254780689

254780689

flagellar motor switch protein G

GeneID in NCBI database:8209693Locus tag:CLIBASIA_02880
Protein GI in NCBI database:254780689Protein Accession:YP_003065102.1
Gene range:-(578555, 579592)Protein Length:345aa
Gene description:flagellar motor switch protein G
COG prediction:none
KEGG prediction:fliG; flagellar motor switch protein G; K02410 flagellar motor switch protein FliG
SEED prediction:Flagellar motor switch protein FliG
Pathway involved in KEGG:Bacterial chemotaxis [PATH:las02030]
Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-----
MNKTTDTVSFKNLYKEISPVSLTQKDKATAILLAMEKQVSGKLLRHFTHAELKEIVASAKLLPEISPEELEDIIDEFESQFIAGIGLTENSKNIESILEEGLEQNELEKLLNKSDISQENNNSIWDHLKETDPGVIADFLSKEHPQTTAYVLSMMPPSIGASVLLRFPNKIHADIMKRTVNLPKISPYIQKTIEKCIVEMLPQSNSNTSTGPEKVANLINELEKPQVDKLLTSLQEVSKEAFDKVRPKVFLFDDLITLSSHDLSIVFNNISLEVLGKALHGTSIETQNAILHCLSNRQRKIIEENIVLNDSSIAPREVAMARRSIVQEAISLLKTNKIELSNPIK
cccccccccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccHHHHHHHHHHHHHcccccccHHHHHHHccHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccHHHHHHHHHHHHHHcHHHHHHHHHHcccHHHHHcccHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccEEcccccc
ccccccEHHHHHHHHcccccccccHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccHHHHHHHHHHHHcccccccccHHHHccccHHHHHHHHHHcccHHEEEEEEcccHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccEEEEcccc
mnkttdtvSFKNLykeispvsltqKDKATAILLAMEKQVSGKLLRHFTHAELKEIVASakllpeispeeLEDIIDEFESQFIAgigltensKNIESILEEGLEQNELEKLLnksdisqennNSIWDHlketdpgviadflskehpqttayvlsmmppsigasvllrfpnkiHADIMKRtvnlpkispYIQKTIEKCIVEmlpqsnsntstgpeKVANLINELEKPQVDKLLTSLQEVSKEAfdkvrpkvflfddlitlsshdlsIVFNNISLEVLGKALHGTSIETQNAILHCLSNRQRKiieenivlndssiapREVAMARRSIVQEAISLLKTNkielsnpik
mnkttdtvsfknlykeispvsltqKDKATAILLAMEKQVSGKLLRHFTHAELKEIVASAKLLPEISPEELEDIIDEFESQFIAGIGLTENSKNIESILEEGLEQNELEKLLNKSDISQENNNSIWDHLKETDPGVIADFLSKEHPQTTAYVLSMMPPSIGASVLLRFPNKIHADIMKrtvnlpkispYIQKTIEKCIVEMLpqsnsntstgPEKVANLINELEKPQVDKLLTSLQEVSkeafdkvrpkVFLFDDLITLSSHDLSIVFNNISLEVLGKALHGTSIETQNAILHCLSNRQRKIIeenivlndssiapREVAMARRSIVQEAISllktnkielsnpik
MNKTTDTVSFKNLYKEISPVSLTQKDKATAILLAMEKQVSGKLLRHFTHAELKEIVASAKLLPEISPEELEDIIDEFESQFIAGIGLTENSKNIESIleegleqnelekllnkSDISQENNNSIWDHLKETDPGVIADFLSKEHPQTTAYVLSMMPPSIGASVLLRFPNKIHADIMKRTVNLPKISPYIQKTIEKCIVEMLPQSNSNTSTGPEKVANLINELEKPQVDKLLTSLQEVSKEAFDKVRPKVFLFDDLITLSSHDLSIVFNNISLEVLGKALHGTSIETQNAILHCLSNRQRKIIEENIVLNDSSIAPREVAMARRSIVQEAISLLKTNKIELSNPIK
***************************ATAILLAMEKQVSGKLLRHFTHAELKEIVASAKLLPEISPEELEDIIDEFESQFIA*****E**KNIESILEEGLEQNELEKLLN**********SIWDHLKETDPGVIADFLSKEHPQTTAYVLSMMPPSIGASVLLRFPNKIHADIMKRTVNLPKISPYIQKTIEKC*******************ANLINELEKPQVDKLLTSLQEVSKEAFDKVRPKVFLFDDLITLSSHDLSIVFNNISLEVLGKALHGTSIETQNAILHCLSNRQR*******************AMARRSIVQEAISLLKTNKIELSN***
********SFKNLYKEISPVSLTQKDKATAILLAMEKQVSGKLLRHFTHAELKEIVASAKLLPEISPEELEDIIDEFESQFIAGIGLTENSKNIESILEEGLEQNELEKLLNKSDISQENNNSIWDHLKETDPGVIADFLSKEHPQTTAYVLSMMPPSIGASVLLRFPNKIHADIMKRTVNLPKISPYIQKTIEKCIVEMLPQSNSNTSTGPEKVANLINELEKPQVDKLLTSLQEVSKEAFDKVRPKVFLFDDLITLSSHDLSIVFNNISLEVLGKALHGTSIETQNAILHCLSNRQRKIIEENIVLNDSSIAPREVAMARRSIVQEAISLLKTNKIELSNPIK
***TTDTVSFKNLYKEISPVSLTQKDKATAILLAMEKQVSGKLLRHFTHAELKEIVASAKLLPEISPEELEDIIDEFESQFIAGIGLTENSKNIESILEEGLEQNELEKLLNKSDISQENNNSIWDHLKETDPGVIADFLSKEHPQTTAYVLSMMPPSIGASVLLRFPNKIHADIMKRTVNLPKISPYIQKTIEKCIVEMLPQSNSNTSTGPEKVANLINELEKPQVDKLLTSLQEVSKEAFDKVRPKVFLFDDLITLSSHDLSIVFNNISLEVLGKALHGTSIETQNAILHCLSNRQRKIIEENIVLNDSSIAPREVAMARRSIVQEAISLLKTNKIELSNPI*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKTTDTVSFKNLYKEISPVSLTQKDKATAILLAMEKQVSGKLLRHFTHAELKEIVASAKLLPEISPEELEDIIDEFESQFIAGIGLTENSKNIESILEEGLEQNELEKLLNKSDISQENNNSIWDHLKETDPGVIADFLSKEHPQTTAYVLSMMPPSIGASVLLRFPNKIHADIMKRTVNLPKISPYIQKTIEKCIVEMLPQSNSNTSTGPEKVANLINELEKPQVDKLLTSLQEVSKEAFDKVRPKVFLFDDLITLSSHDLSIVFNNISLEVLGKALHGTSIETQNAILHCLSNRQRKIIEENIVLNDSSIAPREVAMARRSIVQEAISLLKTNKIELSNPIK
MNKTTDTVSFKNLYKEISPVSLTQKDKATAILLAMEKQVSGKLLRHFTHAELKEIVASAKLLPEISPEELEDIIDEFESQFIAGIGLTENSKNIESILEEGLEQNELEKLLNKSDISQENNNSIWDHLKETDPGVIADFLSKEHPQTTAYVLSMMPPSIGASVLLRFPNKIHADIMKRTVNLPKISPYIQKTIEKCIVEMLPQSNSNTSTGPEKVANLINELEKPQVDKLLTSLQEVSKEAFDKVRPKVFLFDDLITLSSHDLSIVFNNISLEVLGKALHGTSIETQNAILHCLSNRQRKIIEENIVLNDSSIAPREVAMARRSIVQEAISLLKTNKIELSNPIK
MNKTTDTVSFKNLYKEISPVSLTQKDKATAILLAMEKQVSGKLLRHFTHAELKEIVASAKLLPEISPEELEDIIDEFESQFIAGIGLTENSKNIESILEEGLEQNELEKLLNKSDISQENNNSIWDHLKETDPGVIADFLSKEHPQTTAYVLSMMPPSIGASVLLRFPNKIHADIMKRTVNLPKISPYIQKTIEKCIVEMLPQSNSNTSTGPEKVANLINELEKPQVDKLLTSLQEVSKEAFDKVRPKVFLFDDLITLSSHDLSIVFNNISLEVLGKALHGTSIETQNAILHCLSNRQRKIIEENIVLNDSSIAPREVAMARRSIVQEAISLLKTNKIELSNPIK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target345 flagellar motor switch protein G [Candidatus Liberibact
315121856350 flagellar motor switch protein G [Candidatus Liberibact 1 1e-158
190890353346 flagellar motor switch protein [Rhizobium etli CIAT 652 1 1e-83
86356302346 flagellar motor switch protein G [Rhizobium etli CFN 42 1 5e-83
222147561347 flagellar motor switch protein G [Agrobacterium vitis S 1 7e-83
218672784346 flagellar motor switch protein G [Rhizobium etli GR56] 1 2e-82
116250472345 flagellar motor switch protein G [Rhizobium leguminosar 1 1e-81
241203096346 flagellar motor switch protein G [Rhizobium leguminosar 1 1e-81
218515301351 flagellar motor switch protein G [Rhizobium etli 8C-3] 1 2e-81
209547918346 flagellar motor switch protein G [Rhizobium leguminosar 1 3e-81
218663131351 flagellar motor switch protein G [Rhizobium etli IE4771 1 3e-81
>gi|315121856|ref|YP_004062345.1| flagellar motor switch protein G [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 350 Back     alignment and organism information
 Score =  560 bits (1444), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 280/345 (81%), Positives = 312/345 (90%), Gaps = 1/345 (0%)

