254780694

254780694

probable transcriptional regulator protein, LuxR family

GeneID in NCBI database:8209698Locus tag:CLIBASIA_02905
Protein GI in NCBI database:254780694Protein Accession:YP_003065107.1
Gene range:+(574977, 575717)Protein Length:246aa
Gene description:probable transcriptional regulator protein, LuxR family
COG prediction:[K] DNA-binding HTH domain-containing proteins
KEGG prediction:probable transcriptional regulator protein, LuxR family
SEED prediction:transcriptional regulator
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV
ccccEEEEEEEEcccHHHHHHHHHHcccHHHHHHHHcccccEEEEEEEEEcHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHcccc
ccEEEEEEcccccccccccccEcccccccHHHHHHHHHHccHHHHHHHHHHHHHHcccccEEEEEccccccccccEEEEccccHHHHHHHHHHccccccccHHHccccccccEcccccHHccccHHHccccEEEcccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHcccc
MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLfqeqkldsivssdwPFDLVRCMAlsekdkyynvlqrptelfcpvfhtlpenitppagmdnrycsLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFksydvhwgkdfeltgrEVECLTwisegktsdEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV
MNFEIQQVNIvlnredeqrtsfvshlptrsdllaRMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDsivssdwpFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPenitppagmDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWisegktsdeIAVILGISRNTVNNYIASImrktatktrsgaiayavrnniv
MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV
********************************LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAY*******************GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV
MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV
MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV
MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV
MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target246 probable transcriptional regulator protein, LuxR family
254780693235 transcriptional regulator protein [Candidatus Libe 1e-07
>gi|254780693|ref|YP_003065106.1| transcriptional regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 235 Back     alignment
 Score = 48.1 bits (113), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           LT RE  CL    +G TS+EIA  LG+S +TVN Y+ S   K     R  AIA A+R
Sbjct: 174 LTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIR 230

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target246 probable transcriptional regulator protein, LuxR family
315121859246 probable transcriptional regulator protein, LuxR family 1 1e-131
190890349248 transcriptional regulator protein, LuxR family [Rhizobi 1 6e-60
222084851245 transcriptional regulator protein [Agrobacterium radiob 1 2e-59
116250468262 GerE/LuxR family transcriptional regulator [Rhizobium l 1 7e-59
82940562248 putative transcription regulator protein MotR, LuxR fam 1 7e-59
262283887262 VisN [Rhizobium leguminosarum bv. viciae] Length = 262 1 8e-59
209547914248 LuxR family transcriptional regulator [Rhizobium legumi 1 8e-59
86356298234 LuxR family transcriptional regulator [Rhizobium etli C 1 1e-58
241203092248 LuxR family transcriptional regulator [Rhizobium legumi 1 3e-58
15964400245 putative transcription regulator protein [Sinorhizobium 1 1e-54
>gi|315121859|ref|YP_004062348.1| probable transcriptional regulator protein, LuxR family [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 246 Back     alignment and organism information
 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 224/246 (91%), Positives = 234/246 (95%)

Query: 1   MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH 60
           MNFE+QQVNIVLNREDEQRTS VSHLPTRSDLLARMIPLD TVS  MRMYALTEYVGASH
Sbjct: 1   MNFEMQQVNIVLNREDEQRTSIVSHLPTRSDLLARMIPLDRTVSSKMRMYALTEYVGASH 60

Query: 61  FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI 120
           FLLVRWDLFQEQKLDS+VSSDWPFDLVRCM LSEKDKYYNVLQRP ELFCPVFH LPENI
Sbjct: 61  FLLVRWDLFQEQKLDSVVSSDWPFDLVRCMTLSEKDKYYNVLQRPAELFCPVFHILPENI 120

Query: 121 TPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW 180
             P+GMDNRYC+LTFDV RIRIGLMLLFPKGRI+ +DRLWEIGLLAAYQANMFK+Y+VH 
Sbjct: 121 DLPSGMDNRYCALTFDVGRIRIGLMLLFPKGRIVSQDRLWEIGLLAAYQANMFKNYNVHL 180

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           GKDFELTGRE+ECLTWISEGKTSDEIAVILGISRNT+NNYIASIMRKTATKTRSGAIAYA
Sbjct: 181 GKDFELTGREIECLTWISEGKTSDEIAVILGISRNTINNYIASIMRKTATKTRSGAIAYA 240

