 Bac_export_2 FlhB HrpN YscU SpaS Family. This family in 96.72
PRK12772609 bifunctional flagellar biosynthesis protein FliR/FlhB; 95.3
PRK12468383 flhB flagellar biosynthesis protein FlhB; Reviewed 97.58
PRK06298360 type III secretion system protein; Validated 97.15
PRK08156367 surface presentation of antigens protein SpaS; Validate 95.13
PRK05702352 flhB flagellar biosynthesis protein FlhB; Reviewed 97.5
PRK12721349 secretion system apparatus protein SsaU; Reviewed 97.02
PRK12773649 flhB flagellar biosynthesis protein FlhB; Reviewed 96.93
TIGR00328352 flhB flagellar biosynthetic protein FlhB; InterPro: IPR 96.8
COG1422201 Predicted membrane protein [Function unknown] 91.09
>TIGR00328 flhB flagellar biosynthetic protein FlhB; InterPro: IPR006136 The flhB and flhA genes constitute an operon called flhB operon on the Salmonella typhimurium chromosome Back     alignment and domain information
>PRK13109 flhB flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>PRK05702 flhB flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>PRK12772 bifunctional flagellar biosynthesis protein FliR/FlhB; Provisional Back     alignment and domain information
>PRK12468 flhB flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>PRK06298 type III secretion system protein; Validated Back     alignment and domain information
>PRK09108 type III secretion system protein HrcU; Validated Back     alignment and domain information
>COG1377 FlhB Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12721 secretion system apparatus protein SsaU; Reviewed Back     alignment and domain information
>pfam01312 Bac_export_2 FlhB HrpN YscU SpaS Family Back     alignment and domain information
>PRK08156 surface presentation of antigens protein SpaS; Validated Back     alignment and domain information
>PRK12773 flhB flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>TIGR01404 FlhB_rel_III type III secretion protein, YscU/HrpY family; InterPro: IPR006307 This is one of several families of proteins related to bacterial flagellar biosynthesis proteins and involved in bacterial type III protein secretion systems Back     alignment and domain information
>COG4792 EscU Type III secretory pathway, component EscU [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00789 flhB_rel FlhB domain protein; InterPro: IPR004683 This group describes a short protein (80-93 residues) homologous to the C-terminus of the flagellar biosynthetic protein FlhB Back     alignment and domain information
>COG2257 Uncharacterized homolog of the cytoplasmic domain of flagellar protein FhlB [Function unknown] Back     alignment and domain information
>COG1377 FlhB Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13109 flhB flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>PRK09108 type III secretion system protein HrcU; Validated Back     alignment and domain information
