254780695

254780695

flagellar MS-ring protein

GeneID in NCBI database:8209699Locus tag:CLIBASIA_02910
Protein GI in NCBI database:254780695Protein Accession:YP_003065108.1
Gene range:+(572909, 574600)Protein Length:563aa
Gene description:flagellar MS-ring protein
COG prediction:[N] [U] Flagellar biosynthesis/type III secretory pathway lipoprotein
KEGG prediction:fliF; flagellar MS-ring protein; K02409 flagellar M-ring protein FliF
SEED prediction:Flagellar M-ring protein FliF
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED3 TM-Helix
HMMTOP2 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560---
MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIEDRYTQHIS
cccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEcccccHHHHHHHHHHHHHccccEEEcccccEEEEEHHHHHHHHHHHHHccccccccccHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHcccccHHHEEEEcccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEcccEEEEEEEEcccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEEcccEEEEEEEcccEEEEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHcccccccccEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcc
cccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHccccEEEcccccEEEEcHHHHHHHHHHHHHcccccccccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHcEEEEEccccccEEccccccccEEEEEEcccccHHHHHHHHHHHHHHccccccccEEEEEccccEcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEcccEEEccEcccccccccEEEEEEEHccccccccccccccccccccccccccccccccccccccccccEEEEEEcEEEEEEccccEEEEEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHcccccccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccHHHHHccHcccHHHHccccccccccccccccHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccEccc
MAILDQLLQFFKsgtslgrtRILILASVILVPIMLFMAARffvnsphydnlyVKLEVSDVNRISVALSEanidfrisdngssisvpssmvGKARIHLAaqglpssssnsgyelFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIvmpdmgsfrkigarptASVMIRAINPSVYKSAEAIRHLVAAavpnldmgdvtvldstgklltaNEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREivydpdskverSIRLskdaqrsetsqpesavtveqnmphvsdrkvplprslentdkkeeqsnyEINTKsiatthdnyklERLSIAVVVNKGRLtevlgrsadqgkIDSYLAEINKIVSAAtginsrrgdtitITSMDFLEnqlfnsgtvqvSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRrlhniddakkgevggksilspppissavttglmpndnialdssnqdifsHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIEDRYTQHIS
MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSeanidfrisdngssiSVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAavpnldmgdVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELnmdtqqireivydpdskveRSIRlskdaqrsetsqpesavtveqnmphvsdrkvplprslentdkkeeqsnyeintksiatthdnyklERLSIAVVVNKGRLtevlgrsadqgkidSYLAEINKIVsaatginsrrgDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNiddakkgevggksilspppISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWArseiedrytqhis
MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINAlvflvgtllvtflglHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIEDRYTQHIS
****DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM************SVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK*************************IEMNINKALAAFLGVDNFRSAVVAELNMDTQQI*****************************************************************EINTKSIAT*H*NYKLERLSIAVVVNKGRLTEVLG*SA**GKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL****TVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR***********************************************************************MIEINEERFAKILRKWAR************
MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIR*****************************KVPLPRSLEN********NYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI*********
*AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDA**************************************EEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNID**********************************************NLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIEDRYT**I*
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIEDRYTQHIS
MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIEDRYTQHIS
MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIEDRYTQHIS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target563 flagellar MS-ring protein [Candidatus Liberibacter asia
315121860560 flagellar MS-ring protein [Candidatus Liberibacter sola 1 0.0
241203091563 flagellar MS-ring protein [Rhizobium leguminosarum bv. 1 1e-158
327193018563 flagellar M-ring protein [Rhizobium etli CNPAF512] Leng 1 1e-158
190890348563 flagellar M-ring protein [Rhizobium etli CIAT 652] Leng 1 1e-157
116250467561 flagellar MS-ring protein [Rhizobium leguminosarum bv. 1 1e-157
86356297563 flagellar MS-ring protein [Rhizobium etli CFN 42] Lengt 1 1e-156
209547913563 flagellar MS-ring protein [Rhizobium leguminosarum bv. 1 1e-154
222149996568 flagellar MS-ring protein [Agrobacterium vitis S4] Leng 1 1e-153
325291912560 flagellar MS-ring protein [Agrobacterium sp. H13-3] Len 1 1e-149
222084850559 flagellar M-ring protein [Agrobacterium radiobacter K84 1 1e-146
>gi|315121860|ref|YP_004062349.1| flagellar MS-ring protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 560 Back     alignment and organism information
 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/560 (75%), Positives = 480/560 (85%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           MAI+DQLLQFFKS  SLGR R+ I+ +V+   I L +AA FF++SP YD+LYVKLE SDV
Sbjct: 1   MAIIDQLLQFFKSAMSLGRMRLFIVGAVMFASIALLLAASFFMSSPIYDSLYVKLEASDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+ISVALSEA+IDFRI+ NGSSI VPS ++ KAR+ LA QGLP+SS+NSGYELFDKVNSF
Sbjct: 61  NKISVALSEASIDFRIAGNGSSILVPSHLLSKARLRLAEQGLPNSSNNSGYELFDKVNSF 120