Query: 1   MNKTTDTVSFKNLYKEISPVSLTQKDKATAILLAMEKQVSGKLLRHFTHAELKEIVASAK 60
           M+K  DTVSF N YKEIS + LTQKDKATAILLAMEK+VSGKLL++FTHAEL+EIV+SA+
Sbjct: 1   MSKKEDTVSFGNFYKEISHMPLTQKDKATAILLAMEKKVSGKLLKYFTHAELREIVSSAQ 60

Query: 61  LLPEISPEELEDIIDEFESQFIAGIGLTENSKNIESILEEGLEQNELEKLLNKSDISQEN 120
           LLPEISPEELEDIIDEFESQFIAGIGLTENSKNIES+LEEGL QN L++LLN+S+  QE 
Sbjct: 61  LLPEISPEELEDIIDEFESQFIAGIGLTENSKNIESLLEEGLGQNTLDQLLNRSNALQEY 120

Query: 121 NNSIWDHLKETDPGVIADFLSKEHPQTTAYVLSMMPPSIGASVLLRFPNKIHADIMKRTV 180
           +NS+W++ KE DP  IADFL KEHPQTTAY+LSM+PPSIGASVLLRFPNKIHADIMKRTV
Sbjct: 121 DNSVWENFKEVDPTAIADFLLKEHPQTTAYILSMIPPSIGASVLLRFPNKIHADIMKRTV 180

Query: 181 NLPKISPYIQKTIEKCIVEMLPQSNSNTST-GPEKVANLINELEKPQVDKLLTSLQEVSK 239
           NL KI+PY+Q+TIEKCIVEML Q    TST GPEKVANLINELEKPQVDKLLTSL+E+SK
Sbjct: 181 NLQKINPYMQETIEKCIVEMLSQLKLTTSTSGPEKVANLINELEKPQVDKLLTSLEEISK 240

Query: 240 EAFDKVRPKVFLFDDLITLSSHDLSIVFNNISLEVLGKALHGTSIETQNAILHCLSNRQR 299
           EAFDKVRPKVFLF+DLITLSS DLSI+FN ISLE+LGKAL+GTS+E +N IL+CLS RQR
Sbjct: 241 EAFDKVRPKVFLFEDLITLSSRDLSIIFNTISLEILGKALYGTSMEIRNQILNCLSVRQR 300

Query: 300 KIIEENIVLNDSSIAPREVAMARRSIVQEAISLLKTNKIELSNPI 344
           KIIEENI LNDS +APREVA ARRSIVQEAISLLKTNKIEL  PI
Sbjct: 301 KIIEENISLNDSPLAPREVAFARRSIVQEAISLLKTNKIELEEPI 345