Query: 241 VRNNIV 246
           VRNNIV
Sbjct: 241 VRNNIV 246


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190890349|ref|YP_001976891.1| transcriptional regulator protein, LuxR family [Rhizobium etli CIAT 652] Length = 248 Back     alignment and organism information
>gi|222084851|ref|YP_002543380.1| transcriptional regulator protein [Agrobacterium radiobacter K84] Length = 245 Back     alignment and organism information
>gi|116250468|ref|YP_766306.1| GerE/LuxR family transcriptional regulator [Rhizobium leguminosarum bv. viciae 3841] Length = 262 Back     alignment and organism information
>gi|82940562|emb|CAJ44291.1| putative transcription regulator protein MotR, LuxR family [Rhizobium leguminosarum bv. viciae] Length = 248 Back     alignment and organism information
>gi|262283887|gb|ACY40751.1| VisN [Rhizobium leguminosarum bv. viciae] Length = 262 Back     alignment and organism information
>gi|209547914|ref|YP_002279831.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 248 Back     alignment and organism information
>gi|86356298|ref|YP_468190.1| LuxR family transcriptional regulator [Rhizobium etli CFN 42] Length = 234 Back     alignment and organism information
>gi|241203092|ref|YP_002974188.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 248 Back     alignment and organism information
>gi|15964400|ref|NP_384753.1| putative transcription regulator protein [Sinorhizobium meliloti 1021] Length = 245 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target246 probable transcriptional regulator protein, LuxR family
smart0042158 smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon 3e-15
COG277165 COG2771, CsgD, DNA-binding HTH domain-containing protei 7e-13
pfam0019658 pfam00196, GerE, Bacterial regulatory proteins, luxR fa 4e-12
TIGR03020247 TIGR03020, EpsA, transcriptional regulator EpsA 6e-11
COG2197211 COG2197, CitB, Response regulator containing a CheY-lik 7e-11
TIGR03541232 TIGR03541, reg_near_HchA, LuxR family transcriptional r 5e-08
PRK10188240 PRK10188, PRK10188, DNA-binding transcriptional activat 1e-07
PRK10100216 PRK10100, PRK10100, DNA-binding transcriptional regulat 6e-05
COG4566202 COG4566, TtrR, Response regulator [Signal transduction 2e-04
PRK10403215 PRK10403, PRK10403, transcriptional regulator NarP; Pro 0.001
COG2909894 COG2909, MalT, ATP-dependent transcriptional regulator 0.004
cd0617057 cd06170, LuxR_C_like, C-terminal DNA-binding domain of 2e-15
PRK10651216 PRK10651, PRK10651, transcriptional regulator NarL; Pro 0.001
>gnl|CDD|128698 smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon Back     alignment and domain information
>gnl|CDD|32632 COG2771, CsgD, DNA-binding HTH domain-containing proteins [Transcription] Back     alignment and domain information
>gnl|CDD|109261 pfam00196, GerE, Bacterial regulatory proteins, luxR family Back     alignment and domain information
>gnl|CDD|163106 TIGR03020, EpsA, transcriptional regulator EpsA Back     alignment and domain information
>gnl|CDD|32379 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|132580 TIGR03541, reg_near_HchA, LuxR family transcriptional regulatory, chaperone HchA-associated Back     alignment and domain information
>gnl|CDD|182292 PRK10188, PRK10188, DNA-binding transcriptional activator SdiA; Provisional Back     alignment and domain information
>gnl|CDD|182241 PRK10100, PRK10100, DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>gnl|CDD|34204 COG4566, TtrR, Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182431 PRK10403, PRK10403, transcriptional regulator NarP; Provisional Back     alignment and domain information
>gnl|CDD|32733 COG2909, MalT, ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>gnl|CDD|99777 cd06170, LuxR_C_like, C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>gnl|CDD|182619 PRK10651, PRK10651, transcriptional regulator NarL; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 246 probable transcriptional regulator protein, LuxR family
PRK10188240 DNA-binding transcriptional activator SdiA; Provisional 100.0
PRK13870234 transcriptional regulator TraR; Provisional 100.0
TIGR03541232 reg_near_HchA LuxR family transcriptional regulatory, c 100.0
PRK09935210 transcriptional regulator FimZ; Provisional 99.93
PRK09483216 response regulator; Provisional 99.92
PRK10840216 transcriptional regulator RcsB; Provisional 99.91
PRK10651216 transcriptional regulator NarL; Provisional 99.91
PRK09390202 fixJ response regulator FixJ; Provisional 99.89
PRK09958204 DNA-binding transcriptional activator EvgA; Provisional 99.89
PRK10403215 transcriptional regulator NarP; Provisional 99.89
PRK10360196 DNA-binding transcriptional activator UhpA; Provisional 99.88
COG4566202 TtrR Response regulator [Signal transduction mechanisms 99.73
PRK10046225 dpiA two-component response regulator DpiA; Provisional 97.35
PRK10161229 transcriptional regulator PhoB; Provisional 97.2
COG0745229 OmpR Response regulators consisting of a CheY-like rece 97.07
PRK09468239 ompR osmolarity response regulator; Provisional 96.92
PRK11083229 DNA-binding response regulator CreB; Provisional 96.71
PRK10100216 DNA-binding transcriptional regulator CsgD; Provisional 99.91
PRK11475205 DNA-binding transcriptional activator BglJ; Provisional 99.73
PRK10336219 DNA-binding transcriptional regulator QseB; Provisional 98.0
PRK10710240 DNA-binding transcriptional regulator BaeR; Provisional 97.3
PRK11517223 transcriptional regulatory protein YedW; Provisional 97.18
PRK10643222 DNA-binding transcriptional regulator BasR; Provisional 97.07
PRK09836226 DNA-binding transcriptional activator CusR; Provisional 96.93
PRK10766224 DNA-binding transcriptional regulator TorR; Provisional 96.66
PRK10701240 DNA-binding transcriptional regulator RstA; Provisional 96.61
PRK10816223 DNA-binding transcriptional regulator PhoP; Provisional 96.58
CHL00148240 orf27 Ycf27; Reviewed 96.41
COG4565224 CitB Response regulator of citrate/malate metabolism [T 96.22
PRK10955232 DNA-binding transcriptional regulator CpxR; Provisional 96.14
PRK10529225 DNA-binding transcriptional activator KdpE; Provisional 96.09
PRK13856241 two-component response regulator VirG; Provisional 95.79
PRK11173237 two-component response regulator; Provisional 95.57
COG2197211 CitB Response regulator containing a CheY-like receiver 99.9
PRK10430239 DNA-binding transcriptional activator DcuR; Provisional 97.1
TIGR02154226 PhoB phosphate regulon transcriptional regulatory prote 93.88
PRK04841903 transcriptional regulator MalT; Provisional 99.88
COG2909894 MalT ATP-dependent transcriptional regulator [Transcrip 99.79
pfam0019658 GerE Bacterial regulatory proteins, luxR family. 99.7
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR-like 99.69
smart0042158 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulon (ac 99.66
COG277165 CsgD DNA-binding HTH domain-containing proteins [Transc 99.53
TIGR02985167 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bactero 98.66
PRK06930170 positive control sigma-like factor; Validated 98.49
pfam07638185 Sigma70_ECF ECF sigma factor. These proteins are probab 98.42
PRK12523172 RNA polymerase sigma factor; Reviewed 98.38
TIGR02937162 sigma70-ECF RNA polymerase sigma factor, sigma-70 famil 98.33
PRK07037183 extracytoplasmic-function sigma-70 factor; Validated 98.31
PRK12525168 RNA polymerase sigma factor; Provisional 98.29
PRK12527159 RNA polymerase sigma factor; Reviewed 98.29
PRK09646194 RNA polymerase sigma factor SigK; Reviewed 98.29
