254780700

254780700

serine protease DO-like protease

GeneID in NCBI database:8209704Locus tag:CLIBASIA_02935
Protein GI in NCBI database:254780700Protein Accession:YP_003065113.1
Gene range:+(567333, 568802)Protein Length:489aa
Gene description:serine protease DO-like protease
COG prediction:[O] Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain
KEGG prediction:serine protease DO-like protease; K01362 [EC:3.4.21.-]
SEED prediction:putative serine protease
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------49
MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK
ccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHccccEEEEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccEEEEEEEccccEEEEEHHHcccccEEEEEEccccEEEEEEEEEcccccEEEEEEcccccccEEEcccccccccccEEEEEEcccccccEEEEEEEEEcccccccccccEEEEEccccccccccEEEcccccEEcccccccccccccccccccccHHHHHHHHHHHccccccccccccEEEEEccHHHHccccccccccEEEEEEccccHHHHcccccccEEEEEccEEcccHHHHHHHHHHcccccEEEEEEEEccEEEEEEEEEcccccccccccccccccccccEEEEccccccccEEEEEEEEcccccHHHHcccccccEEEEEccEEcccHHHHHHHHHHHHHccccEEEEEEEcccccccccccccEEEEEEccc
ccccHHHHHHHHHHHHHHHHHHcccHHHHHHccccccccHHHHHHHccccEEEEEEEcEEEccccccccccccccccccccccHHcHHHHccccccccccccccccccccccEEEEccccEEEEccEEEccccEEEEEEccccEEEEEEEcccccccEEEEEEcccccccEEEEccccccccccEEEEEccccccccEEEEEEEEccccccccccccEEEEccEEccccccccEEEcccEEEEEEEEEEccccccEEEEEEccHHHHHHHHHHHHHcccEEEcEEEEEEEcccHHHHHHcccccccccEEEEEccccHHHHcccccccEEEEEcccccccHHHHHHHHHccccccEEEEEEEEcccEEEEEEEEEccccccccccccccccccccEEEEcccHHHccccEEEEEEcccccHHHHcccccccEEEEEcccccccHHHHHHHHHHHccccccEEEEEEEEcccEEEEEcccEEEEEEEccc
mfkrqilsVKSICTVALTCVIFSSTYLVleaklppssvdlppviarvspsivSVMVEPKKKVSVEQMFNAygfgnlpedhplknyfrkdfhkffsgeepilsdtVERLmfgsgffitddgyiltsnhivedgasfsvilsddtelpaklvgtDALFDLAVLKvqsdrkfipvefedannirvgeavftignpfrlrgTVSAGIVSaldrdipdrpgtftqidapinqgnsggpcfnALGHVIGVNAMIVTSGQfhmgvgliiPLSIIKKAIPsliskgrvdhgwfgiMTQNLTQELaiplglrgtkgsLITAVVkespadkagmkvGDVICMLDGRIIKSHQDFVWQiasrspkeQVKISLCKEGSKHSVAVVLgssptakndmhlevgDKELLGMVLQDINDGNKKLVRIVAlnpnrerevEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIkydpdmqsgndnmSRFVSLKIDK
mfkrqilsvksiCTVALTCVIFSSTYLVLEAKlppssvdlppvIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPvefedannirvgeAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVkespadkagmkVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLgssptakndmHLEVGDKELLGMVLQDINDGNKKLVRivalnpnrereveakgiqkgmtivsvnthevsciKDVERLIgkakekkrdsvllqikydpdmqsgndnmsrfvslkidk
MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK
*********KSICTVALTCVIFSSTYL***********DLPPVIARVSPSIVSVM*************************PLKNYFR***************************FITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV**************************QD*****KK*VRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIG****KKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID*
MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK
***RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV*QM*NAYGFGNLPEDHPLKNYFRKDFHKFFS*************MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP*************ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK
MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK
MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target489 serine protease DO-like protease [Candidatus Liberibact
315121865490 serine protease DO-like protease [Candidatus Liberibact 1 1e-144
163759094523 protease precursor protein [Hoeflea phototrophica DFL-4 1 2e-83
325292355517 serine protease DO-like protease [Agrobacterium sp. H13 1 5e-82
15888320523 serine protease DO-like protease [Agrobacterium tumefac 1 2e-81
227821359521 serine protease do-like precursor [Sinorhizobium fredii 1 3e-81
150395861517 protease Do [Sinorhizobium medicae WSM419] Length = 517 1 4e-81
15964774504 protease precursor protein [Sinorhizobium meliloti 1021 1 7e-81
307309661517 protease Do [Sinorhizobium meliloti BL225C] Length = 51 1 8e-81
49475272503 Serine protease [Bartonella henselae str. Houston-1] Le 1 2e-79
239831455519 protease Do [Ochrobactrum intermedium LMG 3301] Length 1 2e-79
>gi|315121865|ref|YP_004062354.1| serine protease DO-like protease [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 490 Back     alignment and organism information
 Score =  515 bits (1326), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 271/493 (54%), Positives = 362/493 (73%), Gaps = 13/493 (2%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           MFK  ILS+++I    L  + F+ST  V EA++PPS+ DL P++ RVS S+VS++VEPKK
Sbjct: 1   MFKSHILSIRNISITVLMYIFFASTCFVAEARIPPST-DLVPIVERVSRSVVSILVEPKK 59

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
           +V  ++    YGF  LP+ +PLKNY     H FFS E    +   E+L  GSGFF+T++G
Sbjct: 60  EVLEKEFLKLYGFDTLPDSNPLKNYL----HNFFSNEGNESAGITEKLASGSGFFVTENG 115

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           Y+LTSNH+VE G SFSV+LSD+TE PAK++GTD + DLAVLKVQS++KF+PV+ ED+ N+
Sbjct: 116 YVLTSNHVVERGVSFSVVLSDNTEFPAKVIGTDPMSDLAVLKVQSNQKFVPVKLEDSGNV 175