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190890353|ref|YP_001976895.1| flagellar motor switch protein [Rhizobium etli CIAT 652] Length = 346 Back     alignment and organism information
>gi|86356302|ref|YP_468194.1| flagellar motor switch protein G [Rhizobium etli CFN 42] Length = 346 Back     alignment and organism information
>gi|222147561|ref|YP_002548518.1| flagellar motor switch protein G [Agrobacterium vitis S4] Length = 347 Back     alignment and organism information
>gi|218672784|ref|ZP_03522453.1| flagellar motor switch protein G [Rhizobium etli GR56] Length = 346 Back     alignment and organism information
>gi|116250472|ref|YP_766310.1| flagellar motor switch protein G [Rhizobium leguminosarum bv. viciae 3841] Length = 345 Back     alignment and organism information
>gi|241203096|ref|YP_002974192.1| flagellar motor switch protein G [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 346 Back     alignment and organism information
>gi|218515301|ref|ZP_03512141.1| flagellar motor switch protein G [Rhizobium etli 8C-3] Length = 351 Back     alignment and organism information
>gi|209547918|ref|YP_002279835.1| flagellar motor switch protein G [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 346 Back     alignment and organism information
>gi|218663131|ref|ZP_03519061.1| flagellar motor switch protein G [Rhizobium etli IE4771] Length = 351 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target345 flagellar motor switch protein G [Candidatus Liberibact
PRK05686339 PRK05686, fliG, flagellar motor switch protein G; Valid 3e-83
TIGR00207338 TIGR00207, fliG, flagellar motor switch protein FliG 4e-28
PRK07194334 PRK07194, fliG, flagellar motor switch protein G; Revie 4e-21
COG1536339 COG1536, FliG, Flagellar motor switch protein [Cell mot 7e-48
pfam01706110 pfam01706, FliG_C, FliG C-terminal domain 4e-13
>gnl|CDD|180201 PRK05686, fliG, flagellar motor switch protein G; Validated Back     alignment and domain information
>gnl|CDD|161765 TIGR00207, fliG, flagellar motor switch protein FliG Back     alignment and domain information
>gnl|CDD|180874 PRK07194, fliG, flagellar motor switch protein G; Reviewed Back     alignment and domain information
>gnl|CDD|31725 COG1536, FliG, Flagellar motor switch protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|145059 pfam01706, FliG_C, FliG C-terminal domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 345 flagellar motor switch protein G [Candidatus Liberibact
PRK05686337 fliG flagellar motor switch protein G; Validated 100.0
TIGR00207346 fliG flagellar motor switch protein FliG; InterPro: IPR 100.0
PRK07194334 fliG flagellar motor switch protein G; Reviewed 100.0
COG1536339 FliG Flagellar motor switch protein [Cell motility and 100.0
pfam01706110 FliG_C FliG C-terminal domain. FliG is a component of t 99.96
PRK07194334 fliG flagellar motor switch protein G; Reviewed 99.16
PRK05686337 fliG flagellar motor switch protein G; Validated 99.11
TIGR00207346 fliG flagellar motor switch protein FliG; InterPro: IPR 98.05
COG1536339 FliG Flagellar motor switch protein [Cell motility and 98.77
PRK05934341 type III secretion system protein; Validated 97.81
pfam03448102 MgtE_N MgtE intracellular N domain. This domain is foun 97.33
COG3334192 Uncharacterized conserved protein [Function unknown] 96.38
COG3334192 Uncharacterized conserved protein [Function unknown] 91.23
pfam03448102 MgtE_N MgtE intracellular N domain. This domain is foun 96.88
COG2239451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [I 96.58
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [I 94.7
>PRK05686 fliG flagellar motor switch protein G; Validated Back     alignment and domain information
>TIGR00207 fliG flagellar motor switch protein FliG; InterPro: IPR000090 The flagellar motor switch in Escherichia coli and Salmonella typhimurium regulates the direction of flagellar rotation and hence controls swimming behaviour Back     alignment and domain information
>PRK07194 fliG flagellar motor switch protein G; Reviewed Back     alignment and domain information
>COG1536 FliG Flagellar motor switch protein [Cell motility and secretion] Back     alignment and domain information
>pfam01706 FliG_C FliG C-terminal domain Back     alignment and domain information
>PRK07194 fliG flagellar motor switch protein G; Reviewed Back     alignment and domain information
>PRK05686 fliG flagellar motor switch protein G; Validated Back     alignment and domain information
>TIGR00207 fliG flagellar motor switch protein FliG; InterPro: IPR000090 The flagellar motor switch in Escherichia coli and Salmonella typhimurium regulates the direction of flagellar rotation and hence controls swimming behaviour Back     alignment and domain information
>COG1536 FliG Flagellar motor switch protein [Cell motility and secretion] Back     alignment and domain information
>PRK05934 type III secretion system protein; Validated Back     alignment and domain information
>pfam03448 MgtE_N MgtE intracellular N domain Back     alignment and domain information
>COG3334 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3334 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam03448 MgtE_N MgtE intracellular N domain Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target345 flagellar motor switch protein G [Candidatus Liberibact
1lkv_X232 Crystal Structure Of The Middle And C-Terminal Doma 6e-58
3ajc_A229 Structure Of The Mc Domain Of Flig (Pev), A Cw-Bias 6e-55
3hjl_A329 The Structure Of Full-Length Flig From Aquifex Aeol 3e-54
1qc7_A101 T. Maritima Flig C-Terminal Domain Length = 101 5e-23
>gi|22219246|pdb|1LKV|X Chain X, Crystal Structure Of The Middle And C-Terminal Domains Of The Flagellar Rotor Protein Flig Length = 232 Back     alignment and structure
 Score =  229 bits (583), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 55/227 (24%), Positives = 112/227 (49%), Gaps = 4/227 (1%)