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQEITRVRALEGEI+RTIQ ISGIVAARVHIVMPDMGSFR+IGA+PTASVM+R +
Sbjct: 121 GLTSFMQEITRVRALEGEISRTIQDISGIVAARVHIVMPDMGSFRRIGAKPTASVMVRVV 180

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHE 240
           NPSVYKSAEAIRHLVAAAVP LD+ DVTVLDSTGKLL ANE+ERNI GKSL IVQA+QHE
Sbjct: 181 NPSVYKSAEAIRHLVAAAVPGLDISDVTVLDSTGKLLVANEIERNIFGKSLGIVQAVQHE 240

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           IEMNINKALA FLG+DNFRSAV+AELN D QQI+EIVYDPDS+VERS+RLSKD QRSE+ 
Sbjct: 241 IEMNINKALAPFLGIDNFRSAVIAELNTDIQQIKEIVYDPDSRVERSVRLSKDVQRSESH 300

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           Q ESAVTVEQNMPHVS++    PR+LENTDKKEEQSNYEINTKSI+TTH+NYKLERLSIA
Sbjct: 301 QQESAVTVEQNMPHVSEKNATSPRALENTDKKEEQSNYEINTKSISTTHNNYKLERLSIA 360

Query: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           VVVNKGRL E+LG S +Q K+DSYLAEIN+IVSAATGINS RGD ITITSMDFL++QL N
Sbjct: 361 VVVNKGRLMEMLGPSMEQSKVDSYLAEINRIVSAATGINSIRGDNITITSMDFLDDQLLN 420

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
           S TVQVSFMDILSR+F+ +INAL FL   LL+   G+H LR  +NID  K+ E+  KS L
Sbjct: 421 SSTVQVSFMDILSRNFSIIINALFFLTLVLLMALFGVHVLRGFNNIDLIKRKEMEAKSAL 480

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
           S P I+S   T LM +D++A DS  QDI S + N QS IN+YV++QSD RLL MIEINEE
Sbjct: 481 STPSIASTAETTLMSSDDMASDSFRQDILSRNNNFQSDINNYVAEQSDRRLLRMIEINEE 540