>pfam01312 Bac_export_2 FlhB HrpN YscU SpaS Family Back     alignment and domain information
>PRK12772 bifunctional flagellar biosynthesis protein FliR/FlhB; Provisional Back     alignment and domain information
>PRK12468 flhB flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>PRK06298 type III secretion system protein; Validated Back     alignment and domain information
>PRK08156 surface presentation of antigens protein SpaS; Validated Back     alignment and domain information
>PRK05702 flhB flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>PRK12721 secretion system apparatus protein SsaU; Reviewed Back     alignment and domain information
>PRK12773 flhB flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>TIGR00328 flhB flagellar biosynthetic protein FlhB; InterPro: IPR006136 The flhB and flhA genes constitute an operon called flhB operon on the Salmonella typhimurium chromosome Back     alignment and domain information
>COG1422 Predicted membrane protein [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target354 flagellar biosynthesis protein FlhB [Candidatus Liberib
2w0r_A144 Crystal Structure Of The Mutated N263d Yscu C-Termi 3e-33
3bzr_A137 Crystal Structure Of Escu C-Terminal Domain With N2 8e-33
2jlh_A144 Crystal Structure Of The Cytoplasmic Domain Of Yers 1e-32
3bzt_A137 Crystal Structural Of The Mutated P263a Escu C-Term 2e-32
3bzp_A137 Crystal Structural Of The Mutated N262a Escu C-Term 5e-32
2jlj_A144 Crystal Structure Of The Cytoplasmic Domain Of Yers 9e-32
2v5g_A144 Crystal Structure Of The Mutated N263a Yscu C-Termi 5e-31
2jli_A123 Atomic Resolution Structure Of The Cytoplasmic Doma 1e-30
3bzl_C83 Crystal Structural Of Native Escu C-Terminal Domain 2e-17
3bzx_B83 Crystal Structure Of The Mutated H265a Escu C-Termi 6e-17
3bzv_B83 Crystal Structural Of The Mutated T264a Escu C-Term 6e-17
3c03_C83 Crystal Structure Of The Escu C-Terminal Domain Wit 2e-16
3bzz_B83 Crystal Structural Of The Mutated R313t EscuSPAS C- 3e-16
3bzy_B83 Crystal Structure Of The Mutated Y316d Escu C-Termi 4e-16
2vt1_B93 Crystal Structure Of The Cytoplasmic Domain Of Spa4 6e-10
3c01_E98 Crystal Structural Of Native Spas C-Terminal Domain 2e-08
3bzl_A54 Crystal Structural Of Native Escu C-Terminal Domain 6e-06
3c00_A54 Crystal Structural Of The Mutated G247t EscuSPAS C- 9e-06
3c03_B54 Crystal Structure Of The Escu C-Terminal Domain Wit 3e-05
3c01_A48 Crystal Structural Of Native Spas C-Terminal Domain 6e-05
2vt1_A52 Crystal Structure Of The Cytoplasmic Domain Of Spa4 7e-04
>gi|211939072|pdb|2W0R|A Chain A, Crystal Structure Of The Mutated N263d Yscu C-Terminal Domain Length = 144 Back     alignment and structure
 Score =  147 bits (371), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 40/131 (30%), Positives = 73/131 (55%)

