254780701

254780701

putative two-component sensor histidine kinase transcriptional regulatory protein

GeneID in NCBI database:8209705Locus tag:CLIBASIA_02940
Protein GI in NCBI database:254780701Protein Accession:YP_003065114.1
Gene range:+(565377, 566864)Protein Length:495aa
Gene description:putative two-component sensor histidine kinase transcriptional regulatory protein
COG prediction:[T] Signal transduction histidine kinase
KEGG prediction:putative two-component sensor histidine kinase transcriptional regulatory protein; K07716 two-component system, cell cycle sensor histidine kinase PleC [EC:2.7.13.3]
SEED prediction:Sensor histidine kinase (EC 2.7.3.-)
Pathway involved in KEGG:Two-component system [PATH:las02020]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM5 TM-Helix
TOPPRED5 TM-Helix
HMMTOP5 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM3 TM-Helix
PHOBIUS5 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-----
MYRSRKNKEKDVGLLISPTGDHLGLEYPSKMDFDREIITLHVESLFRVSPILPLFVLLVANIGTWFTQNPIFPMWSLITLAVYAANLSLGKKVMNSDIKIGEVYVWRIWLLVGQIAIGLCWTLLTLVEPGTWTPEYLTIYKSATLLIALSISALSNFMLPYAVFLSFFPVVVALSTQAIMSMHVLDISLAGMLATALSFFTYITYHLFKSNVKILSCQAEKDDLIAELEVAKSLSDETRKRAEEENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNETYKEYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEKNIEIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGWTSGRGQYISIKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLREGVEVIAILPNTRVLNFIPEDNHESTQYKCYA
ccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccHHHHHccHHHHHHHHHHHcccccHHEEEHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccEEEEEEEccccEEEEEEHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccEEEEEEEEccccccHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHccEEEEEEEccccEEEEEEEccccccccccccccccccccccc
cccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccHHEEEccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccccHHHHHHHHHHHHHHHHHHcccEEEEEcccccccEcccHHHHHHHHHHHHHHHHEEcccccEEEEEEEEccccEEEEEEEcccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccEEEEEEEccccEEEEEEEccccccccccccccccccccccc
myrsrknkekdvgllisptgdhlgleypskmdfdREIITLHVESlfrvspilPLFVLLVANIgtwftqnpifpmWSLITLAVYAANLSLgkkvmnsdikiGEVYVWRIWLLVGQIAIGLCWTLLtlvepgtwtpeyLTIYKSATLLIALSISALSNFMLPYAVFLSFFPVVVALSTQAIMSMHVLDISLAGMLATALSFFTYITYHLFKSNVKILSCQAEKDDLIAELEVAKSLSDETRKRAEEENLAKSRFLASMSHELRTPLNAILGFSEVIeletmgplnnetyKEYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEKNIEIFQkidpslssvwadEKGMRQVILNLLSNAVKFTAIGGRVHVTVgwtsgrgqyisikdngpgiaegeiptvltsfgqgsiaIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLREGVEVIailpntrvlnfipednhestqykcya
myrsrknkekdvgllisptgdhlglEYPSKMDFDREIITLHVESLFRVSPILPLFVLLVANIGTWFTQNPIFPMWSLITLAVYAANLSLGKKVMNSDIKIGEVYVWRIWLLVGQIAIGLCWTLLTLVEPGTWTPEYLTIYKSATLLIALSISALSNFMLPYAVFLSFFPVVVALSTQAIMSMHVLDISLAGMLATALSFFTYITYHLFKSNVKILSCQAEKDDLIAELEVakslsdetrkraEEENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNETYKEYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEKNIEIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIGGRVHVtvgwtsgrgqYISIKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLREGVEVIAIlpntrvlnfipednhestqykcya
MYRSRKNKEKDVGLLISPTGDHLGLEYPSKMDFDREIITLHVESLFRVSPILPLFVLLVANIGTWFTQNPIFPMWSLITLAVYAANLSLGKKVMNSDIKIGEVYVWRIWLLVGQIAIGLCWTLLTLVEPGTWTPEYLTIYKsatllialsisalsNFMLPYAVFLSFFPVVVALSTQAIMSMHVLDISLAGMLATALSFFTYITYHLFKSNVKILSCQAEKDDLIAELEVAKSLSDETRKRAEEENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNETYKEYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEKNIEIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGWTSGRGQYISIKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLREGVEVIAILPNTRVLNFIPEDNHESTQYKCYA