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGH 240
            VGE VFTIG+P   RG+V+AGIVSA DR + D+ G++ QIDAPINQGNSGGPCFN  G+
Sbjct: 176 HVGETVFTIGDPLGFRGSVNAGIVSARDRVLADKSGSYIQIDAPINQGNSGGPCFNTSGN 235

Query: 241 VIGVNAMIVTSGQ--FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           VIGV+ +I+T+ +   ++G+GLI+P+S+IKK +PSLI KG VD GW G++ QNLTQELA 
Sbjct: 236 VIGVSDIIITNNESASNVGIGLIVPVSVIKKVLPSLIEKGFVDRGWMGVVVQNLTQELAR 295

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
           PLGL+G  G L+++ VK+SP+D+AG+K GDVIC +DG+IIK+  DFV +I S S K++V+
Sbjct: 296 PLGLKGGNGLLVSSTVKDSPSDRAGIKPGDVICAIDGQIIKNTHDFVGRILSHSSKDKVE 355

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKN-DMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPN 417
           I LCKEG   SV V L S P  K  D    +  K++LG+ LQD N G KK+VRIV ++  
Sbjct: 356 IRLCKEGGDRSVPVYLESYPLVKEGDAKQLLATKKILGLRLQDFNYGTKKIVRIVDMDLG 415

Query: 418 REREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGND 477
              E   KGIQKGM IVSVNT++VSCIKD+E LI +A+EK RD++LLQ+  D D +  ++
Sbjct: 416 --AEAVRKGIQKGMNIVSVNTNQVSCIKDIESLIEQAREKNRDTILLQLSVDNDAKFNSN 473

Query: 478 ---NMSRFVSLKI 487
              N   FVSLKI
Sbjct: 474 FYKNNVFFVSLKI 486