Query: 541 RFAKILRKWARSEIEDRYTQ 560
           RF+KI+RKW RSEIE RYTQ
Sbjct: 541 RFSKIIRKWVRSEIESRYTQ 560


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241203091|ref|YP_002974187.1| flagellar MS-ring protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 563 Back     alignment and organism information
>gi|327193018|gb|EGE59930.1| flagellar M-ring protein [Rhizobium etli CNPAF512] Length = 563 Back     alignment and organism information
>gi|190890348|ref|YP_001976890.1| flagellar M-ring protein [Rhizobium etli CIAT 652] Length = 563 Back     alignment and organism information
>gi|116250467|ref|YP_766305.1| flagellar MS-ring protein [Rhizobium leguminosarum bv. viciae 3841] Length = 561 Back     alignment and organism information
>gi|86356297|ref|YP_468189.1| flagellar MS-ring protein [Rhizobium etli CFN 42] Length = 563 Back     alignment and organism information
>gi|209547913|ref|YP_002279830.1| flagellar MS-ring protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 563 Back     alignment and organism information
>gi|222149996|ref|YP_002550953.1| flagellar MS-ring protein [Agrobacterium vitis S4] Length = 568 Back     alignment and organism information
>gi|325291912|ref|YP_004277776.1| flagellar MS-ring protein [Agrobacterium sp. H13-3] Length = 560 Back     alignment and organism information
>gi|222084850|ref|YP_002543379.1| flagellar M-ring protein [Agrobacterium radiobacter K84] Length = 559 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target563 flagellar MS-ring protein [Candidatus Liberibacter asia
PRK06007542 PRK06007, fliF, flagellar MS-ring protein; Reviewed 1e-109
TIGR00206555 TIGR00206, fliF, flagellar basal-body M-ring protein/fl 1e-43
PRK12800574 PRK12800, fliF, flagellar MS-ring protein; Reviewed 4e-32
COG1766545 COG1766, FliF, Flagellar biosynthesis/type III secretor 8e-89
PRK07193552 PRK07193, fliF, flagellar MS-ring protein; Reviewed 4e-50
pfam01514206 pfam01514, YscJ_FliF, Secretory protein of YscJ/FliF fa 2e-43
pfam08345162 pfam08345, YscJ_FliF_C, Flagellar M-ring protein C-term 3e-30
TIGR02544193 TIGR02544, III_secr_YscJ, type III secretion apparatus 3e-16
COG4669246 COG4669, EscJ, Type III secretory pathway, lipoprotein 2e-10
>gnl|CDD|180348 PRK06007, fliF, flagellar MS-ring protein; Reviewed Back     alignment and domain information
>gnl|CDD|129310 TIGR00206, fliF, flagellar basal-body M-ring protein/flagellar hook-basal body protein (fliF) Back     alignment and domain information
>gnl|CDD|183757 PRK12800, fliF, flagellar MS-ring protein; Reviewed Back     alignment and domain information
>gnl|CDD|31952 COG1766, FliF, Flagellar biosynthesis/type III secretory pathway lipoprotein [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|180873 PRK07193, fliF, flagellar MS-ring protein; Reviewed Back     alignment and domain information
>gnl|CDD|110511 pfam01514, YscJ_FliF, Secretory protein of YscJ/FliF family Back     alignment and domain information
>gnl|CDD|149415 pfam08345, YscJ_FliF_C, Flagellar M-ring protein C-terminal Back     alignment and domain information
>gnl|CDD|162912 TIGR02544, III_secr_YscJ, type III secretion apparatus lipoprotein, YscJ/HrcJ family Back     alignment and domain information
>gnl|CDD|34287 COG4669, EscJ, Type III secretory pathway, lipoprotein EscJ [Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 563 flagellar MS-ring protein [Candidatus Liberibacter asia
PRK06007540 fliF flagellar MS-ring protein; Reviewed 100.0
PRK12800572 fliF flagellar MS-ring protein; Reviewed 100.0
PRK07193550 fliF flagellar MS-ring protein; Reviewed 100.0
COG1766545 fliF Flagellar basal body M-ring protein [Cell motility 100.0
TIGR00206611 fliF flagellar M-ring protein FliF; InterPro: IPR000067 100.0
pfam01514206 YscJ_FliF Secretory protein of YscJ/FliF family. This f 100.0
TIGR02544203 III_secr_YscJ type III secretion apparatus lipoprotein, 99.97
COG4669246 EscJ Type III secretory pathway, lipoprotein EscJ [Intr 99.95
pfam08345162 YscJ_FliF_C Flagellar M-ring protein C-terminal. This d 100.0
PRK05934341 type III secretion system protein; Validated 98.46
TIGR02830193 spore_III_AG stage III sporulation protein AG; InterPro 96.12
PRK06007540 fliF flagellar MS-ring protein; Reviewed 94.14
pfam0941368 DUF2007 Protein of unknown function (DUF2007). This is 92.52
>PRK06007 fliF flagellar MS-ring protein; Reviewed Back     alignment and domain information
>PRK12800 fliF flagellar MS-ring protein; Reviewed Back     alignment and domain information
>PRK07193 fliF flagellar MS-ring protein; Reviewed Back     alignment and domain information
>COG1766 fliF Flagellar basal body M-ring protein [Cell motility and secretion] Back     alignment and domain information
>TIGR00206 fliF flagellar M-ring protein FliF; InterPro: IPR000067 This family corresponds to the FliF protein Back     alignment and domain information
>pfam01514 YscJ_FliF Secretory protein of YscJ/FliF family Back     alignment and domain information
>TIGR02544 III_secr_YscJ type III secretion apparatus lipoprotein, YscJ/HrcJ family; InterPro: IPR003282 Secretion of virulence factors in Gram-negative bacteria involves transportation of the protein across two membranes to reach the cell exterior Back     alignment and domain information
>COG4669 EscJ Type III secretory pathway, lipoprotein EscJ [Intracellular trafficking and secretion] Back     alignment and domain information
>pfam08345 YscJ_FliF_C Flagellar M-ring protein C-terminal Back     alignment and domain information
>PRK05934 type III secretion system protein; Validated Back     alignment and domain information
>TIGR02830 spore_III_AG stage III sporulation protein AG; InterPro: IPR014195 This entry represents the stage III sporulation protein AG, which is encoded in a spore formation operon: spoIIIAABCDEFGH under the control of sigma G Back     alignment and domain information
>PRK06007 fliF flagellar MS-ring protein; Reviewed Back     alignment and domain information
>pfam09413 DUF2007 Protein of unknown function (DUF2007) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target563 flagellar MS-ring protein [Candidatus Liberibacter asia
1yj7_A171 Crystal Structure Of Enteropathogenic E.Coli (Epec) 1e-15
2y9j_Y170 Three-Dimensional Model Of Salmonella's Needle Comp 9e-14
>gi|71042041|pdb|1YJ7|A Chain A, Crystal Structure Of Enteropathogenic E.Coli (Epec) Type Iii Secretion System Protein Escj Length = 171 Back     alignment and structure
 Score = 89.6 bits (220), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/164 (17%), Positives = 67/164 (40%), Gaps = 10/164 (6%)