Query: 121 NNSIWDHLKETDPGVIADFLSKEHPQTTAYVLSMMPPSIGASVLLRFPNKIHADIMKRTV 180
               +  +++TDP  + +FL  EHPQT A VLS + P + A +L   P ++  +++KR  
Sbjct: 1   QVKPFSFVRDTDPVQLVNFLQSEHPQTIAVVLSYLDPPVAAQILGALPEELQTEVLKRIA 60

Query: 181 NLPKISPYIQKTIEKCIVEMLPQSNSN---TSTGPEKVANLINELEKPQVDKLLTSLQEV 237
            L + SP + K IE+ + + +    S       G +  A ++N L++    K++  L + 
Sbjct: 61  LLERTSPEVVKEIERNLEKKISGFVSRTFSKVGGIDTAAEIMNNLDRTTEKKIMDKLVQE 120

Query: 238 SKEAFDKVRPKVFLFDDLITLSSHDLSIVFNNISLEVLGKALHGTSIETQNAILHCLSNR 297
           + E  D++R ++F+F+D++ L    + +V   +    L  AL G S E +  I   +S R
Sbjct: 121 NPELADEIRRRMFVFEDILKLDDRSIQLVLREVDTRDLALALKGASDELKEKIFKNMSKR 180

Query: 298 QRKIIEENIVLNDSSIAPREVAMARRSIVQEAISLLKTNKIELSNPI 344
              ++++ +      +  ++V  A++ I+     L +  +I ++   
Sbjct: 181 AAALLKDELEYM-GPVRLKDVEEAQQKIINIIRRLEEAGEIVIARGG 226


>gi|332639544|pdb|3AJC|A Chain A, Structure Of The Mc Domain Of Flig (Pev), A Cw-Biased Mutant Length = 229 Back     alignment and structure
>gi|302148706|pdb|3HJL|A Chain A, The Structure Of Full-Length Flig From Aquifex Aeolicus Length = 329 Back     alignment and structure
>gi|5822234|pdb|1QC7|A Chain A, T. Maritima Flig C-Terminal Domain Length = 101 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target345 flagellar motor switch protein G [Candidatus Liberibact
3hjl_A329 Flagellar motor switch protein FLIG; armadillo repeat m 3e-49
1lkv_X232 Flagellar motor switch protein FLIG; chemotaxis, flagel 6e-21
1qc7_A101 Protein (FLIG); flagellar motor switch protein, structu 5e-13
>3hjl_A Flagellar motor switch protein FLIG; armadillo repeat motif, superhelix, conformational plasticit repeat, torque generation; 2.40A {Aquifex aeolicus} Length = 329 Back     alignment and structure
 Score =  190 bits (484), Expect = 3e-49
 Identities = 73/325 (22%), Positives = 150/325 (46%), Gaps = 6/325 (1%)

Query: 21  SLTQKDKATAILLAMEKQVSGKLLRHFTHAELKEIVASAKLLPEISPEELEDIIDEFESQ 80
           +L++  KA  +LL++ ++VS  +++  +  EL+++ A AK L  +  EE+E+I +E   +
Sbjct: 8   ALSKAQKAAVLLLSLPEEVSMNIVKELSEEELQKLFALAKDLESVPEEEIENIAEELLDE 67

Query: 81  FIAGIGLTENSKNIESILEEGLEQNELEKLLNKSDISQENNNSIWDHLKETDPGVIADFL 140
                   +  +     +++ +     EK      +   +   I   +++ D  ++A  L
Sbjct: 68  IKKAGIKIKKPEEFIENIKKVIPPTLAEKFRGI--LELGDAEKILKEIEKVDSRILASLL 125

Query: 141 SKEHPQTTAYVLSMMPPSIGASVLLRFPNKIHADIMKRTVNLPKISPYIQKTIEKCIVE- 199
             EHPQT A  LS + P   A ++   P ++  +++KR   L  ++    K + + ++E 
Sbjct: 126 KNEHPQTIALFLSQLSPKKSAEIIQNLPEELKKEVVKRIATLENVNVQYVKELAQILLEE 185

Query: 200 --MLPQSNSNTSTGPEKVANLINELEKPQVDKLLTSLQEVSKEAFDKVRPKVFLFDDLIT 257
              L    +    G    A L+N L+K   + +L S+ +      +++R K+F F+D+  
Sbjct: 186 ISSLGAKEALKLEGTAVAAELLNTLDKETRELILQSIGQEDPLLEERIREKMFTFEDIRK 245

Query: 258 LSSHDLSIVFNNISLEVLGKALHGTSIETQNAILHCLSNRQRKIIEENIVLNDSSIAPRE 317
           LS  D+  +   +    L  AL G   + +   L  +S R  K+  E++      +   E
Sbjct: 246 LSDRDIIEILKVVDKNTLMIALLGAPEDIKQKFLSNMSKRAAKLFLEDME-ALGPVKKSE 304

Query: 318 VAMARRSIVQEAISLLKTNKIELSN 342
           +  A+R +V     ++   KIE+ +
Sbjct: 305 IEKAQRQVVNIIRKMIDEGKIEIGD 329


>1lkv_X Flagellar motor switch protein FLIG; chemotaxis, flagellar motion, structural protein; 2.80A {Thermotoga maritima} SCOP: a.118.14.1 Length = 232 Back     alignment and structure
>1qc7_A Protein (FLIG); flagellar motor switch protein, structural protein; 2.20A {Thermotoga maritima} SCOP: a.118.14.1 Length = 101 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target345 flagellar motor switch protein G [Candidatus Liberibact
3hjl_A329 Flagellar motor switch protein FLIG; armadillo repeat m 100.0
1lkv_X232 Flagellar motor switch protein FLIG; chemotaxis, flagel 100.0
1qc7_A101 Protein (FLIG); flagellar motor switch protein, structu 99.93
3hjl_A329 Flagellar motor switch protein FLIG; armadillo repeat m 99.1
1lkv_X232 Flagellar motor switch protein FLIG; chemotaxis, flagel 98.5
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal transpor 97.97
2oux_A286 Magnesium transporter; 10001B, structural genomics, PSI 96.76
1qc7_A101 Protein (FLIG); flagellar motor switch protein, structu 93.56
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, transpor 97.84
2oux_A286 Magnesium transporter; 10001B, structural genomics, PSI 97.65
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, transpor 97.47
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal transpor 97.27
2gtq_A867 Aminopeptidase N; alanine aminopeptidase, M1 family pep 93.57
>3hjl_A Flagellar motor switch protein FLIG; armadillo repeat motif, superhelix, conformational plasticit repeat, torque generation; 2.40A {Aquifex aeolicus} Back     alignment and structure
Probab=100.00  E-value=0  Score=602.02  Aligned_cols=321  Identities=22%  Similarity=0.379  Sum_probs=303.8