PRK09637181 RNA polymerase sigma factor SigZ; Provisional 98.24
PRK12519194 RNA polymerase sigma factor; Provisional 98.24
PRK11922231 RNA polymerase sigma factor; Provisional 98.23
PRK13919187 putative RNA polymerase sigma E protein; Provisional 98.23
PRK12529178 RNA polymerase sigma factor; Provisional 98.22
PRK09645171 RNA polymerase sigma factor SigL; Provisional 98.21
PRK09652192 RNA polymerase sigma factor RpoE; Provisional 98.19
PRK09638177 RNA polymerase sigma factor SigY; Reviewed 98.18
PRK09047161 RNA polymerase factor sigma-70; Validated 98.18
PRK05602186 RNA polymerase sigma factor; Reviewed 98.18
PRK09651172 RNA polymerase sigma factor FecI; Provisional 98.18
PRK12526206 RNA polymerase sigma factor; Provisional 98.17
PRK12534187 RNA polymerase sigma factor; Provisional 98.17
PRK12537184 RNA polymerase sigma factor; Provisional 98.16
PRK12543190 RNA polymerase sigma factor; Provisional 98.16
PRK12514179 RNA polymerase sigma factor; Provisional 98.15
PRK12512184 RNA polymerase sigma factor; Provisional 98.15
PRK12524196 RNA polymerase sigma factor; Provisional 98.15
PRK09639166 RNA polymerase sigma factor SigX; Provisional 98.15
PRK12541161 RNA polymerase sigma factor; Provisional 98.15
PRK12516190 RNA polymerase sigma factor; Provisional 98.14
PRK08295209 RNA polymerase factor sigma-70; Validated 98.14
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C- 98.12
pfam0828154 Sigma70_r4_2 Sigma-70, region 4. Region 4 of sigma-70 l 98.12
PRK09641187 RNA polymerase sigma factor SigW; Provisional 98.11
PRK12528167 RNA polymerase sigma factor; Provisional 98.1
PRK09643197 RNA polymerase sigma factor SigM; Reviewed 98.1
PRK12547164 RNA polymerase sigma factor; Provisional 98.09
PRK12538233 RNA polymerase sigma factor; Provisional 98.09
PRK09647222 RNA polymerase sigma factor SigE; Reviewed 98.08
PRK12533217 RNA polymerase sigma factor; Provisional 98.07
PRK12515189 RNA polymerase sigma factor; Provisional 98.07
PRK12517188 RNA polymerase sigma factor; Provisional 98.07
PRK11923193 algU RNA polymerase sigma factor AlgU; Provisional 98.06
PRK09648187 RNA polymerase sigma factor SigD; Reviewed 98.06
PRK12513194 RNA polymerase sigma factor; Provisional 98.06
PRK12531194 RNA polymerase sigma factor; Provisional 98.05
PRK12542185 RNA polymerase sigma factor; Provisional 98.05
PRK12522173 RNA polymerase sigma factor; Provisional 98.04
PRK11924180 RNA polymerase sigma factor; Provisional 98.04
PRK12511182 RNA polymerase sigma factor; Provisional 98.04
PRK06811185 RNA polymerase factor sigma-70; Validated 98.03
PRK12546188 RNA polymerase sigma factor; Provisional 98.02
PRK12540181 RNA polymerase sigma factor; Provisional 98.01
PRK09644165 RNA polymerase sigma factor SigM; Provisional 98.0
PRK12539184 RNA polymerase sigma factor; Provisional 97.99
PRK09640188 RNA polymerase sigma factor SigX; Reviewed 97.97
PRK12518175 RNA polymerase sigma factor; Provisional 97.97
PRK12536178 RNA polymerase sigma factor; Provisional 97.96
PRK09415177 RNA polymerase factor sigma C; Reviewed 97.94
PRK06759154 RNA polymerase factor sigma-70; Validated 97.93
PRK12535195 RNA polymerase sigma factor; Provisional 97.92
PRK09649185 RNA polymerase sigma factor SigC; Reviewed 97.92
PRK09642160 RNA polymerase sigma factor SigW; Reviewed 97.92
PRK12520191 RNA polymerase sigma factor; Provisional 97.9
PRK12544207 RNA polymerase sigma factor; Provisional 97.85
PRK12532195 RNA polymerase sigma factor; Provisional 97.84
PRK12530191 RNA polymerase sigma factor; Provisional 97.79
COG1595182 RpoE DNA-directed RNA polymerase specialized sigma subu 97.77
pfam0454550 Sigma70_r4 Sigma-70, region 4. Region 4 of sigma-70 lik 97.71
pfam0496753 HTH_10 HTH DNA binding domain. 97.56
TIGR02983165 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E 97.55
COG3413215 Predicted DNA binding protein [General function predict 97.53
PRK08583257 RNA polymerase sigma factor SigB; Validated 97.35
TIGR01884231 cas_HTH CRISPR locus-related DNA-binding protein; Inter 97.33
PRK07408256 RNA polymerase sigma factor SigF; Reviewed 97.33
PRK12427229 flagellar biosynthesis sigma factor; Provisional 97.29
PRK07122263 RNA polymerase sigma factor SigF; Reviewed 97.25
PRK12545201 RNA polymerase sigma factor; Provisional 97.24
PRK09636 289 RNA polymerase sigma factor SigJ; Provisional 97.22
PRK06288261 RNA polymerase sigma factor WhiG; Reviewed 97.17
PRK05572251 sporulation sigma factor SigF; Validated 97.14
PRK08301239 sporulation sigma factor SigE; Reviewed 97.07
PRK06986234 fliA flagellar biosynthesis sigma factor; Validated 97.06
PRK08215257 sporulation sigma factor SigG; Reviewed 97.04
TIGR02999194 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family 97.03
PRK13558674 bacterio-opsin activator; Provisional 97.02
PRK07670250 RNA polymerase sigma factor SigD; Validated 97.01
PRK05803228 sporulation sigma factor SigK; Reviewed 97.0
PRK05911257 RNA polymerase sigma factor sigma-28; Reviewed 96.92
PRK07500289 rpoH2 RNA polymerase factor sigma-32; Reviewed 96.87
PRK03975139 tfx putative transcriptional regulator; Provisional 96.77
PRK12423 202 LexA repressor; Provisional 96.75
pfam0172665 LexA_DNA_bind LexA DNA binding domain. This is the DNA 96.74
PRK00215 204 LexA repressor; Validated 96.72
PRK06596284 RNA polymerase factor sigma-32; Reviewed 96.71
PRK05901398 RNA polymerase sigma factor; Provisional 96.59
PRK07598410 RNA polymerase sigma factor SigC; Validated 96.58
PRK13413200 mpi multiple promoter invertase; Provisional 96.53
PRK09635 290 sigI RNA polymerase sigma factor SigI; Provisional 96.53
TIGR02952171 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02952 f 96.47
PRK05949327 RNA polymerase sigma factor; Validated 96.47
PRK05657328 RNA polymerase sigma factor RpoS; Validated 96.43
PRK07406385 RNA polymerase sigma factor RpoD; Validated 96.39
PRK07921320 RNA polymerase sigma factor SigB; Reviewed 96.37
PRK08241 341 RNA polymerase factor sigma-70; Validated 96.33
PRK07405318 RNA polymerase sigma factor SigD; Validated 96.32
PRK09210368 RNA polymerase sigma factor RpoD; Validated 96.25
pfam0827955 HTH_11 HTH domain. This family includes helix-turn-heli 96.11
PRK13719220 conjugal transfer transcriptional regulator TraJ; Provi 96.09
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and related 96.06
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and simi 96.03
COG1191247 FliA DNA-directed RNA polymerase specialized sigma subu 96.0
COG0856 203 Orotate phosphoribosyltransferase homologs [Nucleotide 95.88
pfam02001100 DUF134 Protein of unknown function DUF134. This family 95.7
TIGR02997336 Sig70-cyanoRpoD RNA polymerase sigma factor, cyanobacte 95.68
COG3355126 Predicted transcriptional regulator [Transcription] 95.62
COG0568342 RpoD DNA-directed RNA polymerase, sigma subunit (sigma7 95.49
TIGR02984190 Sig-70_plancto1 RNA polymerase sigma-70 factor, Plancto 95.38
pfam0137188 Trp_repressor Trp repressor protein. This protein binds 95.32
pfam0048677 Trans_reg_C Transcriptional regulatory protein, C termi 95.26
COG2345 218 Predicted transcriptional regulator [Transcription] 95.18
pfam0102247 HTH_5 Bacterial regulatory protein, arsR family. Member 95.18
cd0038395 trans_reg_C Effector domain of response regulator. Bact 95.08
pfam09862113 DUF2089 Protein of unknown function(DUF2089). This doma 95.06
COG1318182 Predicted transcriptional regulators [Transcription] 95.06
PRK04217110 hypothetical protein; Provisional 94.95
pfam0344479 DUF293 Domain of unknown function. This domain is alway 94.94