Query: 51  LYVKLEVSDVNRISVALSEA--NIDFRISDNGS-SISVPSSMVGKARIHLAAQGLPSSSS 107
           LY  L   + N++   L     N+   +  +G+ ++SV ++   +A   L   G P    
Sbjct: 5   LYTGLTEKEANQMQALLLSNDVNVSKEMDKSGNMTLSVAAADFVRAITILNNNGFPKKKF 64

Query: 108 NSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKI 167
            +  E+    +    +   +        E +I R +  I G++   V + + +       
Sbjct: 65  -ADIEVIFPPSQLVASPSQENAKINYLKEQDIERLLSKIPGVIDCSVSLNVNNN-----E 118

Query: 168 GARPTASVMIRAINPSVY-KSAEAIRHLVAAAVPNLDMGDVTVL 210
               +A+V++ +        S   I++LV  +V +L + +++V+
Sbjct: 119 SQPSSAAVLVISSPEVNLAPSVIQIKNLVKNSVDDLKLENISVV 162


>gi|326634131|pdb|2Y9J|Y Chain Y, Three-Dimensional Model Of Salmonella's Needle Complex At Subnanometer Resolution Length = 170 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target563 flagellar MS-ring protein [Candidatus Liberibacter asia
1yj7_A171 ESCJ; mixed alpha/beta, extended linker, protein transp 1e-30
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carr 0.001
>1yj7_A ESCJ; mixed alpha/beta, extended linker, protein transport; 1.80A {Escherichia coli} Length = 171 Back     alignment and structure
 Score =  130 bits (327), Expect = 1e-30
 Identities = 27/168 (16%), Positives = 66/168 (39%), Gaps = 10/168 (5%)

