254780699

254780699

hypothetical protein CLIBASIA_02930

GeneID in NCBI database:8209703Locus tag:CLIBASIA_02930
Protein GI in NCBI database:254780699Protein Accession:YP_003065112.1
Gene range:-(568925, 569218)Protein Length:97aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------
MLFDNQFIENILKEDREDNNIKSLAQLQRIAIRTVLANRTKNIKSITKEFMEYWIAHSSRAWRTSKPRTYLNLHIASQSKKIPVSIYIGNIQKNKKI
ccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHccccccEEEEEEEEcccccccEEEEEEcccccccc
ccccHHHHHHHHHHccHcccHHHHHHHHHHHHHHHHHHHcHcHHHHHHHHHHHHHHHccccHcccccccEEEEEEEcccccccEEEEEEEccccccc
MLFDNQFIENILkedrednniKSLAQLQRIAIRTVLANRTKNIKSITKEFMEYWIAHSSrawrtskprtylnLHIASQSKKIPVSIYIGniqknkki
MLFDNQFIENIlkedrednniKSLAQLQRIAIRTVLANRTKNIKSITKEFMEYWIAHSSRAWRTSKPRTYLNLhiasqskkipvsiyigniqknkki
MLFDNQFIENILKEDREDNNIKSLAQLQRIAIRTVLANRTKNIKSITKEFMEYWIAHSSRAWRTSKPRTYLNLHIASQSKKIPVSIYIGNIQKNKKI
***DNQFIENIL************AQLQRIAIRTVLANRTKNIKSITKEFMEYWIAHSSRAWRTSKPRTYLNLHIASQSKKIPVSIYIGNIQ*****
MLFDNQFIENILKEDREDNNIKSLAQLQRIAIRTVLANRTKNIKSITKEFMEYWIAHSSRAWRTSKPRTYLNLHIASQSKKIPVSIYIGNIQKNKKI
MLFDNQFIENILKEDREDNNIKSLAQLQRIAIRTVLANRTKNIKSITKEFMEYWIAHSSRAWRTSKPRTYLNLHIASQSKKIPVSIYIGNIQK****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLFDNQFIENILKEDREDNNIKSLAQLQRIAIRTVLANRTKNIKSITKEFMEYWIAHSSRAWRTSKPRTYLNLHIASQSKKIPVSIYIGNIQKNKKI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target97 hypothetical protein CLIBASIA_02930 [Candidatus Liberib
315121864101 hypothetical protein CKC_00570 [Candidatus Liberibacter 1 1e-28
>gi|315121864|ref|YP_004062353.1| hypothetical protein CKC_00570 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 101 Back     alignment and organism information
 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 81/95 (85%), Gaps = 1/95 (1%)

Query: 1  MLFDNQFIENILKEDREDNNIKSLAQ-LQRIAIRTVLANRTKNIKSITKEFMEYWIAHSS 59
          M FDNQF+ENILK+ R++N  KSL+Q LQ IA+  +LANRTKNIKSITKEF+EYW+ ++S
Sbjct: 1  MAFDNQFLENILKKSRKENLNKSLSQALQGIALHAILANRTKNIKSITKEFIEYWMTYNS 60

Query: 60 RAWRTSKPRTYLNLHIASQSKKIPVSIYIGNIQKN 94
          RAWR+S+ R YLN+HI+S+ KK+P+ I +GNI+KN
Sbjct: 61 RAWRSSQARAYLNIHISSRGKKVPIYISLGNIEKN 95


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00