TIGR02846228 spore_sigmaK RNA polymerase sigma-K factor; InterPro: I 94.87
COG5625113 Predicted transcription regulator containing HTH domain 94.82
TIGR02479227 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG family 94.68
smart0086278 Trans_reg_C Transcriptional regulatory protein, C termi 94.67
TIGR03001249 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxococcale 94.66
PRK05658620 RNA polymerase sigma factor RpoD; Validated 94.66
PRK00118105 putative DNA-binding protein; Validated 94.64
TIGR02989163 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirell 94.63
COG3415138 Transposase and inactivated derivatives [DNA replicatio 94.59
PRK02277 201 orotate phosphoribosyltransferase-like protein; Provisi 94.57
pfam0197868 TrmB Sugar-specific transcriptional regulator TrmB. One 94.54
pfam04297101 UPF0122 Putative helix-turn-helix protein, YlxM / p13 l 94.45
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon 94.44
TIGR02859198 spore_sigH RNA polymerase sigma-H factor; InterPro: IPR 94.41
PRK11179153 DNA-binding transcriptional regulator AsnC; Provisional 94.41
pfam0279645 HTH_7 Helix-turn-helix domain of resolvase. 94.35
COG1522154 Lrp Transcriptional regulators [Transcription] 94.26
TIGR02954173 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 f 94.26
pfam0381188 Ins_element1 Insertion element protein. 94.12
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an autogenou 94.11
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resistanc 93.82
TIGR02233106 Myxo_sigma_rel Myxococcus probable DNA-binding regulato 93.26
COG3398240 Uncharacterized protein conserved in archaea [Function 93.26
TIGR02959170 SigZ RNA polymerase sigma factor, SigZ family; InterPro 93.22
pfam03965115 Pencillinase_R Penicillinase repressor. The penicillina 93.16
COG2865467 Predicted transcriptional regulator containing an HTH d 92.81
PRK03573144 transcriptional regulator SlyA; Provisional 92.79
pfam0104759 MarR MarR family. The Mar proteins are involved in the 92.74
PRK06704228 RNA polymerase factor sigma-70; Validated 92.54
pfam03428177 RP-C Replication protein C N-terminal domain. Replicati 92.5
TIGR02980229 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subf 92.43
COG1710139 Uncharacterized protein conserved in archaea [Function 92.43
TIGR02950162 SigM_subfam RNA polymerase sigma factor, SigM family; I 92.36
PRK09191 261 two-component response regulator; Provisional 92.34
COG134299 Predicted DNA-binding proteins [General function predic 92.29
COG1356143 tfx Transcriptional regulator [DNA replication, recombi 92.19
PRK11512144 DNA-binding transcriptional repressor MarR; Provisional 92.16
TIGR02702 215 SufR_cyano iron-sulfur cluster biosynthesis transcripti 92.09
TIGR02941256 Sigma_B RNA polymerase sigma-B factor; InterPro: IPR014 91.98
TIGR00721142 tfx DNA-binding protein, Tfx family; InterPro: IPR00464 91.41
pfam0933952 HTH_IclR IclR helix-turn-helix domain. 91.03
PRK11169164 leucine-responsive transcriptional regulator; Provision 90.94
pfam0421853 CENP-B_N CENP-B N-terminal DNA-binding domain. Centrome 90.89
pfam01418106 HTH_6 Helix-turn-helix domain, rpiR family. This domain 90.88
pfam0012660 HTH_1 Bacterial regulatory helix-turn-helix protein, ly 90.43
TIGR02960 329 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family; 90.15
COG3877122 Uncharacterized protein conserved in bacteria [Function 90.12
pfam0846166 HTH_12 Ribonuclease R winged-helix domain. This domain 90.1
TIGR03020247 EpsA transcriptional regulator EpsA. Proteins in this f 99.83
pfam03472146 Autoind_bind Autoinducer binding domain. This domain is 98.75
PRK11557282 putative DNA-binding transcriptional regulator; Provisi 94.02
PRK11337293 DNA-binding transcriptional repressor RpiR; Provisional 93.27
PRK11886319 biotin--protein ligase; Provisional 92.8
PRK11302284 DNA-binding transcriptional regulator HexR; Provisional 92.59
COG1737281 RpiR Transcriptional regulators [Transcription] 92.47
COG2390321 DeoR Transcriptional regulator, contains sigma factor-r 92.28
COG5484279 Uncharacterized conserved protein [Function unknown] 91.71
PRK09801310 transcriptional activator TtdR; Provisional 90.19
PRK11074300 putative DNA-binding transcriptional regulator; Provisi 90.15
>PRK10188 DNA-binding transcriptional activator SdiA; Provisional Back     alignment and domain information
>PRK13870 transcriptional regulator TraR; Provisional Back     alignment and domain information
>TIGR03541 reg_near_HchA LuxR family transcriptional regulatory, chaperone HchA-associated Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>PRK10161 transcriptional regulator PhoB; Provisional Back     alignment and domain information
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>PRK11517 transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>PRK09836 DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>PRK10766 DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10955 DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>PRK13856 two-component response regulator VirG; Provisional Back     alignment and domain information
>PRK11173 two-component response regulator; Provisional Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB; InterPro: IPR011879 PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>pfam00196 GerE Bacterial regulatory proteins, luxR family Back     alignment and domain information
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon Back     alignment and domain information
>COG2771 CsgD DNA-binding HTH domain-containing proteins [Transcription] Back     alignment and domain information
>TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1; InterPro: IPR014327 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK06930 positive control sigma-like factor; Validated Back     alignment and domain information
>pfam07638 Sigma70_ECF ECF sigma factor Back     alignment and domain information
>PRK12523 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family; InterPro: IPR014284 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK07037 extracytoplasmic-function sigma-70 factor; Validated Back     alignment and domain information
>PRK12525 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12527 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>PRK09646 RNA polymerase sigma factor SigK; Reviewed Back     alignment and domain information
>PRK09637 RNA polymerase sigma factor SigZ; Provisional Back     alignment and domain information
>PRK12519 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK11922 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK13919 putative RNA polymerase sigma E protein; Provisional Back     alignment and domain information
>PRK12529 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09645 RNA polymerase sigma factor SigL; Provisional Back     alignment and domain information
>PRK09652 RNA polymerase sigma factor RpoE; Provisional Back     alignment and domain information
>PRK09638 RNA polymerase sigma factor SigY; Reviewed Back     alignment and domain information
>PRK09047 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK05602 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>PRK09651 RNA polymerase sigma factor FecI; Provisional Back     alignment and domain information
>PRK12526 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12534 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12537 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12543 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12514 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12512 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12524 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09639 RNA polymerase sigma factor SigX; Provisional Back     alignment and domain information