Query: 219 YSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALA 278
             +LKMSK EIK E K+  G+P IK++++   +      M E   R+++++ +PTH A+ 
Sbjct: 1   IKELKMSKDEIKREYKEMEGSPEIKSKRRQFHQEIQSGNMRENVKRSSVVVADPTHIAIG 60

Query: 279 LRYIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVF 338
           + Y + E   P++  K  +   + +RKIA E  +PI +   LAR+L+    ++  IP   
Sbjct: 61  ILYKRGETPLPLVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQ 120

Query: 339 YKAVAQLIYKI 349
            +A A+++  +
Sbjct: 121 IEATAEVLRWL 131


>gi|185177891|pdb|3BZR|A Chain A, Crystal Structure Of Escu C-Terminal Domain With N262d Mutation, Space Group P 41 21 2 Length = 137 Back     alignment and structure
>gi|222446917|pdb|2JLH|A Chain A, Crystal Structure Of The Cytoplasmic Domain Of Yersinia Pestis Yscu N263a Mutant Length = 144 Back     alignment and structure
>gi|185177893|pdb|3BZT|A Chain A, Crystal Structural Of The Mutated P263a Escu C-Terminal Domain Length = 137 Back     alignment and structure
>gi|185177890|pdb|3BZP|A Chain A, Crystal Structural Of The Mutated N262a Escu C-Terminal Domain Length = 137 Back     alignment and structure
>gi|222446919|pdb|2JLJ|A Chain A, Crystal Structure Of The Cytoplasmic Domain Of Yersinia Pestis Yscu N263a P264a Mutant Length = 144 Back     alignment and structure
>gi|211938988|pdb|2V5G|A Chain A, Crystal Structure Of The Mutated N263a Yscu C-Terminal Domain Length = 144 Back     alignment and structure
>gi|222446918|pdb|2JLI|A Chain A, Atomic Resolution Structure Of The Cytoplasmic Domain Of Yersinia Pestis Yscu, A Regulatory Switch Involved In Type Iii Secretion Length = 123 Back     alignment and structure
>gi|185177885|pdb|3BZL|C Chain C, Crystal Structural Of Native Escu C-Terminal Domain Length = 83 Back     alignment and structure
>gi|185177897|pdb|3BZX|B Chain B, Crystal Structure Of The Mutated H265a Escu C-Terminal Domain Length = 83 Back     alignment and structure
>gi|185177895|pdb|3BZV|B Chain B, Crystal Structural Of The Mutated T264a Escu C-Terminal Domain Length = 83 Back     alignment and structure
>gi|185177914|pdb|3C03|C Chain C, Crystal Structure Of The Escu C-Terminal Domain With P263a Mutation,Space Group P 1 21 1 Length = 83 Back     alignment and structure
>gi|185177901|pdb|3BZZ|B Chain B, Crystal Structural Of The Mutated R313t EscuSPAS C- Terminal Domain Length = 83 Back     alignment and structure
>gi|185177899|pdb|3BZY|B Chain B, Crystal Structure Of The Mutated Y316d Escu C-Terminal Domain Length = 83 Back     alignment and structure
>gi|188595909|pdb|2VT1|B Chain B, Crystal Structure Of The Cytoplasmic Domain Of Spa40, The Specificity Switch For The Shigella Flexneri Type Iii Secretion System Length = 93 Back     alignment and structure
>gi|185177905|pdb|3C01|E Chain E, Crystal Structural Of Native Spas C-Terminal Domain Length = 98 Back     alignment and structure
>gi|185177884|pdb|3BZL|A Chain A, Crystal Structural Of Native Escu C-Terminal Domain Length = 54 Back     alignment and structure
>gi|185177902|pdb|3C00|A Chain A, Crystal Structural Of The Mutated G247t EscuSPAS C- Terminal Domain Length = 54 Back     alignment and structure
>gi|185177913|pdb|3C03|B Chain B, Crystal Structure Of The Escu C-Terminal Domain With P263a Mutation,Space Group P 1 21 1 Length = 54 Back     alignment and structure
>gi|185177904|pdb|3C01|A Chain A, Crystal Structural Of Native Spas C-Terminal Domain Length = 48 Back     alignment and structure
>gi|188595908|pdb|2VT1|A Chain A, Crystal Structure Of The Cytoplasmic Domain Of Spa40, The Specificity Switch For The Shigella Flexneri Type Iii Secretion System Length = 52 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target354 flagellar biosynthesis protein FlhB [Candidatus Liberib
2jlj_A144 YSCU, YOP proteins translocation protein U; cell membra 2e-41
2jli_A123 YSCU, YOP proteins translocation protein; cell membrane 1e-38
3bzs_A137 ESCU; auto cleavage protein, intein, T3SS, TTSS, aspara 6e-38
3bzy_B83 ESCU; auto cleavage protein, flagella, intein, T3SS, me 6e-22
2vt1_B93 Surface presentation of antigens protein SPAS; specific 2e-21
3c01_E98 Surface presentation of antigens protein SPAS; auto cle 2e-20
3bzy_A54 ESCU; auto cleavage protein, flagella, intein, T3SS, me 4e-14
2vt1_A52 Surface presentation of antigens protein SPAS; specific 7e-14
3c01_A48 Surface presentation of antigens protein SPAS; auto cle 6e-13
>2jlj_A YSCU, YOP proteins translocation protein U; cell membrane, transmembrane, yersinia pesits, protein transport, type III secretion system, plasmid; 1.3A {Yersinia pestis} PDB: 2jlh_A* 2v5g_A 2w0r_A Length = 144 Back     alignment and structure
 Score =  164 bits (417), Expect = 2e-41
 Identities = 39/130 (30%), Positives = 71/130 (54%)