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163759094|ref|ZP_02166180.1| protease precursor protein [Hoeflea phototrophica DFL-43] Length = 523 Back     alignment and organism information
>gi|325292355|ref|YP_004278219.1| serine protease DO-like protease [Agrobacterium sp. H13-3] Length = 517 Back     alignment and organism information
>gi|15888320|ref|NP_354001.1| serine protease DO-like protease [Agrobacterium tumefaciens str. C58] Length = 523 Back     alignment and organism information
>gi|227821359|ref|YP_002825329.1| serine protease do-like precursor [Sinorhizobium fredii NGR234] Length = 521 Back     alignment and organism information
>gi|150395861|ref|YP_001326328.1| protease Do [Sinorhizobium medicae WSM419] Length = 517 Back     alignment and organism information
>gi|15964774|ref|NP_385127.1| protease precursor protein [Sinorhizobium meliloti 1021] Length = 504 Back     alignment and organism information
>gi|307309661|ref|ZP_07589313.1| protease Do [Sinorhizobium meliloti BL225C] Length = 517 Back     alignment and organism information
>gi|49475272|ref|YP_033313.1| Serine protease [Bartonella henselae str. Houston-1] Length = 503 Back     alignment and organism information
>gi|239831455|ref|ZP_04679784.1| protease Do [Ochrobactrum intermedium LMG 3301] Length = 519 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target489 serine protease DO-like protease [Candidatus Liberibact
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protease, D 2e-85
PRK10942473 PRK10942, PRK10942, serine endoprotease; Provisional 4e-46
PRK10139455 PRK10139, PRK10139, serine endoprotease; Provisional 2e-49
TIGR02038351 TIGR02038, protease_degS, periplasmic serine pepetdase 6e-40
PRK10898353 PRK10898, PRK10898, serine endoprotease; Provisional 1e-37
KOG1320473 KOG1320, KOG1320, KOG1320, Serine protease [Posttransla 2e-19
KOG1421 955 KOG1421, KOG1421, KOG1421, Predicted signaling-associat 2e-08
COG0265347 COG0265, DegQ, Trypsin-like serine proteases, typically 1e-54
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspin-lik 3e-13
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacterial a 6e-06
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO- 2e-05
cd0098679 cd00986, PDZ_LON_protease, PDZ domain of ATP-dependent 2e-04
TIGR00054420 TIGR00054, TIGR00054, RIP metalloprotease RseP 0.001
PRK10779449 PRK10779, PRK10779, zinc metallopeptidase RseP; Provisi 0.003
cd0099080 cd00990, PDZ_glycyl_aminopeptidase, PDZ domain associat 0.004
pfam00089218 pfam00089, Trypsin, Trypsin 4e-09
KOG1320473 KOG1320, KOG1320, KOG1320, Serine protease [Posttransla 3e-06
>gnl|CDD|162670 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|182855 PRK10942, PRK10942, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|182262 PRK10139, PRK10139, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|162671 TIGR02038, protease_degS, periplasmic serine pepetdase DegS Back     alignment and domain information
>gnl|CDD|182820 PRK10898, PRK10898, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|36534 KOG1320, KOG1320, KOG1320, Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|36635 KOG1421, KOG1421, KOG1421, Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|30614 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|29044 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|29046 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|128524 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|29043 cd00986, PDZ_LON_protease, PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>gnl|CDD|161683 TIGR00054, TIGR00054, RIP metalloprotease RseP Back     alignment and domain information
>gnl|CDD|182723 PRK10779, PRK10779, zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>gnl|CDD|29047 cd00990, PDZ_glycyl_aminopeptidase, PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>gnl|CDD|143870 pfam00089, Trypsin, Trypsin Back     alignment and domain information
>gnl|CDD|36534 KOG1320, KOG1320, KOG1320, Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 489 serine protease DO-like protease [Candidatus Liberibact
TIGR02037484 degP_htrA_DO protease Do; InterPro: IPR011782 Proteolyt 100.0
PRK10942474 serine endoprotease; Provisional 100.0
PRK10139455 serine endoprotease; Provisional 100.0
KOG1421 955 consensus 100.0
PRK10898355 serine endoprotease; Provisional 100.0
TIGR02038358 protease_degS periplasmic serine peptidase DegS; InterP 100.0
COG0265347 DegQ Trypsin-like serine proteases, typically periplasm 100.0
KOG1320473 consensus 100.0
KOG1320473 consensus 99.96
KOG1421955 consensus 99.83
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like serine p 99.73
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaeal zin 99.56
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON serine 99.56
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated with ar 99.45
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and plant z 99.25
PRK10779449 zinc metallopeptidase; Provisional 99.11
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processing-, 99.03
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis, out 98.99
TIGR00054463 TIGR00054 membrane-associated zinc metalloprotease, put 98.96
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Also cal 98.73
PRK11186 673 carboxy-terminal protease; Provisional 98.66
KOG3580 1027 consensus 98.63
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous region) 98.62
COG3975558 Predicted protease with the C-terminal PDZ domain [Gene 98.56
pfam0059580 PDZ PDZ domain (Also known as DHR or GLGF). PDZ domains 98.55
KOG3580 1027 consensus 98.39
COG3480342 SdrC Predicted secreted protein containing a PDZ domain 98.22
cd0099282 PDZ_signaling PDZ domain found in a variety of Eumetazo 98.09
KOG3129231 consensus 97.94
COG3031275 PulC Type II secretory pathway, component PulC [Intrace 97.59
pfam04495280 GRASP55_65 GRASP55/65 family. GRASP55 (Golgi reassembly 97.24
KOG3532 1051 consensus 96.24
TIGR00225 361 prc C-terminal processing peptidase; InterPro: IPR00444 96.09
KOG2921484 consensus 96.05
KOG3571 626 consensus 95.07
KOG1892 1629 consensus 94.07
KOG3550207 consensus 93.96
PRK10779 449 zinc metallopeptidase; Provisional 99.67
TIGR00054 463 TIGR00054 membrane-associated zinc metalloprotease, put 99.41
KOG3209984 consensus 99.27
KOG3209 984 consensus 99.13
KOG3834 462 consensus 98.82
KOG3605829 consensus 98.59
KOG43711332 consensus 94.88
TIGR02037484 degP_htrA_DO protease Do; InterPro: IPR011782 Proteolyt 99.39
pfam00089218 Trypsin Trypsin. 99.21
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of these ar 98.4
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of these ar 98.31
COG3591251 V8-like Glu-specific endopeptidase [Amino acid transpor 98.23
pfam00863233 Peptidase_C4 Peptidase family C4. This peptidase is pre 98.06
pfam05579426 Peptidase_S32 Equine arteritis virus serine endopeptida 97.39
pfam03761280 DUF316 Domain of unknown function (DUF316). This family 94.66
pfam02122203 Peptidase_S39 Peptidase S39. This family contains polyp 92.81
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like serine p 99.13
PRK10139455 serine endoprotease; Provisional 99.09
PRK10942474 serine endoprotease; Provisional 99.04
PRK10898355 serine endoprotease; Provisional 99.02