Q ss_pred             HHHCCHHHHHHHHHHHHCCHHHHHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHH
Q ss_conf             22368687999999983814689998519999999999998613899989999999999999851045665348899997
Q gi|254780689|r   19 PVSLTQKDKATAILLAMEKQVSGKLLRHFTHAELKEIVASAKLLPEISPEELEDIIDEFESQFIAGIGLTENSKNIESIL   98 (345)
Q Consensus        19 p~~Ltg~eKAAilLl~LGee~Aa~ilk~l~~~Ei~~i~~~m~~l~~i~~~~~~~vl~EF~~~~~~~~~~~g~~~~~~~lL   98 (345)
                      +..|||+||||+||++||++.|++||+||+++||++|+.+|++++.|++++++.|++||++.+..+++..+++..+.++|
T Consensus         6 ~~~Lsg~qKAAilLl~LGee~Aa~vlk~L~~~Ei~~l~~~m~~l~~v~~~~~~~Vl~eF~~~~~~~~~~~~~~~~~~~~L   85 (329)
T 3hjl_A            6 KSALSKAQKAAVLLLSLPEEVSMNIVKELSEEELQKLFALAKDLESVPEEEIENIAEELLDEIKKAGIKIKKPEEFIENI   85 (329)
T ss_dssp             CHHHHHHHHHHHHHHHSCHHHHHHHHHHSCHHHHHHHHHHHHTCCCCCHHHHHHHHHHHHHHHHHTTCCCSCHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHCCHHHHHHHHCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             23138898999999997927799998679999999999999714899999999999999999998763125789999999


Q ss_pred             HHCCCHHHHHHHHHHHHCCCCCCCCHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             61149799999975441134456756789741998999999840386478899995788899999983798999999999
Q gi|254780689|r   99 EEGLEQNELEKLLNKSDISQENNNSIWDHLKETDPGVIADFLSKEHPQTTAYVLSMMPPSIGASVLLRFPNKIHADIMKR  178 (345)
Q Consensus        99 ~~al~~d~a~~ll~~~~~~~~~~~~~~~~L~~~~~~~La~~L~~EhPQtiAlILs~L~~~~Aa~VL~~Lp~e~r~ev~~R  178 (345)
                      ++++|+++++.+++.+.  .....++|++|+|++|++|++||++|||||||+|||||+|++||+||..||+++|.+|++|
T Consensus        86 ~~~l~~~~a~~il~~i~--~~~~~~~~~~L~~~~~~~La~~L~~EhPQtiAliLs~L~~~~AA~VL~~Lp~~~r~eVv~R  163 (329)
T 3hjl_A           86 KKVIPPTLAEKFRGILE--LGDAEKILKEIEKVDSRILASLLKNEHPQTIALFLSQLSPKKSAEIIQNLPEELKKEVVKR  163 (329)
T ss_dssp             HHHSCCCHHHHHHHHHH--HHHHHHHHHHHHTSCHHHHHHHHTTSCHHHHHHHHTTSCHHHHHHHHHTSCHHHHHHHHHH
T ss_pred             HHHHCHHHHHHHHHHHH--CCCCCCHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHH
T ss_conf             98608778999999873--4563457899874998999999874781599999993899999999986999889999999


Q ss_pred             HHHCCCCCHHHHHHHHHHHHHHHCC---CCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHH
Q ss_conf             8404899989999999999997223---4421236378999995017757799999999986599999999741578998
Q gi|254780689|r  179 TVNLPKISPYIQKTIEKCIVEMLPQ---SNSNTSTGPEKVANLINELEKPQVDKLLTSLQEVSKEAFDKVRPKVFLFDDL  255 (345)
Q Consensus       179 ia~l~~v~~ev~~~ie~~L~~~l~~---~~~~~~~G~~~vA~Iln~l~~~~~~~iL~~L~~~d~~la~~Ir~~mF~FeDl  255 (345)
                      ||+++.++|+++++|+++|.+++..   ......||++.+|+|||+++++.++++|+.|+++||+++++||++||+||||
T Consensus       164 ia~l~~v~~~~v~~le~~L~~~l~~~~~~~~~~~~G~~~~A~ILn~~~~~~~~~il~~l~~~d~~la~~Ir~~mF~Fedl  243 (329)
T 3hjl_A          164 IATLENVNVQYVKELAQILLEEISSLGAKEALKLEGTAVAAELLNTLDKETRELILQSIGQEDPLLEERIREKMFTFEDI  243 (329)
T ss_dssp             HHHCSCCCHHHHHHHHHHHHHHHHHHHHHHSCCCCHHHHHHHHHHHSCHHHHHHHHHHHHHHCHHHHHHHHHHHSCGGGG
T ss_pred             HHCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHCHHHHHHHHHHCCCHHHH
T ss_conf             97447999999999999999887301210011244089999998537778899999999862899999999862388878