Query: 221 KLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALR 280
           +LKMSK EIK E K+  G+P IK++++   +      M E   R+++++   TH A+ + 
Sbjct: 3   ELKMSKDEIKREYKEMEGSPEIKSKRRQFHQEIQSRNMRENVKRSSVVVAAATHIAIGIL 62

Query: 281 YIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYK 340
           Y + E   P++  K  +   + +RKIA E  +PI +   LAR+L+    ++  IP    +
Sbjct: 63  YKRGETPLPLVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIE 122

Query: 341 AVAQLIYKIY 350
           A A+++  + 
Sbjct: 123 ATAEVLRWLE 132


>2jli_A YSCU, YOP proteins translocation protein; cell membrane, transmembrane, protein transport, type III secretion system, plasmid, membrane; 1.13A {Yersinia pestis} Length = 123 Back     alignment and structure
>3bzs_A ESCU; auto cleavage protein, intein, T3SS, TTSS, asparagine cyclization, membrane, membrane protein, protein transport; 1.48A {Escherichia coli} PDB: 3bzr_A 3bzp_A 3bzt_A 3c03_A Length = 137 Back     alignment and structure
>3bzy_B ESCU; auto cleavage protein, flagella, intein, T3SS, membrane, membrane protein, protein transport; 1.20A {Escherichia coli} SCOP: d.367.1.1 PDB: 3c00_B 3bzl_C 3bzo_B 3bzv_B 3c03_C 3bzz_B 3bzx_B Length = 83 Back     alignment and structure
>2vt1_B Surface presentation of antigens protein SPAS; specificity switch, virulence, transmembrane, inner membrane, FLHB, YSCU, T3SS, plasmid; 2.0A {Shigella flexneri} SCOP: d.367.1.1 Length = 93 Back     alignment and structure
>3c01_E Surface presentation of antigens protein SPAS; auto cleavage protein, flagella, ESCU, YSCU, intein, T3SS, membrane, inner membrane; 2.60A {Salmonella typhimurium} SCOP: d.367.1.1 Length = 98 Back     alignment and structure
>3bzy_A ESCU; auto cleavage protein, flagella, intein, T3SS, membrane, membrane protein, protein transport; 1.20A {Escherichia coli} SCOP: d.367.1.1 PDB: 3bzl_A 3bzv_A 3bzx_A 3bzo_A 3bzz_A 3c03_B 3c00_A Length = 54 Back     alignment and structure
>2vt1_A Surface presentation of antigens protein SPAS; specificity switch, virulence, transmembrane, inner membrane, FLHB, YSCU, T3SS, plasmid; 2.0A {Shigella flexneri} SCOP: d.367.1.1 Length = 52 Back     alignment and structure
>3c01_A Surface presentation of antigens protein SPAS; auto cleavage protein, flagella, ESCU, YSCU, intein, T3SS, membrane, inner membrane; 2.60A {Salmonella typhimurium} SCOP: d.367.1.1 Length = 48 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target354 flagellar biosynthesis protein FlhB [Candidatus Liberib
2jlj_A144 YSCU, YOP proteins translocation protein U; cell membra 100.0
3bzs_A137 ESCU; auto cleavage protein, intein, T3SS, TTSS, aspara 100.0
2jli_A123 YSCU, YOP proteins translocation protein; cell membrane 100.0
3c01_E98 Surface presentation of antigens protein SPAS; auto cle 99.93
3bzy_B83 ESCU; auto cleavage protein, flagella, intein, T3SS, me 99.93
2vt1_B93 Surface presentation of antigens protein SPAS; specific 99.93
3bzy_A54 ESCU; auto cleavage protein, flagella, intein, T3SS, me 99.66
3c01_A48 Surface presentation of antigens protein SPAS; auto cle 99.61
2vt1_A52 Surface presentation of antigens protein SPAS; specific 99.58
>2jlj_A YSCU, YOP proteins translocation protein U; cell membrane, transmembrane, yersinia pesits, protein transport, type III secretion system, plasmid; 1.3A {Yersinia pestis} PDB: 2jlh_A* 2v5g_A 2w0r_A Back     alignment and structure
Probab=100.00  E-value=0  Score=410.50  Aligned_cols=135  Identities=29%  Similarity=0.455  Sum_probs=133.3