********************************FDREIITLHVESLFRVSPILPLFVLLVANIGTWFTQNPIFPMWSLITLAVYAANLSLGKKVMNSDIKIGEVYVWRIWLLVGQIAIGLCWTLLTLVEPGTWTPEYLTIYKSATLLIALSISALSNFMLPYAVFLSFFPVVVALSTQAIMSMHVLDISLAGMLATALSFFTYITYHLFKSNVKILSCQAEKDDLIAE*****************ENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNETYKEYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEKNIEIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGWTSGRGQYISIKDNGPGIAEGEIPTVLTSFGQ**********GVGLGLPIAQSIMANHGGQFLIRSKLREGVEVIAILPNT********************
**********DVGLLISPTGDHLGLEYPSKMDFDREIITLHVESLFRVSPILPLFVLLVANIGTWFTQNPIFPMWSLITLAVYAANLSLGKKVMNSDIKIGEVYVWRIWLLVGQIAIGLCWTLLTLVEPGTWTPEYLTIYKSATLLIALSISALSNFMLPYAVFLSFFPVVVALSTQAIMSMHVLDISLAGMLATALSFFTYITYHLFKSNVKILSCQAEKDDLIAELEVAKSLSDETRKRAEEENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNETYKEYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEKNIEIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGWTSGRGQYISIKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLREGVEVIAILPNTRVLNFIPEDN**********
******************************MDFDREIITLHVESLFRVSPILPLFVLLVANIGTWFTQNPIFPMWSLITLAVYAANLSLGKKVMNSDIKIGEVYVWRIWLLVGQIAIGLCWTLLTLVEPGTWTPEYLTIYKSATLLIALSISALSNFMLPYAVFLSFFPVVVALSTQAIMSMHVLDISLAGMLATALSFFTYITYHLFKSNVKILSCQAEKDDLIAELEVAKSLSDETRKRAEEENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNETYKEYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEKNIEIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGWTSGRGQYISIKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLREGVEVIAILPNTR*******************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYRSRKNKEKDVGLLISPTGDHLGLEYPSKMDFDREIITLHVESLFRVSPILPLFVLLVANIGTWFTQNPIFPMWSLITLAVYAANLSLGKKVMNSDIKIGEVYVWRIWLLVGQIAIGLCWTLLTLVEPGTWTPEYLTIYKSATLLIALSISALSNFMLPYAVFLSFFPVVVALSTQAIMSMHVLDISLAGMLATALSFFTYITYHLFKSNVKILSCQAEKDDLxxxxxxxxxxxxxxxxxxxxxNLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNETYKEYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEKNIEIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGWTSGRGQYISIKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLREGVEVIAILPNTRVLNFIPEDNHESTQYKCYA
MYRSRKNKEKDVGLLISPTGDHLGLEYPSKMDFDREIITLHVESLFRVSPILPLFVLLVANIGTWFTQNPIFPMWSLITLAVYAANLSLGKKVMNSDIKIGEVYVWRIWLLVGQIAIGLCWTLLTLVEPGTWTPEYLTIYKSATLLIALSISALSNFMLPYAVFLSFFPVVVALSTQAIMSMHVLDISLAGMLATALSFFTYITYHLFKSNVKILSCQAEKDDLIAELEVAKSLSDETRKRAEEENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNETYKEYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEKNIEIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGWTSGRGQYISIKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLREGVEVIAILPNTRVLNFIPEDNHESTQYKCYA
MYRSRKNKEKDVGLLISPTGDHLGLEYPSKMDFDREIITLHVESLFRVSPILPLFVLLVANIGTWFTQNPIFPMWSLITLAVYAANLSLGKKVMNSDIKIGEVYVWRIWLLVGQIAIGLCWTLLTLVEPGTWTPEYLTIYKSATLLIALSISALSNFMLPYAVFLSFFPVVVALSTQAIMSMHVLDISLAGMLATALSFFTYITYHLFKSNVKILSCQAEKDDLIAELEVAKSLSDETRKRAEEENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNETYKEYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEKNIEIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGWTSGRGQYISIKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLREGVEVIAILPNTRVLNFIPEDNHESTQYKCYA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target495 putative two-component sensor histidine kinase transcri
254780413820 PAS/PAC sensor signal transduction histidine kinas 2e-44
254780903766 two-component sensor histidine kinase protein [Can 5e-42
255764476792 two-component sensor histidine kinase protein [Can 1e-28
254780450 803 two-component sensor histidine kinase/response reg 0.007
>gi|254780413|ref|YP_003064826.1| PAS/PAC sensor signal transduction histidine kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Back     alignment
 Score =  171 bits (434), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 97/258 (37%), Positives = 154/258 (59%)