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaeal zin 98.94
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and plant z 98.75
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON serine 98.68
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processing-, 98.59
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated with ar 98.5
TIGR02038358 protease_degS periplasmic serine peptidase DegS; InterP 98.49
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Also cal 98.39
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous region) 98.34
COG0265347 DegQ Trypsin-like serine proteases, typically periplasm 98.24
cd0099282 PDZ_signaling PDZ domain found in a variety of Eumetazo 98.09
pfam0059580 PDZ PDZ domain (Also known as DHR or GLGF). PDZ domains 98.01
TIGR01713281 typeII_sec_gspC general secretion pathway protein C; In 97.53
PRK09681319 putative type II secretion protein GspC; Provisional 97.23
KOG3542 1283 consensus 96.53
KOG3553124 consensus 96.5
KOG3532 1051 consensus 96.46
KOG3129231 consensus 96.38
COG3031275 PulC Type II secretory pathway, component PulC [Intrace 96.15
KOG1892 1629 consensus 96.15
COG3975558 Predicted protease with the C-terminal PDZ domain [Gene 95.91
KOG3605829 consensus 95.59
KOG3571 626 consensus 94.99
KOG0606 1205 consensus 94.62
KOG3550207 consensus 94.41
KOG3551 506 consensus 94.34
KOG2921 484 consensus 94.32
KOG3552 1298 consensus 94.05
KOG3606358 consensus 93.53
TIGR02860 423 spore_IV_B stage IV sporulation protein B; InterPro: IP 98.73
PRK09681319 putative type II secretion protein GspC; Provisional 97.29
COG0750375 Predicted membrane-associated Zn-dependent proteases 1 94.86
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacterial-sp 98.31
KOG3553124 consensus 97.16
KOG3542 1283 consensus 96.91
KOG0606 1205 consensus 94.92
COG5233417 GRH1 Peripheral Golgi membrane protein [Intracellular t 92.36
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis, out 98.29
KOG3651429 consensus 94.07
KOG0609542 consensus 91.06
TIGR02860423 spore_IV_B stage IV sporulation protein B; InterPro: IP 98.19
pfam10459 696 Peptidase_S46 Peptidase S46. Dipeptidyl-peptidase 7 (DP 97.84
TIGR03279433 cyano_FeS_chp putative FeS-containing Cyanobacterial-sp 97.47
PRK11186673 carboxy-terminal protease; Provisional 98.03
pfam10459 696 Peptidase_S46 Peptidase S46. Dipeptidyl-peptidase 7 (DP 97.06
COG3480342 SdrC Predicted secreted protein containing a PDZ domain 96.95
TIGR00225361 prc C-terminal processing peptidase; InterPro: IPR00444 94.1
TIGR01713281 typeII_sec_gspC general secretion pathway protein C; In 97.8
pfam09342267 DUF1986 Domain of unknown function (DUF1986). This doma 95.88
KOG3606358 consensus 94.58
KOG0609542 consensus 93.84
pfam11874183 DUF3394 Domain of unknown function (DUF3394). This doma 92.59
KOG3549505 consensus 92.51
>TIGR02037 degP_htrA_DO protease Do; InterPro: IPR011782 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>KOG1421 consensus Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine peptidase DegS; InterPro: IPR011783 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1320 consensus Back     alignment and domain information
>KOG1320 consensus Back     alignment and domain information
>KOG1421 consensus Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>PRK10779 zinc metallopeptidase; Provisional Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00054 TIGR00054 membrane-associated zinc metalloprotease, putative; InterPro: IPR004387 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG3580 consensus Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>pfam00595 PDZ PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>KOG3580 consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>KOG3129 consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>pfam04495 GRASP55_65 GRASP55/65 family Back     alignment and domain information
>KOG3532 consensus Back     alignment and domain information
>TIGR00225 prc C-terminal processing peptidase; InterPro: IPR004447 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>KOG2921 consensus Back     alignment and domain information
>KOG3571 consensus Back     alignment and domain information
>KOG1892 consensus Back     alignment and domain information
>KOG3550 consensus Back     alignment and domain information
>PRK10779 zinc metallopeptidase; Provisional Back     alignment and domain information
>TIGR00054 TIGR00054 membrane-associated zinc metalloprotease, putative; InterPro: IPR004387 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>KOG3209 consensus Back     alignment and domain information
>KOG3209 consensus Back     alignment and domain information
>KOG3834 consensus Back     alignment and domain information
>KOG3605 consensus Back     alignment and domain information
>KOG4371 consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO protease Do; InterPro: IPR011782 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>pfam00089 Trypsin Trypsin Back     alignment and domain information
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam00863 Peptidase_C4 Peptidase family C4 Back     alignment and domain information
>pfam05579 Peptidase_S32 Equine arteritis virus serine endopeptidase S32 Back     alignment and domain information
>pfam03761 DUF316 Domain of unknown function (DUF316) Back     alignment and domain information
>pfam02122 Peptidase_S39 Peptidase S39 Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine peptidase DegS; InterPro: IPR011783 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>pfam00595 PDZ PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C; InterPro: IPR001639 The general (type II) secretion pathway (GSP) within Gram-negative bacteria is a signal sequence-dependent process responsible for protein export , , Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>KOG3542 consensus Back     alignment and domain information
>KOG3553 consensus Back     alignment and domain information
>KOG3532 consensus Back     alignment and domain information
>KOG3129 consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1892 consensus Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG3605 consensus Back     alignment and domain information
>KOG3571 consensus Back     alignment and domain information
>KOG0606 consensus Back     alignment and domain information
>KOG3550 consensus Back     alignment and domain information
>KOG3551 consensus Back     alignment and domain information
>KOG2921 consensus Back     alignment and domain information
>KOG3552 consensus Back     alignment and domain information
>KOG3606 consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B; InterPro: IPR014219 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>KOG3553 consensus Back     alignment and domain information
>KOG3542 consensus Back     alignment and domain information
>KOG0606 consensus Back     alignment and domain information
>COG5233 GRH1 Peripheral Golgi membrane protein [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3651 consensus Back     alignment and domain information