Q ss_pred             HHHHCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCEEEEEEECCCCCCCCEEEEECCCH
Q ss_conf             98406998999999754489989999999999999998898607768699873553078889768888888899807658
Q gi|254780690|r  219 YSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL  298 (354)
Q Consensus       219 ~k~lkMskqEvK~E~K~~EGdP~iK~~~r~~~re~~~~~~~~~V~~A~vvitNPTH~AVAL~Y~~~~~~aP~vvaKG~~~  298 (354)
                      +|+||||||||||||||+||||+||++||++|||+++++++.+|++|||||||||||||||+||+++++||+|||||.|.
T Consensus         1 ik~lkMsk~EvK~E~K~~EGdP~iK~~rr~~~~e~~~~~~~~~v~~a~vvi~NPth~AVAL~Yd~~~~~aP~VvAkG~g~   80 (144)
T 2jlj_A            1 IKELKMSKDEIKREYKEMEGSPEIKSKRRQFHQEIQSRNMRENVKRSSVVVAAATHIAIGILYKRGETPLPLVTFKYTDA   80 (144)
T ss_dssp             -------------------CCHHHHHHHHHHHHHHCCCCHHHHHHTCSEEEEETTTEEEEEECCTTTCSSCEEEEEEETH
T ss_pred             CCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCEEEEEEECCCCCCCCEEECCCCCH
T ss_conf             94144888999999884539989999999999999985777405741389957871678988788999878820416829


Q ss_pred             HHHHHHHHHHHCCCCEEECHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             9999999999739978868899999997288989489899999999999997302
Q gi|254780690|r  299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK  353 (354)
Q Consensus       299 ~A~~Ir~~A~~~~Vpive~~~LAR~Ly~~~~ig~~Ip~~~y~aVA~il~~v~~lk  353 (354)
                      +|.+|+++|++|||||+|||+|||+||.++++|++||+++|++||+||+|||+++
T Consensus        81 ~A~~I~~~A~e~gIPi~e~~~LAr~Ly~~~~vg~~IP~ely~aVA~ILa~v~~l~  135 (144)
T 2jlj_A           81 QVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRWLERQN  135 (144)
T ss_dssp             HHHHHHHHHHHHTCCEEECHHHHHHHHHHCCTTSBCCGGGHHHHHHHHHHHHHC-
T ss_pred             HHHHHHHHHHHCCCCEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999859978848999999997488999369999999999999999987