Q ss_pred             HCCCHHHHHHHHHCCCHHHHHHHHCCCCHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             50997899999830988899998538898999999961008999999999850058999899999999999999999986
Q gi|254780689|r  256 ITLSSHDLSIVFNNISLEVLGKALHGTSIETQNAILHCLSNRQRKIIEENIVLNDSSIAPREVAMARRSIVQEAISLLKT  335 (345)
Q Consensus       256 ~~l~~~~l~~ll~evd~~~l~~ALkga~~e~~e~il~nmS~Ra~~~l~eel~~~~g~v~~~dve~Aq~~I~~~~r~L~~~  335 (345)
                      .+++++++|++|++|+.++|++||||++++++++||+|||+|+++|+++||+.+ |||+.+||++||++|++++|+|+++
T Consensus       244 ~~l~~~~l~~ll~~v~~~~l~~ALkga~~e~~~~il~nms~R~a~~l~~el~~~-gpv~~~~ve~Aq~~i~~~~r~L~~~  322 (329)
T 3hjl_A          244 RKLSDRDIIEILKVVDKNTLMIALLGAPEDIKQKFLSNMSKRAAKLFLEDMEAL-GPVKKSEIEKAQRQVVNIIRKMIDE  322 (329)
T ss_dssp             GGSCHHHHHHHHTTSCHHHHHHHHHTSCHHHHHHHHTTSCHHHHHHHHHHHHHT-CSCCHHHHHHHHHHHHHHHHHHHTS
T ss_pred             HCCCHHHHHHHHHCCCHHHHHHHHCCCCHHHHHHHHHHHCHHHHHHHHHHHHHC-CCCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             427988999998729988999987679999999999875799999999999854-9988999999999999999999988


Q ss_pred             CCEECCC
Q ss_conf             9795188
Q gi|254780689|r  336 NKIELSN  342 (345)
Q Consensus       336 G~I~l~~  342 (345)
                      |+|+|++
T Consensus       323 G~I~l~~  329 (329)
T 3hjl_A          323 GKIEIGD  329 (329)
T ss_dssp             SSCC---
T ss_pred             CCEECCC
T ss_conf             8965089



>1lkv_X Flagellar motor switch protein FLIG; chemotaxis, flagellar motion, structural protein; 2.80A {Thermotoga maritima} SCOP: a.118.14.1 Back     alignment and structure
>1qc7_A Protein (FLIG); flagellar motor switch protein, structural protein; 2.20A {Thermotoga maritima} SCOP: a.118.14.1 Back     alignment and structure
>3hjl_A Flagellar motor switch protein FLIG; armadillo repeat motif, superhelix, conformational plasticit repeat, torque generation; 2.40A {Aquifex aeolicus} Back     alignment and structure
>1lkv_X Flagellar motor switch protein FLIG; chemotaxis, flagellar motion, structural protein; 2.80A {Thermotoga maritima} SCOP: a.118.14.1 Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus HB8} PDB: 2yvx_A Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, protein structure initiative, nysgxrc; 2.16A {Enterococcus faecalis V583} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>1qc7_A Protein (FLIG); flagellar motor switch protein, structural protein; 2.20A {Thermotoga maritima} SCOP: a.118.14.1 Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus HB8} PDB: 2yvz_A Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, protein structure initiative, nysgxrc; 2.16A {Enterococcus faecalis V583} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus HB8} PDB: 2yvz_A Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus HB8} PDB: 2yvx_A Back     alignment and structure
>2gtq_A Aminopeptidase N; alanine aminopeptidase, M1 family peptidases, MCSG, PSI-2, structural genomics, protein structure initiative; 2.05A {Neisseria meningitidis MC58} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 345 flagellar motor switch protein G [Candidatus Liberibact
d1lkvx_213 a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336] 4e-20
d1qc7a_101 a.118.14.1 (A:) FliG {Thermotoga maritima [TaxId: 2336] 5e-13
>d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]} Length = 213 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: FliG
family: FliG
domain: FliG
species: Thermotoga maritima [TaxId: 2336]
 Score = 92.5 bits (229), Expect = 4e-20
 Identities = 53/213 (24%), Positives = 106/213 (49%), Gaps = 4/213 (1%)

Query: 132 DPGVIADFLSKEHPQTTAYVLSMMPPSIGASVLLRFPNKIHADIMKRTVNLPKISPYIQK 191
           DP  + +FL  EHPQT A VLS + P + A +L   P ++  +++KR   L + SP + K
Sbjct: 1   DPVQLVNFLQSEHPQTIAVVLSYLDPPVAAQILGALPEELQTEVLKRIALLERTSPEVVK 60

Query: 192 TIEKCIVEM---LPQSNSNTSTGPEKVANLINELEKPQVDKLLTSLQEVSKEAFDKVRPK 248
            IE+ + +          +   G +  A ++N L++    K++  L + + E  D++R +
Sbjct: 61  EIERNLEKKISGFVSRTFSKVGGIDTAAEIMNNLDRTTEKKIMDKLVQENPELADEIRRR 120

Query: 249 VFLFDDLITLSSHDLSIVFNNISLEVLGKALHGTSIETQNAILHCLSNRQRKIIEENIVL 308
           +F+F+D++ L    + +V   +    L  AL G S E +  I   +S R   ++++ +  
Sbjct: 121 MFVFEDILKLDDRSIQLVLREVDTRDLALALKGASDELKEKIFKNMSKRAAALLKDELEY 180

Query: 309 NDSSIAPREVAMARRSIVQEAISLLKTNKIELS 341
               +  ++V  A++ I+     L +  +I ++
Sbjct: 181 M-GPVRLKDVEEAQQKIINIIRRLEEAGEIVIA 212


>d1qc7a_ a.118.14.1 (A:) FliG {Thermotoga maritima [TaxId: 2336]} Length = 101 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target345 flagellar motor switch protein G [Candidatus Liberibact
d1lkvx_213 FliG {Thermotoga maritima [TaxId: 2336]} 100.0
d1qc7a_101 FliG {Thermotoga maritima [TaxId: 2336]} 99.93
d1lkvx_213 FliG {Thermotoga maritima [TaxId: 2336]} 98.77
d2ouxa1130 Magnesium transporter MgtE {Enterococcus faecalis [TaxI 97.8
d2yvxa1125 Magnesium transporter MgtE {Thermus thermophilus [TaxId 97.16
d2ouxa1130 Magnesium transporter MgtE {Enterococcus faecalis [TaxI 96.68
d2yvxa1125 Magnesium transporter MgtE {Thermus thermophilus [TaxId 96.19
>d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: FliG
family: FliG
domain: FliG
species: Thermotoga maritima [TaxId: 2336]
Probab=100.00  E-value=1.8e-39  Score=277.69  Aligned_cols=209  Identities=25%  Similarity=0.478  Sum_probs=200.6