>KOG0609 consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B; InterPro: IPR014219 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>pfam10459 Peptidase_S46 Peptidase S46 Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>pfam10459 Peptidase_S46 Peptidase S46 Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00225 prc C-terminal processing peptidase; InterPro: IPR004447 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C; InterPro: IPR001639 The general (type II) secretion pathway (GSP) within Gram-negative bacteria is a signal sequence-dependent process responsible for protein export , , Back     alignment and domain information
>pfam09342 DUF1986 Domain of unknown function (DUF1986) Back     alignment and domain information
>KOG3606 consensus Back     alignment and domain information
>KOG0609 consensus Back     alignment and domain information
>pfam11874 DUF3394 Domain of unknown function (DUF3394) Back     alignment and domain information
>KOG3549 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target489 serine protease DO-like protease [Candidatus Liberibact
3mh5_A456 Htra Proteases Are Activated By A Conserved Mechani 5e-44
2zle_A448 Cryo-Em Structure Of Degp12OMP Length = 448 5e-44
3mh4_A456 Htra Proteases Are Activated By A Conserved Mechani 5e-44
3otp_A459 Crystal Structure Of The Degp Dodecamer With A Mode 6e-44
3cs0_A448 Crystal Structure Of Degp24 Length = 448 1e-40
3mh7_A456 Htra Proteases Are Activated By A Conserved Mechani 1e-40
1ky9_A448 Crystal Structure Of Degp (Htra) Length = 448 1e-40
1l1j_A239 Crystal Structure Of The Protease Domain Of An Atp- 4e-16
1lcy_A325 Crystal Structure Of The Mitochondrial Serine Prote 5e-05
3nzi_A334 Substrate Induced Remodeling Of The Active Site Reg 7e-08
3nwu_A227 Substrate Induced Remodeling Of The Active Site Reg 7e-08
3num_A332 Substrate Induced Remodeling Of The Active Site Reg 7e-08
3lgi_A237 Structure Of The Protease Domain Of Degs (Degs-Delt 2e-06
2qf3_A243 Structure Of The Delta Pdz Truncation Of The Degs P 2e-06
3lh3_A241 Dfp Modified Degs Delta Pdz Length = 241 2e-06
2rce_A243 Dfp Modified Degs Delta Pdz Length = 243 2e-06
3lgy_A241 R178a Mutant Of The Degs-Deltapdz Protease Length = 2e-06
2qgr_A243 Structure Of The R178a Mutant Of Delta Pdz Degs Pro 2e-06
3lh1_A241 Q191a Mutant Of The Degs-Deltapdz Length = 241 2e-06
3b8j_A243 Q191a Mutant Of Degs-Deltapdz Length = 243 2e-06
3lgu_A241 Y162a Mutant Of The Degs-Deltapdz Protease Length = 2e-06
3lgv_A241 H198p Mutant Of The Degs-Deltapdz Protease Length = 3e-06
3lgw_A241 H198pT167V DOUBLE MUTANT OF DEGS-Deltapdz Protease 3e-06
2r3u_A211 Crystal Structure Of The Pdz Deletion Mutant Of Deg 3e-06
3lgt_A241 Y162aH198P DOUBLE MUTANT OF DEGS-Deltapdz Protease 4e-06
2qf0_A243 Structure Of The Delta Pdz Truncation Of The Degs P 4e-06
1lcy_A325 Crystal Structure Of The Mitochondrial Serine Prote 4e-08
3nzi_A334 Substrate Induced Remodeling Of The Active Site Reg 2e-07
3num_A332 Substrate Induced Remodeling Of The Active Site Reg 2e-07
2pzd_A113 Crystal Structure Of The Htra2OMI PDZ DOMAIN BOUND 7e-08
2p3w_A112 Crystal Structure Of The Htra3 Pdz Domain Bound To 1e-07
1wh1_A124 Solution Structure Of The Fourth Pdz Domain Of Kiaa 2e-07
1uf1_A128 Solution Structure Of The Second Pdz Domain Of Huma 2e-07
2ytw_A118 Solution Structure Of The Pdz-Domain Of Human Prote 2e-07
3qo6_A348 Crystal Structure Analysis Of The Plant Protease De 3e-07
2joa_A105 Htra1 Bound To An Optimized Peptide: Nmr Assignment 5e-07
1x5q_A110 Solution Structure Of The First Pdz Domain Of Scrib 1e-06
2w4f_A97 Crystal Structure Of The First Pdz Domain Of Human 2e-06
1sot_A320 Crystal Structure Of The Degs Stress Sensor Length 1e-05
1wi2_A104 Solution Structure Of The Pdz Domain From Riken Cdn 2e-06
1fc7_A 388 Photosystem Ii D1 C-Terminal Processing Protease Le 2e-06
1fc6_A 388 Photosystem Ii D1 C-Terminal Processing Protease Le 2e-06
2o2t_A117 The Crystal Structure Of The 1st Pdz Domain Of Mpdz 4e-06
1uez_A101 Solution Structure Of The First Pdz Domain Of Human 5e-06
2dm8_A116 Solution Structure Of The Eighth Pdz Domain Of Huma 6e-06
2he4_A90 The Crystal Structure Of The Second Pdz Domain Of H 6e-06
2d90_A102 Solution Structure Of The Third Pdz Domain Of Pdz D 7e-06
2eeh_A100 Solution Structure Of First Pdz Domain Of Pdz Domai 9e-06
3id4_A93 Crystal Structure Of Rsep Pdz2 Domain Fused Gkaspv 1e-05
3id3_A89 Crystal Structure Of Rsep Pdz2 I304a Domain Length 1e-05
3id2_A90 Crystal Structure Of Rsep Pdz2 Domain Length = 90 1e-05
2eei_A106 Solution Structure Of Second Pdz Domain Of Pdz Doma 1e-05
2qg1_A92 Crystal Structure Of The 11th Pdz Domain Of Mpdz (M 1e-05
2dls_A93 Solution Structure Of The Pdz Domain Of Human Rho G 1e-05
1i92_A91 Structural Basis Of The Nherf Pdz1-Cftr Interaction 1e-05
1gq4_A90 Structural Determinants Of The Nherf Interaction Wi 1e-05
1gq5_A91 Structural Determinants Of The Nherf Interaction Wi 1e-05
1g9o_A91 First Pdz Domain Of The Human Na+H+ EXCHANGER REGUL 1e-05
2krg_A 216 Solution Structure Of Human Sodium HYDROGEN EXCHANG 2e-05
2vz5_A139 Structure Of The Pdz Domain Of Tax1 (Human T-Cell L 2e-05
2kjd_A128 Solution Structure Of Extended Pdz2 Domain From Nhe 2e-05
2jxo_A98 Structure Of The Second Pdz Domain Of Nherf-1 Lengt 2e-05
2kg2_A124 Solution Structure Of A Pdz Protein Length = 124 3e-05
2ozf_A92 The Crystal Structure Of The 2nd Pdz Domain Of The 3e-05
3qdo_A109 Crystal Structure Of Pdz Domain Of Sorting Nexin 27 3e-05
2omj_A89 Solution Structure Of Larg Pdz Domain Length = 89 4e-05
3diw_A124 C-Terminal Beta-Catenin Bound Tip-1 Structure Lengt 4e-05
3gj9_A124 Crystal Structure Of Tip-1 In Complex With C-Termin 4e-05
1x5n_A114 Solution Structure Of The Second Pdz Domain Of Harm 4e-05
2wl7_A102 Crystal Structure Of The Psd93 Pdz1 Domain Length = 5e-05
3qgl_A101 Crystal Structure Of Pdz Domain Of Sorting Nexin 27 5e-05
3qe1_A107 Crystal Structure Of Pdz Domain Of Sorting Nexin 27 5e-05
3dj3_A113 Crystal Structure Of C-Terminal Truncated Tip-1 (6- 6e-05
3khf_A99 The Crystal Structure Of The Pdz Domain Of Human Mi 6e-05
2zpm_A91 Crystal Structure Analysis Of Pdz Domain B Length = 7e-05
1wha_A105 Solution Structure Of The Second Pdz Domain Of Huma 1e-04
2kqf_A96 Solution Structure Of Mast205-Pdz Complexed With Th 1e-04
2w7r_A98 Structure Of The Pdz Domain Of Human Microtubule As 1e-04
2kbs_A92 Solution Structure Of Harmonin Pdz2 In Complex With 1e-04
1uew_A114 Solution Structure Of The Forth Pdz Domain Of Human 2e-04
2yub_A118 Solution Structure Of The Pdz Domain From Mouse Lim 2e-04
1be9_A119 The Third Pdz Domain From The Synaptic Protein Psd- 2e-04
1wfv_A103 Solution Structure Of The Fifth Pdz Domain Of Human 2e-04
2ocs_A88 The Crystal Structure Of The First Pdz Domain Of Hu 2e-04
3gcn_A340 Crystal Structure Of Degs H198pD320A MUTANT MODIFIE 2e-07
1soz_A314 Crystal Structure Of Degs Protease In Complex With 2e-07
1te0_A318 Structural Analysis Of Degs, A Stress Sensor Of The 9e-07
3gcn_A340 Crystal Structure Of Degs H198pD320A MUTANT MODIFIE 2e-05
1soz_A314 Crystal Structure Of Degs Protease In Complex With 1e-05
1te0_A318 Structural Analysis Of Degs, A Stress Sensor Of The 1e-05
3qo6_A348 Crystal Structure Analysis Of The Plant Protease De 9e-04
1sot_A320 Crystal Structure Of The Degs Stress Sensor Length 2e-06
>gi|299856797|pdb|3MH5|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
 Score =  183 bits (464), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 125/455 (27%), Positives = 212/455 (46%), Gaps = 17/455 (3%)