>PRK12541 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12516 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK08295 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>pfam08281 Sigma70_r4_2 Sigma-70, region 4 Back     alignment and domain information
>PRK09641 RNA polymerase sigma factor SigW; Provisional Back     alignment and domain information
>PRK12528 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09643 RNA polymerase sigma factor SigM; Reviewed Back     alignment and domain information
>PRK12547 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12538 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09647 RNA polymerase sigma factor SigE; Reviewed Back     alignment and domain information
>PRK12533 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12515 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12517 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK11923 algU RNA polymerase sigma factor AlgU; Provisional Back     alignment and domain information
>PRK09648 RNA polymerase sigma factor SigD; Reviewed Back     alignment and domain information
>PRK12513 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12531 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12542 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12522 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK11924 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12511 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK06811 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK12546 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12540 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09644 RNA polymerase sigma factor SigM; Provisional Back     alignment and domain information
>PRK12539 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09640 RNA polymerase sigma factor SigX; Reviewed Back     alignment and domain information
>PRK12518 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12536 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09415 RNA polymerase factor sigma C; Reviewed Back     alignment and domain information
>PRK06759 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK12535 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09649 RNA polymerase sigma factor SigC; Reviewed Back     alignment and domain information
>PRK09642 RNA polymerase sigma factor SigW; Reviewed Back     alignment and domain information
>PRK12520 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12544 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12532 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12530 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>COG1595 RpoE DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription] Back     alignment and domain information
>pfam04545 Sigma70_r4 Sigma-70, region 4 Back     alignment and domain information
>pfam04967 HTH_10 HTH DNA binding domain Back     alignment and domain information
>TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family; InterPro: IPR014325 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>COG3413 Predicted DNA binding protein [General function prediction only] Back     alignment and domain information
>PRK08583 RNA polymerase sigma factor SigB; Validated Back     alignment and domain information
>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein; InterPro: IPR010163 Most but not all examples of this family are associated with CRISPR loci, a combination of DNA repeats and characteristic proteins encoded near the repeat cluster Back     alignment and domain information
>PRK07408 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>PRK12427 flagellar biosynthesis sigma factor; Provisional Back     alignment and domain information
>PRK07122 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>PRK12545 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09636 RNA polymerase sigma factor SigJ; Provisional Back     alignment and domain information
>PRK06288 RNA polymerase sigma factor WhiG; Reviewed Back     alignment and domain information
>PRK05572 sporulation sigma factor SigF; Validated Back     alignment and domain information
>PRK08301 sporulation sigma factor SigE; Reviewed Back     alignment and domain information
>PRK06986 fliA flagellar biosynthesis sigma factor; Validated Back     alignment and domain information
>PRK08215 sporulation sigma factor SigG; Reviewed Back     alignment and domain information
>TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family; InterPro: IPR011517 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK07670 RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>PRK05803 sporulation sigma factor SigK; Reviewed Back     alignment and domain information
>PRK05911 RNA polymerase sigma factor sigma-28; Reviewed Back     alignment and domain information
>PRK07500 rpoH2 RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>PRK03975 tfx putative transcriptional regulator; Provisional Back     alignment and domain information
>PRK12423 LexA repressor; Provisional Back     alignment and domain information
>pfam01726 LexA_DNA_bind LexA DNA binding domain Back     alignment and domain information
>PRK00215 LexA repressor; Validated Back     alignment and domain information
>PRK06596 RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>PRK05901 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK07598 RNA polymerase sigma factor SigC; Validated Back     alignment and domain information
>PRK13413 mpi multiple promoter invertase; Provisional Back     alignment and domain information
>PRK09635 sigI RNA polymerase sigma factor SigI; Provisional Back     alignment and domain information
>TIGR02952 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02952 family; InterPro: IPR014298 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK05949 RNA polymerase sigma factor; Validated Back     alignment and domain information
>PRK05657 RNA polymerase sigma factor RpoS; Validated Back     alignment and domain information
>PRK07406 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>PRK07921 RNA polymerase sigma factor SigB; Reviewed Back     alignment and domain information
>PRK08241 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK07405 RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>PRK09210 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>pfam08279 HTH_11 HTH domain Back     alignment and domain information
>PRK13719 conjugal transfer transcriptional regulator TraJ; Provisional Back     alignment and domain information
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>COG1191 FliA DNA-directed RNA polymerase specialized sigma subunit [Transcription] Back     alignment and domain information
>COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] Back     alignment and domain information
>pfam02001 DUF134 Protein of unknown function DUF134 Back     alignment and domain information
>TIGR02997 Sig70-cyanoRpoD RNA polymerase sigma factor, cyanobacterial RpoD-like family Back     alignment and domain information
>COG3355 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG0568 RpoD DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) [Transcription] Back     alignment and domain information