Query: 51  LYVKLEVSDVNRISVALSEANIDFRIS---DNGSSISVPSSMVGKARIHLAAQGLPSSSS 107
           LY  L   + N++   L   +++           ++SV ++   +A   L   G P    
Sbjct: 5   LYTGLTEKEANQMQALLLSNDVNVSKEMDKSGNMTLSVAAADFVRAITILNNNGFPKKKF 64

Query: 108 NSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKI 167
            +  E+    +    +   +        E +I R +  I G++   V + +         
Sbjct: 65  -ADIEVIFPPSQLVASPSQENAKINYLKEQDIERLLSKIPGVIDCSVSLNVN-----NNE 118

Query: 168 GARPTASVMIRAI-NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTG 214
               +A+V++ +    ++  S   I++LV  +V +L + +++V+  + 
Sbjct: 119 SQPSSAAVLVISSPEVNLAPSVIQIKNLVKNSVDDLKLENISVVIKSS 166


>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target563 flagellar MS-ring protein [Candidatus Liberibacter asia
1yj7_A171 ESCJ; mixed alpha/beta, extended linker, protein transp 100.0
2hfv_A97 Hypothetical protein RPA1041; NESG, GFT-alpha+beta, str 96.31
>1yj7_A ESCJ; mixed alpha/beta, extended linker, protein transport; 1.80A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=4.5e-44  Score=310.82  Aligned_cols=160  Identities=18%  Similarity=0.276  Sum_probs=146.0

Q ss_pred             EEECCCCCHHHHHHHHHHHHHCCCCEEECCC---CCEEEECHHHHHHHHHHHHHCCCCCCCCCCHHH-HHCCCCCCCCCH
Q ss_conf             4503899989999999999977992999189---977995189999999999976998877663256-530588842599
Q gi|254780695|r   49 DNLYVKLEVSDVNRISVALSEANIDFRISDN---GSSISVPSSMVGKARIHLAAQGLPSSSSNSGYE-LFDKVNSFGLTS  124 (563)
Q Consensus        49 ~~L~~~l~~~d~~~i~~~L~~~gI~y~~~~~---g~~I~Vp~~~~~~~r~~La~~glp~~~~~~g~e-l~d~~~~~g~T~  124 (563)
                      ++||+||+++|+++|++.|+++||+|++..+   |.+|+||+++++++|+.||.+|||+.+. .||+ +|++ ++||+|+
T Consensus         3 ~~Ly~~L~~~da~~i~~~L~~~gI~y~~~~~~~gg~~I~V~~~~~~~a~~~La~~glP~~~~-~~~~~lf~~-~~~~~T~   80 (171)
T 1yj7_A            3 EQLYTGLTEKEANQMQALLLSNDVNVSKEMDKSGNMTLSVAAADFVRAITILNNNGFPKKKF-ADIEVIFPP-SQLVASP   80 (171)
T ss_dssp             EEEEEEECHHHHHHHHHHHHHTTCCCEEEECTTSCEEEEEEGGGHHHHHHHHHHTTCSCCCC-CCHHHHCC-------CH
T ss_pred             CHHHCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCEEEEECHHHHHHHHHHHHHCCCCCCCC-CCHHHHCCC-CCCCCCH
T ss_conf             61106999999999999999879985975179984799976888999999999728998888-889998158-9876799


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCCCCEEEEEECCCCCC-HHHHHHHHHHHHHHHHCCC
Q ss_conf             999999999999999999960576314899998336665555555871599970687789-8899999999986540188
Q gi|254780695|r  125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV-YKSAEAIRHLVAAAVPNLD  203 (563)
Q Consensus       125 ~~~~~~~~ralegeL~rtI~~~~~V~~ArV~l~~p~~~~f~~~~~~~sASV~l~~~~~l~-~~qv~~I~~lVa~sV~gL~  203 (563)
                      |+++++|+|||||||+|||++|++|++|||||++|++     ++.++||||+|+++++.. ..||.+|++|||+|||||+
T Consensus        81 ~~~~~~~~~ale~eL~~tI~~i~gV~~ArV~l~~P~~-----~~~~~tASV~l~~~~~~~l~~qv~~I~~LVa~sV~gL~  155 (171)
T 1yj7_A           81 SQENAKINYLKEQDIERLLSKIPGVIDCSVSLNVNNN-----ESQPSSAAVLVISSPEVNLAPSVIQIKNLVKNSVDDLK  155 (171)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTSTTEEEEEEEEEC------------CEEEEEEEECTTCCCGGGHHHHHHHHHHHSTTCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEECCCC-----CCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             9999999999999999999816570157999957988-----88985179999718998769999999999997269989