Query: 26  YLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNY 85
                A        L P++ +V PS+VS+ VE    V+  +M   +      +D P    
Sbjct: 1   AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQ-QFFGDDSPFCQE 59

Query: 86  FRKDFHKFF---SGEEPILSDTVERLMFGSGFFITDD-GYILTSNHIVEDGASFSVILSD 141
                   F              + +  GSG  I  D GY++T+NH+V++     V LSD
Sbjct: 60  GSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSD 119

Query: 142 DTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSA 201
             +  AK+VG D   D+A++++Q+ +    ++  D++ +RVG+    IGNPF L  TV++
Sbjct: 120 GRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTS 179

Query: 202 GIVSALDRDIPD--RPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVG 259
           GIVSAL R   +      F Q DA IN+GNSGG   N  G +IG+N  I+     ++G+G
Sbjct: 180 GIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIG 239

Query: 260 LIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPA 319
             IP +++K     ++  G+V  G  GIM   L  ELA  + +   +G+ ++ V+  S A
Sbjct: 240 FAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSA 299

Query: 320 DKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT 379
            KAG+K GDVI  L+G+ I S      Q+ +     ++ + L ++G + +V + L    +
Sbjct: 300 AKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQ--S 357

Query: 380 AKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTH 439
           ++N +        + G  + +      K   +V  N          G++KG  I+  N  
Sbjct: 358 SQNQVDSSSIFNGIEGAEMSN----KGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQ 413

Query: 440 EVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
            V  I ++ +++    + K   + L I+       
Sbjct: 414 AVKNIAELRKVL----DSKPSVLALNIQRGDSTIY 444