>TIGR02984 Sig-70_plancto1 RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1; InterPro: IPR014326 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>pfam01371 Trp_repressor Trp repressor protein Back     alignment and domain information
>pfam00486 Trans_reg_C Transcriptional regulatory protein, C terminal Back     alignment and domain information
>COG2345 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>pfam01022 HTH_5 Bacterial regulatory protein, arsR family Back     alignment and domain information
>cd00383 trans_reg_C Effector domain of response regulator Back     alignment and domain information
>pfam09862 DUF2089 Protein of unknown function(DUF2089) Back     alignment and domain information
>COG1318 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PRK04217 hypothetical protein; Provisional Back     alignment and domain information
>pfam03444 DUF293 Domain of unknown function Back     alignment and domain information
>TIGR02846 spore_sigmaK RNA polymerase sigma-K factor; InterPro: IPR014209 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>COG5625 Predicted transcription regulator containing HTH domain [Transcription] Back     alignment and domain information
>TIGR02479 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG family; InterPro: IPR012845 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>smart00862 Trans_reg_C Transcriptional regulatory protein, C terminal Back     alignment and domain information
>TIGR03001 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxococcales family 1; InterPro: IPR011745 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK05658 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>PRK00118 putative DNA-binding protein; Validated Back     alignment and domain information
>TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family; InterPro: IPR014331 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK02277 orotate phosphoribosyltransferase-like protein; Provisional Back     alignment and domain information
>pfam01978 TrmB Sugar-specific transcriptional regulator TrmB Back     alignment and domain information
>pfam04297 UPF0122 Putative helix-turn-helix protein, YlxM / p13 like Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>TIGR02859 spore_sigH RNA polymerase sigma-H factor; InterPro: IPR014218 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>pfam02796 HTH_7 Helix-turn-helix domain of resolvase Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>TIGR02954 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 family; InterPro: IPR014300 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>pfam03811 Ins_element1 Insertion element protein Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>TIGR02233 Myxo_sigma_rel Myxococcus probable DNA-binding regulatory protein Back     alignment and domain information
>COG3398 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>TIGR02959 SigZ RNA polymerase sigma factor, SigZ family; InterPro: IPR014304 This entry is a group of RNA polymerase sigma factors where one of the members is designated as SigZ in Bacillus subtilis Back     alignment and domain information
>pfam03965 Pencillinase_R Penicillinase repressor Back     alignment and domain information
>COG2865 Predicted transcriptional regulator containing an HTH domain and an uncharacterized domain shared with the mammalian protein Schlafen [Transcription] Back     alignment and domain information
>PRK03573 transcriptional regulator SlyA; Provisional Back     alignment and domain information
>pfam01047 MarR MarR family Back     alignment and domain information
>PRK06704 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>pfam03428 RP-C Replication protein C N-terminal domain Back     alignment and domain information
>TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily; InterPro: IPR014322 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>COG1710 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>TIGR02950 SigM_subfam RNA polymerase sigma factor, SigM family; InterPro: IPR014296 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK09191 two-component response regulator; Provisional Back     alignment and domain information
>COG1342 Predicted DNA-binding proteins [General function prediction only] Back     alignment and domain information
>COG1356 tfx Transcriptional regulator [DNA replication, recombination and repair] Back     alignment and domain information
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR; InterPro: IPR014075 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>TIGR02941 Sigma_B RNA polymerase sigma-B factor; InterPro: IPR014288 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>TIGR00721 tfx DNA-binding protein, Tfx family; InterPro: IPR004645 This is a family of Tfx DNA-binding proteins, which is restricted to the archaea Back     alignment and domain information
>pfam09339 HTH_IclR IclR helix-turn-helix domain Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>pfam04218 CENP-B_N CENP-B N-terminal DNA-binding domain Back     alignment and domain information
>pfam01418 HTH_6 Helix-turn-helix domain, rpiR family Back     alignment and domain information
>pfam00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family Back     alignment and domain information
>TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family; InterPro: IPR014305 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>COG3877 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam08461 HTH_12 Ribonuclease R winged-helix domain Back     alignment and domain information
>TIGR03020 EpsA transcriptional regulator EpsA Back     alignment and domain information
>pfam03472 Autoind_bind Autoinducer binding domain Back     alignment and domain information
>PRK11557 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK11337 DNA-binding transcriptional repressor RpiR; Provisional Back     alignment and domain information
>PRK11886 biotin--protein ligase; Provisional Back     alignment and domain information
>PRK11302 DNA-binding transcriptional regulator HexR; Provisional Back     alignment and domain information
>COG1737 RpiR Transcriptional regulators [Transcription] Back     alignment and domain information
>COG2390 DeoR Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription] Back     alignment and domain information
>COG5484 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09801 transcriptional activator TtdR; Provisional Back     alignment and domain information
>PRK11074 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target246 probable transcriptional regulator protein, LuxR family
3qp6_A265 Crystal Structure Of Cvir (Chromobacterium Violaceu 1e-26
3qp5_A265 Crystal Structure Of Cvir Bound To Antagonist Chlor 1e-25
3c3w_A225 Crystal Structure Of The Mycobacterium Tuberculosis 5e-22
2q0o_A236 Crystal Structure Of An Anti-Activation Complex In 3e-20
1yio_A208 Crystallographic Structure Of Response Regulator St 7e-16
2rnj_A91 Nmr Structure Of The S. Aureus Vrar Dna Binding Dom 6e-18
1fse_A74 Crystal Structure Of The Bacillus Subtilis Regulato 1e-16
1a04_A215 The Structure Of The NitrateNITRITE RESPONSE REGULA 1e-16
3kln_A225 Vibrio Cholerae Vpst Length = 225 4e-16
gi|327200688|pdb|3QP6|A Chain A, Crystal Structure Of Cvir (Chromobacterium Violaceum 12472) Bound To C6-Hsl Length = 265 Back     alignment and structure
 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 35/225 (15%), Positives = 76/225 (33%), Gaps = 19/225 (8%)