Q ss_pred             CCCEEEEECCCC
Q ss_conf             352699828983
Q gi|254780695|r  204 MGDVTVLDSTGK  215 (563)
Q Consensus       204 ~e~VtVvD~~G~  215 (563)
                      ++||||+|+.+.
T Consensus       156 ~e~VtVv~q~~~  167 (171)
T 1yj7_A          156 LENISVVIKSSS  167 (171)
T ss_dssp             GGGEEEEEEECC
T ss_pred             CCCEEEEECCCC
T ss_conf             113699974687



>2hfv_A Hypothetical protein RPA1041; NESG, GFT-alpha+beta, structural genomics, PSI-2, protein structure initiative; NMR {Pseudomonas aeruginosa} SCOP: d.58.5.5 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target563 flagellar MS-ring protein [Candidatus Liberibacter asia
d2hfva175 Hypothetical protein RPA1041 {Rhodopseudomonas palustri 94.63
>d2hfva1 d.58.5.5 (A:23-97) Hypothetical protein RPA1041 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: GlnB-like
family: RPA1041-like
domain: Hypothetical protein RPA1041
species: Rhodopseudomonas palustris [TaxId: 1076]
Probab=94.63  E-value=0.043  Score=29.98  Aligned_cols=58  Identities=19%  Similarity=0.223  Sum_probs=48.7

Q ss_pred             CEEECCCCCHHHHHHHHHHHHHCCCCEEECCCC------------CEEEECHHHHHHHHHHHHHCCCCCC
Q ss_conf             245038999899999999999779929991899------------7799518999999999997699887
Q gi|254780695|r   48 YDNLYVKLEVSDVNRISVALSEANIDFRISDNG------------SSISVPSSMVGKARIHLAAQGLPSS  105 (563)
Q Consensus        48 y~~L~~~l~~~d~~~i~~~L~~~gI~y~~~~~g------------~~I~Vp~~~~~~~r~~La~~glp~~  105 (563)
                      |+.|+.--++--.+.+.+.|+.+||+|-+-+.+            .+|+|+++++.+||-.|+.+|++..
T Consensus         1 M~ELlrTnD~v~is~~~aLL~~agI~~~v~D~~mSilEGsig~iPRRimV~~~d~~~Ar~lL~dag~~~e   70 (75)
T d2hfva1           1 LRELLRTNDAVLLSAVGALLDGADIGHLVLDQNMSILEGSLGVIPRRVLVHEDDLAGARRLLTDAGLAHE   70 (75)
T ss_dssp             EEEEEEECCHHHHHHHHHHHHHTTCCEECCSCCCCSSSCCSSSSCEEEEEEGGGHHHHHHHHHHTTCCSS
T ss_pred             CCEEEECCCHHHHHHHHHHHHHCCCCEEEECCCCHHHCCCCCCEEEEEEECHHHHHHHHHHHHHCCCCHH
T ss_conf             9331234888899999999735799779842874032144354047898757589999999998696210



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 563 flagellar MS-ring protein [Candidatus Liberibacter
1yj7_A_69-171103 (A:69-171) ESCJ; mixed alpha/beta, extended linker 1e-22
>1yj7_A (A:69-171) ESCJ; mixed alpha/beta, extended linker, protein transport; 1.80A {Escherichia coli}Length = 103 Back     alignment and structure
 Score =  102 bits (256), Expect = 1e-22
 Identities = 16/108 (14%), Positives = 44/108 (40%), Gaps = 7/108 (6%)