>gi|189339589|pdb|2ZLE|A Chain A, Cryo-Em Structure Of Degp12OMP Length = 448 Back     alignment and structure
>gi|299856795|pdb|3MH4|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>gi|319443676|pdb|3OTP|A Chain A, Crystal Structure Of The Degp Dodecamer With A Model Substrate Length = 459 Back     alignment and structure
>gi|189096226|pdb|3CS0|A Chain A, Crystal Structure Of Degp24 Length = 448 Back     alignment and structure
>gi|299856800|pdb|3MH7|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>gi|20151110|pdb|1KY9|A Chain A, Crystal Structure Of Degp (Htra) Length = 448 Back     alignment and structure
>gi|29726369|pdb|1L1J|A Chain A, Crystal Structure Of The Protease Domain Of An Atp- Independent Heat Shock Protease Htra Length = 239 Back     alignment and structure
>gi|21466051|pdb|1LCY|A Chain A, Crystal Structure Of The Mitochondrial Serine Protease Htra2 Length = 325 Back     alignment and structure
>gi|323714490|pdb|3NZI|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 334 Back     alignment and structure
>gi|323714486|pdb|3NWU|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 227 Back     alignment and structure
>gi|323714485|pdb|3NUM|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 332 Back     alignment and structure
>gi|304445857|pdb|3LGI|A Chain A, Structure Of The Protease Domain Of Degs (Degs-Deltapdz) At 1.65 A Length = 237 Back     alignment and structure
>gi|162330034|pdb|2QF3|A Chain A, Structure Of The Delta Pdz Truncation Of The Degs Protease Length = 243 Back     alignment and structure
>gi|304445874|pdb|3LH3|A Chain A, Dfp Modified Degs Delta Pdz Length = 241 Back     alignment and structure
>gi|162330111|pdb|2RCE|A Chain A, Dfp Modified Degs Delta Pdz Length = 243 Back     alignment and structure
>gi|304445872|pdb|3LGY|A Chain A, R178a Mutant Of The Degs-Deltapdz Protease Length = 241 Back     alignment and structure
>gi|162330037|pdb|2QGR|A Chain A, Structure Of The R178a Mutant Of Delta Pdz Degs Protease Length = 243 Back     alignment and structure
>gi|304445873|pdb|3LH1|A Chain A, Q191a Mutant Of The Degs-Deltapdz Length = 241 Back     alignment and structure
>gi|203282366|pdb|3B8J|A Chain A, Q191a Mutant Of Degs-Deltapdz Length = 243 Back     alignment and structure
>gi|304445861|pdb|3LGU|A Chain A, Y162a Mutant Of The Degs-Deltapdz Protease Length = 241 Back     alignment and structure
>gi|304445862|pdb|3LGV|A Chain A, H198p Mutant Of The Degs-Deltapdz Protease Length = 241 Back     alignment and structure
>gi|304445871|pdb|3LGW|A Chain A, H198pT167V DOUBLE MUTANT OF DEGS-Deltapdz Protease Length = 241 Back     alignment and structure
>gi|161172200|pdb|2R3U|A Chain A, Crystal Structure Of The Pdz Deletion Mutant Of Degs Length = 211 Back     alignment and structure
>gi|304445860|pdb|3LGT|A Chain A, Y162aH198P DOUBLE MUTANT OF DEGS-Deltapdz Protease Length = 241 Back     alignment and structure
>gi|162330025|pdb|2QF0|A Chain A, Structure Of The Delta Pdz Truncation Of The Degs Protease Length = 243 Back     alignment and structure
>gi|21466051|pdb|1LCY|A Chain A, Crystal Structure Of The Mitochondrial Serine Protease Htra2 Length = 325 Back     alignment and structure
>gi|323714490|pdb|3NZI|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 334 Back     alignment and structure
>gi|323714485|pdb|3NUM|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 332 Back     alignment and structure
>gi|157835814|pdb|2PZD|A Chain A, Crystal Structure Of The Htra2OMI PDZ DOMAIN BOUND TO A Phage-Derived Ligand (Wtmfwv) Length = 113 Back     alignment and structure
>gi|160285756|pdb|2P3W|A Chain A, Crystal Structure Of The Htra3 Pdz Domain Bound To A Phage- Derived Ligand (Fgrwv) Length = 112 Back     alignment and structure
>gi|159163341|pdb|1WH1|A Chain A, Solution Structure Of The Fourth Pdz Domain Of Kiaa1095 Protein Length = 124 Back     alignment and structure
>gi|159163122|pdb|1UF1|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Kiaa1526 Protein Length = 128 Back     alignment and structure
>gi|178847412|pdb|2YTW|A Chain A, Solution Structure Of The Pdz-Domain Of Human Protease Htra 1 Precursor Length = 118 Back     alignment and structure
>gi|332138234|pdb|3QO6|A Chain A, Crystal Structure Analysis Of The Plant Protease Deg1 Length = 348 Back     alignment and structure
>gi|160877664|pdb|2JOA|A Chain A, Htra1 Bound To An Optimized Peptide: Nmr Assignment Of Pdz Domain And Ligand Resonances Length = 105 Back     alignment and structure
>gi|159163574|pdb|1X5Q|A Chain A, Solution Structure Of The First Pdz Domain Of Scribble Homolog Protein (Hscrib) Length = 110 Back     alignment and structure
>gi|217035285|pdb|2W4F|A Chain A, Crystal Structure Of The First Pdz Domain Of Human Scrib1 Length = 97 Back     alignment and structure
>gi|49259097|pdb|1SOT|A Chain A, Crystal Structure Of The Degs Stress Sensor Length = 320 Back     alignment and structure
>gi|159163370|pdb|1WI2|A Chain A, Solution Structure Of The Pdz Domain From Riken Cdna 2700099c19 Length = 104 Back     alignment and structure
>gi|13096475|pdb|1FC7|A Chain A, Photosystem Ii D1 C-Terminal Processing Protease Length = 388 Back     alignment and structure
>gi|13096474|pdb|1FC6|A Chain A, Photosystem Ii D1 C-Terminal Processing Protease Length = 388 Back     alignment and structure
>gi|122921327|pdb|2O2T|A Chain A, The Crystal Structure Of The 1st Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>gi|159163120|pdb|1UEZ|A Chain A, Solution Structure Of The First Pdz Domain Of Human Kiaa1526 Protein Length = 101 Back     alignment and structure
>gi|159164214|pdb|2DM8|A Chain A, Solution Structure Of The Eighth Pdz Domain Of Human Inad- Like Protein Length = 116 Back     alignment and structure
>gi|112491310|pdb|2HE4|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Nherf-2 (Slc9a3r2) Interacting With A Mode 1 Pdz Binding Motif Length = 90 Back     alignment and structure