Q ss_pred             CHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCC---CCCC
Q ss_conf             9899999984038647889999578889999998379899999999984048999899999999999972234---4212
Q gi|254780689|r  132 DPGVIADFLSKEHPQTTAYVLSMMPPSIGASVLLRFPNKIHADIMKRTVNLPKISPYIQKTIEKCIVEMLPQS---NSNT  208 (345)
Q Consensus       132 ~~~~La~~L~~EhPQtiAlILs~L~~~~Aa~VL~~Lp~e~r~ev~~Ria~l~~v~~ev~~~ie~~L~~~l~~~---~~~~  208 (345)
                      ||++|++||++||||++|+||+||+|++||+||..||++.|.+|+.+|+.++.++++.+..++..+...+.+.   ....
T Consensus         1 dp~~la~~l~~e~p~~~A~iL~~L~~d~aa~vL~~L~~~~~~~il~~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~   80 (213)
T d1lkvx_           1 DPVQLVNFLQSEHPQTIAVVLSYLDPPVAAQILGALPEELQTEVLKRIALLERTSPEVVKEIERNLEKKISGFVSRTFSK   80 (213)
T ss_dssp             CCTHHHHHHHTSCHHHHHHHHTTSCHHHHHHHHHHSCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHSS
T ss_pred             CHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHC
T ss_conf             98999999980699999999972998899999996999999999996050023365999998888874415522010001


Q ss_pred             CCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHCCCHHHHHHHHHCCCHHHHHHHHCCCCHHHHH
Q ss_conf             36378999995017757799999999986599999999741578998509978999998309888999985388989999
Q gi|254780689|r  209 STGPEKVANLINELEKPQVDKLLTSLQEVSKEAFDKVRPKVFLFDDLITLSSHDLSIVFNNISLEVLGKALHGTSIETQN  288 (345)
Q Consensus       209 ~~G~~~vA~Iln~l~~~~~~~iL~~L~~~d~~la~~Ir~~mF~FeDl~~l~~~~l~~ll~evd~~~l~~ALkga~~e~~e  288 (345)
                      .+|.+.+++|||++++..++.++.++...||+++..++++||.|+||.++....++.+++++..+.++.|++|++.+.+.
T Consensus        81 ~~~~~~v~~il~~~~~~~~~~~l~~l~~~~~~~~~~i~~~l~~f~dl~~l~~~~~~~~l~~i~~~~~~~a~~~~~~e~~~  160 (213)
T d1lkvx_          81 VGGIDTAAEIMNNLDRTTEKKIMDKLVQENPELADEIRRRMFVFEDILKLDDRSIQLVLREVDTRDLALALKGASDELKE  160 (213)
T ss_dssp             CCCHHHHHHHHHTSCHHHHHHHHHHHHHHCHHHHHHHHHHHCCGGGGGGSCHHHHHHHHTTSCHHHHHHHHTTCCHHHHH
T ss_pred             CHHHHHHHHHHHHCCCCCCHHHEEEEEECCHHHHHHHHHHCCCCCCHHHHCCCCHHHHHHHHHHHHHEEEHHCCCHHHHH
T ss_conf             30899999999750122100020000221733313476401562018997203076778773100012100038999999


Q ss_pred             HHHHHCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCEECC
Q ss_conf             99961008999999999850058999899999999999999999986979518
Q gi|254780689|r  289 AILHCLSNRQRKIIEENIVLNDSSIAPREVAMARRSIVQEAISLLKTNKIELS  341 (345)
Q Consensus       289 ~il~nmS~Ra~~~l~eel~~~~g~v~~~dve~Aq~~I~~~~r~L~~~G~I~l~  341 (345)
                      +||+|||.|++.++.+++..+ |+|+.+||++||++|++.+|+|+++|+|+|.
T Consensus       161 ~~l~~~~~~~~~vv~~e~~~~-G~I~~~Die~A~~~i~~~~~~l~~~G~i~l~  212 (213)
T d1lkvx_         161 KIFKNMSKRAAALLKDELEYM-GPVRLKDVEEAQQKIINIIRRLEEAGEIVIA  212 (213)
T ss_dssp             HHHTTSCHHHHHHHHHHHHSC-CCCCHHHHHHHHHHHHHHHHHHHHTTSSCCC
T ss_pred             HHHHHCCHHHHHHHHHHHHHC-CCCCHHHHHHHHHHHHHHHHHHHHCCCEEEC
T ss_conf             999969998989998753415-9974999999999999999999868977740



>d1qc7a_ a.118.14.1 (A:) FliG {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ouxa1 a.118.26.1 (A:6-135) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2yvxa1 a.118.26.1 (A:7-131) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ouxa1 a.118.26.1 (A:6-135) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2yvxa1 a.118.26.1 (A:7-131) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 345 flagellar motor switch protein G [Candidatus Liber
1qc7_A_101 (A:) Protein (FLIG); flagellar motor switch protei 3e-13
1lkv_X_138-23295 (X:138-232) Flagellar motor switch protein FLIG; c 2e-10
1lkv_X_1-6565 (X:1-65) Flagellar motor switch protein FLIG; chem 8e-13
2zy9_A_1-158158 (A:1-158) Mg2+ transporter MGTE; membrane protien, 5e-10
>1qc7_A (A:) Protein (FLIG); flagellar motor switch protein, structural protein; 2.20A {Thermotoga maritima}Length = 101 Back     alignment and structure
 Score = 70.5 bits (173), Expect = 3e-13
 Identities = 19/92 (20%), Positives = 43/92 (46%), Gaps = 1/92 (1%)

Query: 250 FLFDDLITLSSHDLSIVFNNISLEVLGKALHGTSIETQNAILHCLSNRQRKIIEENIVLN 309
           F+F+D++ L    + +V   +    L  AL G S E +  I   +S R   ++++ +   
Sbjct: 2   FVFEDILKLDDRSIQLVLREVDTRDLALALKGASDELKEKIFKNMSKRAAALLKDELEYM 61