Query: 113 LFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPT 172
           +F   +    +   +        E +I R +  I G++   V + + +           +
Sbjct: 2   IFPP-SQLVASPSQENAKINYLKEQDIERLLSKIPGVIDCSVSLNVNN-----NESQPSS 55

Query: 173 ASVMIRAINP-SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
           A+V++ +    ++  S   I++LV  +V +L + +++V+  +      
Sbjct: 56  AAVLVISSPEVNLAPSVIQIKNLVKNSVDDLKLENISVVIKSSSGQDG 103


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target563 flagellar MS-ring protein [Candidatus Liberibacter asia
1yj7_A_69-171103 ESCJ; mixed alpha/beta, extended linker, protein t 99.96
1yj7_A_1-6868 ESCJ; mixed alpha/beta, extended linker, protein t 97.79
2hfv_A_97 Hypothetical protein RPA1041; NESG, GFT-alpha+beta 96.74
>1yj7_A (A:69-171) ESCJ; mixed alpha/beta, extended linker, protein transport; 1.80A {Escherichia coli} Back     alignment and structure
Probab=99.96  E-value=1e-29  Score=216.30  Aligned_cols=101  Identities=16%  Similarity=0.223  Sum_probs=95.2

Q ss_pred             HHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCCCCEEEEEECCCCCC-HHHHHHH
Q ss_conf             530588842599999999999999999999960576314899998336665555555871599970687789-8899999
Q gi|254780695|r  113 LFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV-YKSAEAI  191 (563)
Q Consensus       113 l~d~~~~~g~T~~~~~~~~~ralegeL~rtI~~~~~V~~ArV~l~~p~~~~f~~~~~~~sASV~l~~~~~l~-~~qv~~I  191 (563)
                      +|++ ++||+|+|+++++|+||||+||+|||++|+||++|||||++|++     ++.+|||||+|+++++.+ ++||.+|
T Consensus         2 lf~~-~~l~~T~~ee~~~~~~ale~eL~~ti~~i~gV~~ArV~i~~p~~-----~~~~~sASV~l~~~~g~~l~~qv~~I   75 (103)
T 1yj7_A            2 IFPP-SQLVASPSQENAKINYLKEQDIERLLSKIPGVIDCSVSLNVNNN-----ESQPSSAAVLVISSPEVNLAPSVIQI   75 (103)
T ss_dssp             HCC-------CHHHHHHHHHHHHHHHHHHHHTTSTTEEEEEEEEEC------------CEEEEEEEECTTCCCGGGHHHH
T ss_pred             HHCC-CCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEECCCC-----CCCCCCEEEEEECCCCCCCHHHHHHH
T ss_conf             8158-98768999999999999999999999816781378999957887-----78997428999618988889999999


Q ss_pred             HHHHHHHHHCCCCCCEEEEECCCCEEEC
Q ss_conf             9999865401883526998289835003
Q gi|254780695|r  192 RHLVAAAVPNLDMGDVTVLDSTGKLLTA  219 (563)
Q Consensus       192 ~~lVa~sV~gL~~e~VtVvD~~G~~L~~  219 (563)
                      ++|||+|||||++|||||+|++|++|++
T Consensus        76 ~~lVa~sV~gL~~enVtVvd~~g~~lsa  103 (103)
T 1yj7_A           76 KNLVKNSVDDLKLENISVVIKSSSGQDG  103 (103)
T ss_dssp             HHHHHHHSTTCCGGGEEEEEEECC----
T ss_pred             HHHHHHHCCCCCCCCEEEEECCCCCCCC
T ss_conf             9999972699991125999635877888



>1yj7_A (A:1-68) ESCJ; mixed alpha/beta, extended linker, protein transport; 1.80A {Escherichia coli} Back     alignment and structure
>2hfv_A (A:) Hypothetical protein RPA1041; NESG, GFT-alpha+beta, structural genomics, PSI-2, protein structure initiative; NMR {Pseudomonas aeruginosa} Back     alignment and structure