>3bzs_A ESCU; auto cleavage protein, intein, T3SS, TTSS, asparagine cyclization, membrane, membrane protein, protein transport; 1.48A {Escherichia coli} PDB: 3bzr_A 3bzp_A 3bzt_A 3c03_A Back     alignment and structure
>2jli_A YSCU, YOP proteins translocation protein; cell membrane, transmembrane, protein transport, type III secretion system, plasmid, membrane; 1.13A {Yersinia pestis} Back     alignment and structure
>3c01_E Surface presentation of antigens protein SPAS; auto cleavage protein, flagella, ESCU, YSCU, intein, T3SS, membrane, inner membrane; 2.60A {Salmonella typhimurium} SCOP: d.367.1.1 Back     alignment and structure
>3bzy_B ESCU; auto cleavage protein, flagella, intein, T3SS, membrane, membrane protein, protein transport; 1.20A {Escherichia coli} SCOP: d.367.1.1 PDB: 3c00_B 3bzl_C 3bzo_B 3bzv_B 3c03_C 3bzz_B 3bzx_B Back     alignment and structure
>2vt1_B Surface presentation of antigens protein SPAS; specificity switch, virulence, transmembrane, inner membrane, FLHB, YSCU, T3SS, plasmid; 2.00A {Shigella flexneri} SCOP: d.367.1.1 Back     alignment and structure
>3bzy_A ESCU; auto cleavage protein, flagella, intein, T3SS, membrane, membrane protein, protein transport; 1.20A {Escherichia coli} SCOP: d.367.1.1 PDB: 3bzl_A 3bzv_A 3bzx_A 3bzo_A 3bzz_A 3c03_B 3c00_A Back     alignment and structure
>3c01_A Surface presentation of antigens protein SPAS; auto cleavage protein, flagella, ESCU, YSCU, intein, T3SS, membrane, inner membrane; 2.60A {Salmonella typhimurium} SCOP: d.367.1.1 Back     alignment and structure
>2vt1_A Surface presentation of antigens protein SPAS; specificity switch, virulence, transmembrane, inner membrane, FLHB, YSCU, T3SS, plasmid; 2.00A {Shigella flexneri} SCOP: d.367.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 354 flagellar biosynthesis protein FlhB [Candidatus Liberib
g3bzy.1100 d.367.1.1 (A:246-262,B:263-345) Type III secretion prot 2e-26
g3c01.1108 d.367.1.1 (A:239-258,E:259-346) Surface presentation of 3e-25
g2vt1.1102 d.367.1.1 (A:237-257,B:258-338) Surface presentation of 3e-25

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target354 flagellar biosynthesis protein FlhB [Candidatus Liberib
g3c01.1108 Surface presentation of antigens protein SpaS {Salmonel 100.0
g2vt1.1102 Surface presentation of antigens protein SpaS {Shigella 99.97
g3bzy.1100 Type III secretion proteins EscU {Escherichia coli [Tax 99.97

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 354 flagellar biosynthesis protein FlhB [Candidatus Li
3bzs_A_137 (A:) ESCU; auto cleavage protein, intein, T3SS, TT 1e-40
2jli_A_123 (A:) YSCU, YOP proteins translocation protein; cel 2e-35
2jlj_A_38-144107 (A:38-144) YSCU, YOP proteins translocation protei 6e-28
3bzy_B_83 (B:) ESCU; auto cleavage protein, flagella, intein 2e-23
2vt1_B_1-6868 (B:1-68) Surface presentation of antigens protein 2e-20
3c01_E_1-6262 (E:1-62) Surface presentation of antigens protein 2e-18
3bzy_A_54 (A:) ESCU; auto cleavage protein, flagella, intein 7e-15
2vt1_A_52 (A:) Surface presentation of antigens protein SPAS 2e-14
3c01_A_48 (A:) Surface presentation of antigens protein SPAS 6e-13
>3bzs_A (A:) ESCU; auto cleavage protein, intein, T3SS, TTSS, asparagine cyclization, membrane, membrane protein, protein transport; 1.48A {Escherichia coli} PDB: 3bzr_A 3bzp_A 3bzt_A 3c03_ALength = 137 Back     alignment and structure
 Score =  161 bits (409), Expect = 1e-40
 Identities = 42/133 (31%), Positives = 70/133 (52%)

Query: 221 KLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALR 280
              MSK E+K E K + GNP IK  ++ +        +     ++T+I+ +PTH A+ L 
Sbjct: 4   MASMSKDEVKREAKDTDGNPEIKGERRRLHSEIQSGSLANNIKKSTVIVKDPTHIAICLY 63

Query: 281 YIQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYK 340
           Y   E   P+++  G++  A ++ K+A  ++IP+ E+  LARSL+K +     I   F++
Sbjct: 64  YKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLYKNIHKGQYITEDFFE 123

Query: 341 AVAQLIYKIYHKK 353
            VAQLI       
Sbjct: 124 PVAQLIRIAIDLD 136


>2jli_A (A:) YSCU, YOP proteins translocation protein; cell membrane, transmembrane, protein transport, type III secretion system, plasmid, membrane; 1.13A {Yersinia pestis}Length = 123 Back     alignment and structure
>2jlj_A (A:38-144) YSCU, YOP proteins translocation protein U; cell membrane, transmembrane, yersinia pesits, protein transport, type III secretion system, plasmid; 1.3A {Yersinia pestis} PDB: 2jlh_A* 2v5g_A 2w0r_ALength = 107 Back     alignment and structure
>3bzy_B (B:) ESCU; auto cleavage protein, flagella, intein, T3SS, membrane, membrane protein, protein transport; 1.20A {Escherichia coli}Length = 83 Back     alignment and structure
>2vt1_B (B:1-68) Surface presentation of antigens protein SPAS; specificity switch, virulence, transmembrane, inner membrane, FLHB, YSCU, T3SS, plasmid; 2.0A {Shigella flexneri}Length = 68 Back     alignment and structure
>3c01_E (E:1-62) Surface presentation of antigens protein SPAS; auto cleavage protein, flagella, ESCU, YSCU, intein, T3SS, membrane, inner membrane; 2.60A {Salmonella typhimurium}Length = 62 Back     alignment and structure
>3bzy_A (A:) ESCU; auto cleavage protein, flagella, intein, T3SS, membrane, membrane protein, protein transport; 1.20A {Escherichia coli}Length = 54 Back     alignment and structure
>2vt1_A (A:) Surface presentation of antigens protein SPAS; specificity switch, virulence, transmembrane, inner membrane, FLHB, YSCU, T3SS, plasmid; 2.0A {Shigella flexneri}Length = 52 Back     alignment and structure
>3c01_A (A:) Surface presentation of antigens protein SPAS; auto cleavage protein, flagella, ESCU, YSCU, intein, T3SS, membrane, inner membrane; 2.60A {Salmonella typhimurium}Length = 48 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target354 flagellar biosynthesis protein FlhB [Candidatus Liberib
3bzs_A_137 ESCU; auto cleavage protein, intein, T3SS, TTSS, a 100.0
2jli_A_123 YSCU, YOP proteins translocation protein; cell mem 100.0
2jlj_A_38-144107 YSCU, YOP proteins translocation protein U; cell m 99.97
3bzy_B_83 ESCU; auto cleavage protein, flagella, intein, T3S 99.93
2vt1_B_1-6868 Surface presentation of antigens protein SPAS; spe 99.82
3c01_E_1-6262 Surface presentation of antigens protein SPAS; aut 99.76
3bzy_A_54 ESCU; auto cleavage protein, flagella, intein, T3S 99.68
3c01_A_48 Surface presentation of antigens protein SPAS; aut 99.6
2vt1_A_52 Surface presentation of antigens protein SPAS; spe 99.58
>3bzs_A (A:) ESCU; auto cleavage protein, intein, T3SS, TTSS, asparagine cyclization, membrane, membrane protein, protein transport; 1.48A {Escherichia coli} PDB: 3bzr_A 3bzp_A 3bzt_A 3c03_A Back     alignment and structure
Probab=100.00  E-value=0  Score=402.99  Aligned_cols=135  Identities=31%  Similarity=0.468  Sum_probs=133.3