>gi|159164003|pdb|2D90|A Chain A, Solution Structure Of The Third Pdz Domain Of Pdz Domain Containing Protein 1 Length = 102 Back     alignment and structure
>gi|159794776|pdb|2EEH|A Chain A, Solution Structure Of First Pdz Domain Of Pdz Domain Containing Protein 7 Length = 100 Back     alignment and structure
>gi|255918016|pdb|3ID4|A Chain A, Crystal Structure Of Rsep Pdz2 Domain Fused Gkaspv Peptide Length = 93 Back     alignment and structure
>gi|255918014|pdb|3ID3|A Chain A, Crystal Structure Of Rsep Pdz2 I304a Domain Length = 89 Back     alignment and structure
>gi|255918012|pdb|3ID2|A Chain A, Crystal Structure Of Rsep Pdz2 Domain Length = 90 Back     alignment and structure
>gi|168988594|pdb|2EEI|A Chain A, Solution Structure Of Second Pdz Domain Of Pdz Domain Containing Protein 1 Length = 106 Back     alignment and structure
>gi|157835914|pdb|2QG1|A Chain A, Crystal Structure Of The 11th Pdz Domain Of Mpdz (Mupp1) Length = 92 Back     alignment and structure
>gi|159164200|pdb|2DLS|A Chain A, Solution Structure Of The Pdz Domain Of Human Rho Guanine Nucleotide Exchange Factor 11 Length = 93 Back     alignment and structure
>gi|14719565|pdb|1I92|A Chain A, Structural Basis Of The Nherf Pdz1-Cftr Interaction Length = 91 Back     alignment and structure
>gi|21465489|pdb|1GQ4|A Chain A, Structural Determinants Of The Nherf Interaction With Beta2ar And Pdgfr Length = 90 Back     alignment and structure
>gi|27065015|pdb|1GQ5|A Chain A, Structural Determinants Of The Nherf Interaction With Beta2- Ar And Pdgfr Length = 91 Back     alignment and structure
>gi|14488759|pdb|1G9O|A Chain A, First Pdz Domain Of The Human Na+H+ EXCHANGER REGULATORY Factor Length = 91 Back     alignment and structure
>gi|282403526|pdb|2KRG|A Chain A, Solution Structure Of Human Sodium HYDROGEN EXCHANGE Regulatory Factor 1(150-358) Length = 216 Back     alignment and structure
>gi|196049685|pdb|2VZ5|A Chain A, Structure Of The Pdz Domain Of Tax1 (Human T-Cell Leukemia Virus Type I) Binding Protein 3 Length = 139 Back     alignment and structure
>gi|282403523|pdb|2KJD|A Chain A, Solution Structure Of Extended Pdz2 Domain From Nherf1 (150- 270) Length = 128 Back     alignment and structure
>gi|217035216|pdb|2JXO|A Chain A, Structure Of The Second Pdz Domain Of Nherf-1 Length = 98 Back     alignment and structure
>gi|284055340|pdb|2KG2|A Chain A, Solution Structure Of A Pdz Protein Length = 124 Back     alignment and structure
>gi|145580334|pdb|2OZF|A Chain A, The Crystal Structure Of The 2nd Pdz Domain Of The Human Nherf-1 (Slc9a3r1) Length = 92 Back     alignment and structure
>gi|326328030|pdb|3QDO|A Chain A, Crystal Structure Of Pdz Domain Of Sorting Nexin 27 (Snx27) Fused To The Gly-Gly Linker Followed By C-Terminal (Eseskv) Of Girk3 Length = 109 Back     alignment and structure
>gi|166007052|pdb|2OMJ|A Chain A, Solution Structure Of Larg Pdz Domain Length = 89 Back     alignment and structure
gi|209870453|pdb|3DIW|A Chain A, C-Terminal Beta-Catenin Bound Tip-1 Structure Length = 124 Back     alignment and structure
gi|281307039|pdb|3GJ9|A Chain A, Crystal Structure Of Tip-1 In Complex With C-Terminal Of Kir2.3 Length = 124 Back     alignment and structure
>gi|159163571|pdb|1X5N|A Chain A, Solution Structure Of The Second Pdz Domain Of Harmonin Protein Length = 114 Back     alignment and structure
>gi|284055363|pdb|2WL7|A Chain A, Crystal Structure Of The Psd93 Pdz1 Domain Length = 102 Back     alignment and structure
>gi|326328038|pdb|3QGL|A Chain A, Crystal Structure Of Pdz Domain Of Sorting Nexin 27 (Snx27) In Complex With The Eseskv Peptide Corresponding To The C-Terminal Tail Of Girk3 Length = 101 Back     alignment and structure
>gi|209870459|pdb|3DJ3|A Chain A, Crystal Structure Of C-Terminal Truncated Tip-1 (6-113) Length = 113 Back     alignment and structure
>gi|270346732|pdb|3KHF|A Chain A, The Crystal Structure Of The Pdz Domain Of Human Microtubule Associated SerineTHREONINE KINASE 3 (MAST3) Length = 99 Back     alignment and structure
>gi|209870320|pdb|2ZPM|A Chain A, Crystal Structure Analysis Of Pdz Domain B Length = 91 Back     alignment and structure
>gi|159163350|pdb|1WHA|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 105 Back     alignment and structure
>gi|311771866|pdb|2KQF|A Chain A, Solution Structure Of Mast205-Pdz Complexed With The C-Terminus Of A Rabies Virus G Protein Length = 96 Back     alignment and structure
>gi|237640404|pdb|2W7R|A Chain A, Structure Of The Pdz Domain Of Human Microtubule Associated Serine-Threonine Kinase 4 Length = 98 Back     alignment and structure
>gi|226192562|pdb|2KBS|A Chain A, Solution Structure Of Harmonin Pdz2 In Complex With The Carboxyl Tail Peptide Of Cadherin23 Length = 92 Back     alignment and structure
>gi|159163118|pdb|1UEW|A Chain A, Solution Structure Of The Forth Pdz Domain Of Human Atrophin-1 Interacting Protein 1 (Kiaa0705 Protein) Length = 114 Back     alignment and structure
>gi|178847415|pdb|2YUB|A Chain A, Solution Structure Of The Pdz Domain From Mouse Lim Domain Kinase Length = 118 Back     alignment and structure
>gi|3891677|pdb|1BE9|A Chain A, The Third Pdz Domain From The Synaptic Protein Psd-95 In Complex With A C-Terminal Peptide Derived From Cript. Length = 119 Back     alignment and structure
>gi|159163311|pdb|1WFV|A Chain A, Solution Structure Of The Fifth Pdz Domain Of Human Membrane Associated Guanylate Kinase Inverted-2 (Kiaa0705 Protein) Length = 103 Back     alignment and structure
>gi|126031518|pdb|2OCS|A Chain A, The Crystal Structure Of The First Pdz Domain Of Human Nherf-2 (Slc9a3r2) Length = 88 Back     alignment and structure
>gi|226192717|pdb|3GCN|A Chain A, Crystal Structure Of Degs H198pD320A MUTANT MODIFIED BY Dfp In Complex With Omp Peptide (Yqf) Length = 340 Back     alignment and structure