Query: 37  IPLDCTVSWTMRMYALTEYVGASHFLLVRW---DLFQEQKLDSIVSSDWPFDLVRCMALS 93
             ++        +  +     +   +LV     +  Q Q+++ +++  +P D +   +  
Sbjct: 32  GHIETEGELKAFLDNILSQAPSDRIILVLGRLNNQNQIQRMEKVLNVSYPSDWLNQYSQE 91

Query: 94  EKDKYYNVLQRPTELFCPVFHT------------LPENITPPAGMDNRYCSLTFDVARIR 141
              ++  +++       PV                        GM +             
Sbjct: 92  NFAQHDPIMRIHLGQ-GPVIWEERFSRAKGSEEKRFIAEASSNGMGSGITFSAASDRNNV 150

Query: 142 IGLMLLFPKGRIILRDRLWEIGLLAAYQAN---MFKSYDVHWGKDFELTGREVECLTWIS 198
             ++ +  K        +  +  L  +         +       +  L+ RE +   W+S
Sbjct: 151 GSILSIGGKEPGRNAALVAMLNCLTPHLHQAAVRIANLPPASPSNMPLSQREYDIFHWMS 210

Query: 199 EGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            GKT+ EIA IL IS  TV  ++A+++RK     R+ AI   +  
Sbjct: 211 RGKTNWEIATILNISERTVKFHVANVIRKLNANNRTHAIVLGMHL 255


>gi|327200684|pdb|3QP5|A Chain A, Crystal Structure Of Cvir Bound To Antagonist Chlorolactone (Cl) Length = 265 Back     alignment and structure
>gi|185177925|pdb|3C3W|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Hypoxic Response Regulator Dosr Length = 225 Back     alignment and structure
gi|158429605|pdb|2Q0O|A Chain A, Crystal Structure Of An Anti-Activation Complex In Bacterial Quorum Sensing Length = 236 Back     alignment and structure
>gi|78100993|pdb|1YIO|A Chain A, Crystallographic Structure Of Response Regulator Styr From Pseudomonas Fluorescens Length = 208 Back     alignment and structure
>gi|166007196|pdb|2RNJ|A Chain A, Nmr Structure Of The S. Aureus Vrar Dna Binding Domain Length = 91 Back     alignment and structure
gi|13786948|pdb|1FSE|A Chain A, Crystal Structure Of The Bacillus Subtilis Regulatory Protein Gere Length = 74 Back     alignment and structure
>gi|2981650|pdb|1A04|A Chain A, The Structure Of The NitrateNITRITE RESPONSE REGULATOR Protein Narl In The Monoclinic C2 Crystal Form Length = 215 Back     alignment and structure
>gi|288563091|pdb|3KLN|A Chain A, Vibrio Cholerae Vpst Length = 225 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target246 probable transcriptional regulator protein, LuxR family
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA bindi 4e-15
2krf_A73 Transcriptional regulatory protein COMA; activator, com 4e-15
2rnj_A91 Response regulator protein VRAR; HTH LUXR-type domain, 5e-15
3clo_A258 Transcriptional regulator; NP_811094.1, bacterial regul 1e-14
1je8_A82 Nitrate/nitrite response regulator protein NARL; protei 1e-14
1x3u_A79 Transcriptional regulatory protein FIXJ; helix-turn-hel 2e-13
1fse_A74 GERE; helix-turn-helix DNA-binding protein transcriptio 2e-13
2jpc_A61 SSRB; DNA binding protein, structural genomics, PSI-2, 5e-13
3c57_A95 Two component transcriptional regulatory protein DEVR; 2e-12
3klo_A225 Transcriptional regulator VPST; REC domain, HTH domain, 3e-10
3c3w_A225 Two component transcriptional regulatory protein DEVR; 6e-10
1a04_A215 Nitrate/nitrite response regulator protein NARL; signal 1e-07
1yio_A208 Response regulatory protein; transcription regulation, 3e-05
2q0o_A236 Probable transcriptional activator protein TRAR; helix- 1e-14
1l3l_A234 Transcriptional activator protein TRAR; helix-turn-heli 4e-14
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Length = 99 Back     alignment and structure
 Score = 77.2 bits (190), Expect = 4e-15
 Identities = 17/64 (26%), Positives = 26/64 (40%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  L+ +E E L   +EG    EIA  L  S  T+++   S M K         + Y   
Sbjct: 32  DKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVDNDIALLNYLSS 91