Q ss_pred             HHHHCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCEEEEEEECCCCCCCCEEEEECCCH
Q ss_conf             98406998999999754489989999999999999998898607768699873553078889768888888899807658
Q gi|254780690|r  219 YSKLKMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRYIQTENDAPVLVAKGQNL  298 (354)
Q Consensus       219 ~k~lkMskqEvK~E~K~~EGdP~iK~~~r~~~re~~~~~~~~~V~~A~vvitNPTH~AVAL~Y~~~~~~aP~vvaKG~~~  298 (354)
                      .|+||||||||||||||+||||+||++||++|||+++++++.+|++|||||||||||||||+||+++++||+|+|||.|.
T Consensus         2 tk~lkMsk~EvK~E~K~~EGdP~iK~~rr~~~~e~~~~~~~~~v~~a~vvi~NPth~AVAL~Y~~~~~~aP~VvAkG~~~   81 (137)
T 3bzs_A            2 SHMASMSKDEVKREAKDTDGNPEIKGERRRLHSEIQSGSLANNIKKSTVIVKDPTHIAICLYYKLGETPLPLVIETGKDA   81 (137)
T ss_dssp             --------------------------------------CHHHHHHHCSEEEEETTTEEEEEECCTTTCSSCEEEEEEETH
T ss_pred             CCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCCCCCCEEEEEECCH
T ss_conf             72145798999999884439988999999999999972666411225189858976899999768888798799986778


Q ss_pred             HHHHHHHHHHHCCCCEEECHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             9999999999739978868899999997288989489899999999999997302
Q gi|254780690|r  299 IAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYKAVAQLIYKIYHKK  353 (354)
Q Consensus       299 ~A~~Ir~~A~~~~Vpive~~~LAR~Ly~~~~ig~~Ip~~~y~aVA~il~~v~~lk  353 (354)
                      +|.+|+++|++|||||++|+||||+||+++++|++||+++|++||+||+|||++|
T Consensus        82 ~A~~I~~~A~~~gVPiv~~~~LAr~Ly~~~~~g~~IP~ely~aVA~Il~~v~~l~  136 (137)
T 3bzs_A           82 KALQIIKLAELYDIPVIEDIPLARSLYKNIHKGQYITEDFFEPVAQLIRIAIDLD  136 (137)
T ss_dssp             HHHHHHHHHHHHTCCEEECHHHHHHHHHHSCTTCBCCGGGHHHHHHHHHHHC---
T ss_pred             HHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             7999999999859829988899999997488989179999999999999998623



>2jli_A (A:) YSCU, YOP proteins translocation protein; cell membrane, transmembrane, protein transport, type III secretion system, plasmid, membrane; 1.13A {Yersinia pestis} Back     alignment and structure
>2jlj_A (A:38-144) YSCU, YOP proteins translocation protein U; cell membrane, transmembrane, yersinia pesits, protein transport, type III secretion system, plasmid; 1.3A {Yersinia pestis} PDB: 2jlh_A* 2v5g_A 2w0r_A Back     alignment and structure
>3bzy_B (B:) ESCU; auto cleavage protein, flagella, intein, T3SS, membrane, membrane protein, protein transport; 1.20A {Escherichia coli} Back     alignment and structure
>2vt1_B (B:1-68) Surface presentation of antigens protein SPAS; specificity switch, virulence, transmembrane, inner membrane, FLHB, YSCU, T3SS, plasmid; 2.0A {Shigella flexneri} Back     alignment and structure
>3c01_E (E:1-62) Surface presentation of antigens protein SPAS; auto cleavage protein, flagella, ESCU, YSCU, intein, T3SS, membrane, inner membrane; 2.60A {Salmonella typhimurium} Back     alignment and structure
>3bzy_A (A:) ESCU; auto cleavage protein, flagella, intein, T3SS, membrane, membrane protein, protein transport; 1.20A {Escherichia coli} Back     alignment and structure
>3c01_A (A:) Surface presentation of antigens protein SPAS; auto cleavage protein, flagella, ESCU, YSCU, intein, T3SS, membrane, inner membrane; 2.60A {Salmonella typhimurium} Back     alignment and structure
>2vt1_A (A:) Surface presentation of antigens protein SPAS; specificity switch, virulence, transmembrane, inner membrane, FLHB, YSCU, T3SS, plasmid; 2.0A {Shigella flexneri} Back     alignment and structure