Query: 310 DSSIAPREVAMARRSIVQEAISLLKTNKIELS 341
              +  ++V  A++ I+     L +  +I ++
Sbjct: 62  -GPVRLKDVEEAQQKIINIIRRLEEAGEIVIA 92


>1lkv_X (X:138-232) Flagellar motor switch protein FLIG; chemotaxis, flagellar motion, structural protein; 2.80A {Thermotoga maritima}Length = 95 Back     alignment and structure
>1lkv_X (X:1-65) Flagellar motor switch protein FLIG; chemotaxis, flagellar motion, structural protein; 2.80A {Thermotoga maritima}Length = 65 Back     alignment and structure
>2zy9_A (A:1-158) Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus HB8} PDB: 2yvx_ALength = 158 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target345 flagellar motor switch protein G [Candidatus Liberibact
1qc7_A_101 Protein (FLIG); flagellar motor switch protein, st 99.93
1lkv_X_138-23295 Flagellar motor switch protein FLIG; chemotaxis, f 99.88
1lkv_X_1-6565 Flagellar motor switch protein FLIG; chemotaxis, f 99.72
2oux_A_59-14082 Magnesium transporter; 10001B, structural genomics 95.02
2yvy_A_56-13782 MGTE, Mg2+ transporter MGTE; membrane protein, tra 94.58
2oux_A_59-14082 Magnesium transporter; 10001B, structural genomics 93.5
1qc7_A_101 Protein (FLIG); flagellar motor switch protein, st 93.47
1lkv_X_1-6565 Flagellar motor switch protein FLIG; chemotaxis, f 92.9
2zy9_A_1-158158 Mg2+ transporter MGTE; membrane protien, metal tra 99.33
2zy9_A_1-158158 Mg2+ transporter MGTE; membrane protien, metal tra 97.05
1lkv_X_93-13745 Flagellar motor switch protein FLIG; chemotaxis, f 99.16
>1qc7_A (A:) Protein (FLIG); flagellar motor switch protein, structural protein; 2.20A {Thermotoga maritima} Back     alignment and structure
Probab=99.93  E-value=9.9e-26  Score=189.38  Aligned_cols=96  Identities=20%  Similarity=0.383  Sum_probs=93.5

Q ss_pred             CCCHHHHHCCCHHHHHHHHHCCCHHHHHHHHCCCCHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHH
Q ss_conf             15789985099789999983098889999853889899999996100899999999985005899989999999999999
Q gi|254780689|r  249 VFLFDDLITLSSHDLSIVFNNISLEVLGKALHGTSIETQNAILHCLSNRQRKIIEENIVLNDSSIAPREVAMARRSIVQE  328 (345)
Q Consensus       249 mF~FeDl~~l~~~~l~~ll~evd~~~l~~ALkga~~e~~e~il~nmS~Ra~~~l~eel~~~~g~v~~~dve~Aq~~I~~~  328 (345)
                      ||+|+||.++++++++.+|++|+.++|++||||++++++++||+|||+|+++++++||+.+ |||+.+||++||+.|++.
T Consensus         1 mF~F~dl~~l~~~~l~~ll~~i~~~~la~ALkga~~~~~~~il~nms~R~~~~l~~el~~~-g~V~~~dve~Aq~~Iv~~   79 (101)
T 1qc7_A            1 MFVFEDILKLDDRSIQLVLREVDTRDLALALKGASDELKEKIFKNMSKRAAALLKDELEYM-GPVRLKDVEEAQQKIINI   79 (101)
T ss_dssp             CCCGGGGGGBCHHHHHHHHTSSCHHHHHHHHTTSCHHHHHHHHTTSCHHHHHHHHHHHHHH-CSCCHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHCCCHHHHHHHHHHCCHHHHHHHHCCCCHHHHHHHHHHCCHHHHHHHHHHHHHC-CCCCHHHHHHHHHHHHHH
T ss_conf             9563566548988999999968998999998689999999999866899999999999863-998899999999999999


Q ss_pred             HHHHHHCCCEECCCCCC
Q ss_conf             99999869795188889
Q gi|254780689|r  329 AISLLKTNKIELSNPIK  345 (345)
Q Consensus       329 ~r~L~~~G~I~l~~~~~  345 (345)
                      +|+|+++|+|+|....+
T Consensus        80 ~r~L~~~G~I~l~~~~e   96 (101)
T 1qc7_A           80 IRRLEEAGEIVIARGGG   96 (101)
T ss_dssp             HHHHHHTTCCCBCTTCC
T ss_pred             HHHHHHCCCEEECCCCC
T ss_conf             99999889988526997



>1lkv_X (X:138-232) Flagellar motor switch protein FLIG; chemotaxis, flagellar motion, structural protein; 2.80A {Thermotoga maritima} Back     alignment and structure
>1lkv_X (X:1-65) Flagellar motor switch protein FLIG; chemotaxis, flagellar motion, structural protein; 2.80A {Thermotoga maritima} Back     alignment and structure
>2oux_A (A:59-140) Magnesium transporter; 10001B, structural genomics, PSI-2, protein structure initiative, nysgxrc; 2.16A {Enterococcus faecalis V583} Back     alignment and structure
>2yvy_A (A:56-137) MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus HB8} PDB: 2yvz_A Back     alignment and structure
>2oux_A (A:59-140) Magnesium transporter; 10001B, structural genomics, PSI-2, protein structure initiative, nysgxrc; 2.16A {Enterococcus faecalis V583} Back     alignment and structure
>1qc7_A (A:) Protein (FLIG); flagellar motor switch protein, structural protein; 2.20A {Thermotoga maritima} Back     alignment and structure
>1lkv_X (X:1-65) Flagellar motor switch protein FLIG; chemotaxis, flagellar motion, structural protein; 2.80A {Thermotoga maritima} Back     alignment and structure
>2zy9_A (A:1-158) Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus HB8} PDB: 2yvx_A Back     alignment and structure
>2zy9_A (A:1-158) Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus HB8} PDB: 2yvx_A Back     alignment and structure
>1lkv_X (X:93-137) Flagellar motor switch protein FLIG; chemotaxis, flagellar motion, structural protein; 2.80A {Thermotoga maritima} Back     alignment and structure