Query: 243 NNIV 246
            ++ 
Sbjct: 92  VSMT 95


>2krf_A Transcriptional regulatory protein COMA; activator, competence, DNA-binding, transcription regulation component regulatory system; NMR {Bacillus subtilis} Length = 73 Back     alignment and structure
>2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} Length = 91 Back     alignment and structure
>3clo_A Transcriptional regulator; NP_811094.1, bacterial regulatory proteins, LUXR family, structural genomics; 2.04A {Bacteroides thetaiotaomicron vpi-5482} Length = 258 Back     alignment and structure
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A Length = 82 Back     alignment and structure
>1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} Length = 79 Back     alignment and structure
>1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulator; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 Length = 74 Back     alignment and structure
>2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} Length = 61 Back     alignment and structure
>3c57_A Two component transcriptional regulatory protein DEVR; response regulator, two-component regulatory system, DNA- binding protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A Length = 95 Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Length = 225 Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein DEVR; response regulator, two-component regulatory system, DNA- binding protein; 2.20A {Mycobacterium tuberculosis} Length = 225 Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Length = 215 Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Length = 208 Back     alignment and structure
>2q0o_A Probable transcriptional activator protein TRAR; helix-turn-helix, two-helix coiled coil; HET: LAE; 2.00A {Rhizobium SP} Length = 236 Back     alignment and structure
>1l3l_A Transcriptional activator protein TRAR; helix-turn-helix DNA binding motif, alpha/beta/alpha sandwich; HET: LAE; 1.66A {Agrobacterium tumefaciens} SCOP: a.4.6.2 d.110.5.1 PDB: 1h0m_A* Length = 234 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target246 probable transcriptional regulator protein, LuxR family
2q0o_A236 Probable transcriptional activator protein TRAR; helix- 99.98
1l3l_A234 Transcriptional activator protein TRAR; helix-turn-heli 99.97
1a04_A215 Nitrate/nitrite response regulator protein NARL; signal 99.85
3c3w_A225 Two component transcriptional regulatory protein DEVR; 99.87
3klo_A225 Transcriptional regulator VPST; REC domain, HTH domain, 99.86
1yio_A208 Response regulatory protein; transcription regulation, 99.71
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription; HET 97.45
2gwr_A238 DNA-binding response regulator MTRA; two-component regu 97.3
2oqr_A230 Sensory transduction protein REGX3; response regulator, 97.21
1ys7_A233 Transcriptional regulatory protein PRRA; response regul 97.17
1kgs_A225 DRRD, DNA binding response regulator D; DNA-binding pro 97.08
2hqr_A223 Putative transcriptional regulator; phosporylation-inde 95.4
1fse_A74 GERE; helix-turn-helix DNA-binding protein transcriptio 99.79
3clo_A258 Transcriptional regulator; NP_811094.1, bacterial regul 99.79
2krf_A73 Transcriptional regulatory protein COMA; activator, com 99.76
2rnj_A91 Response regulator protein VRAR; HTH LUXR-type domain, 99.76
1je8_A82 Nitrate/nitrite response regulator protein NARL; protei 99.75
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA bindi 99.75
3c57_A95 Two component transcriptional regulatory protein DEVR; 99.75
1x3u_A79 Transcriptional regulatory protein FIXJ; helix-turn-hel 99.73
2jpc_A61 SSRB; DNA binding protein, structural genomics, PSI-2, 99.68
1xsv_A113 Hypothetical UPF0122 protein SAV1236; helix-turn-helix, 98.19
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter recogn 98.05
1s7o_A113 Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042 98.02
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zinc bin 97.98
3mzy_A164 RNA polymerase sigma-H factor; PSI, MCSG, structural ge 97.91
1or7_A194 Sigma-24, RNA polymerase sigma-E factor; regulation, DN 97.74
1rp3_A239 RNA polymerase sigma factor sigma-28 (FLIA); transcript 97.7
2q1z_A184 RPOE, ECF SIGE; ECF sigma factor, cupin fold, zinc bind 97.63
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription; 1.8 97.33
1jhf_A 202 LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {E 97.27
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, regula 97.17
1l0o_C243 Sigma factor; bergerat fold, helix-turn-helix, protein 97.17
1tty_A87 Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-h 96.95
3k2z_A 196 LEXA repressor; winged helix-turn-helix, SOS system, au 96.84
1u78_A141 TC3 transposase, transposable element TC3 transposase; 96.83
1l9z_H438 Sigma factor SIGA; helix-turn-helix, coiled-coil, trans 96.8
2a6h_F423 RNA polymerase sigma factor RPOD; RNA polymerase holoen 96.53
1tlh_B81 Sigma-70, RNA polymerase sigma factor RPOD; anti-sigma, 96.42
3frw_A107 Putative Trp repressor protein; structural genomics, AP 96.42
2d1h_A109 ST1889, 109AA long hypothetical transcriptional regulat 96.37
1jko_C52 HIN recombinase, DNA-invertase HIN; water-mediated reco 96.26
3kor_A119 Possible Trp repressor; putative DNA-binding Trp repres 96.22
2r0q_C209 Putative transposon TN552 DNA-invertase BIN3; site-spec 96.14
2p5v_A162 Transcriptional regulator, LRP/ASNC family; NMB0573, st 96.08
2wte_A244 CSA3; antiviral protein, viral resistance, winged helix 95.97
1y0u_A96 Arsenical resistance operon repressor, putative; struct 95.93
1uly_A 192 Hypothetical protein PH1932; helix-turn-helix, structur 95.9
1gdt_A183 GD resolvase, protein (gamma delta resolvase); protein-