Query: 216 SCQAEKDDLIAELEVAKSLSDETRKRAEEENLAKSRFLASMSHELRTPLNAILGFSEVIE 275
           SC +     I+E +  K+     +K AE+E+  KS FLA +SHE+RTPL AI+GFSEVI+
Sbjct: 552 SCYSLTMHDISEWKQEKNKLSHAKKIAEKESSHKSDFLARVSHEIRTPLTAIIGFSEVIK 611

Query: 276 LETMGPLNNETYKEYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVREC 335
            +  GPL N  Y EY   I RSG  +L+++N++LD+S+IE+G+  L    +SL + V E 
Sbjct: 612 NQRFGPLGNPRYIEYANYIDRSGNLVLDIVNDLLDISKIESGKMNLHFEPVSLDEAVSEA 671

Query: 336 IIMLQLRAQEKNIEIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGW 395
           I ++QL A EK I I      ++  + AD + ++Q+ LN+LSNA+ FT  GG++ ++   
Sbjct: 672 ISLVQLYANEKRILIRTSFANNIPRILADLRSVKQIALNILSNAIHFTPSGGQIIISTTH 731

Query: 396 TSGRGQYISIKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQ 455
           TS     + ++D G G+   E+   +  FGQ   + +   +G GLGLP+A++++  + G+
Sbjct: 732 TSNEEVILRVRDTGVGMTNYELEKAMKPFGQIPNSQQIRGEGTGLGLPLAKAMVDANMGK 791

Query: 456 FLIRSKLREGVEVIAILP 473
           F I S   +G  +  I P
Sbjct: 792 FYIFSTPAKGTLIEIIFP 809

>gi|254780903|ref|YP_003065316.1| two-component sensor histidine kinase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 766 Back     alignment
 Score =  163 bits (413), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 146/249 (58%), Gaps = 6/249 (2%)

Query: 227 ELEVAKSLSDETRKRAEEENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNET 286
           EL +A +     ++RAE  N  KS FLA MSHELRTPLNAILGFSEVI+ E  G L +  
Sbjct: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580

Query: 287 YKEYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEK 346
           Y EY  DIH SGQHLLN+IN IL++S+IE  +  + +    LI I+ E I ++   AQ K
Sbjct: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640

Query: 347 NIEIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGWTSGRGQY--IS 404
           NI+I +KI PS     AD++ +++++  +LSN++KFT   G++ +    TS  GQ   I+
Sbjct: 641 NIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCVIIT 696

Query: 405 IKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLRE 464
           I D G GI +  +  +   F         +  G GLGL I+ ++   HGG+  I S+  +
Sbjct: 697 IADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGK 756

Query: 465 GVEVIAILP 473
           G  V   +P
Sbjct: 757 GTIVTICMP 765

>gi|255764476|ref|YP_003065238.2| two-component sensor histidine kinase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 792 Back     alignment
 Score =  119 bits (297), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 85/242 (35%), Positives = 133/242 (54%), Gaps = 10/242 (4%)

Query: 229 EVAKSLSDETRKRAEEENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNETYK 288
           E A +  +E  ++A+E    K+ F+  +S+ELR+PL  I+GF+++++   +G LN++   
Sbjct: 552 ERALTEKNEALRKADE---IKNSFVQHVSYELRSPLTNIIGFTDLLKTSKLGSLNSKQ-S 607

Query: 289 EYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEKNI 348
           +Y+  I  S   LLNL+N+ILDL+ ++AG  +L+ S I L D++ E    +  +  E NI
Sbjct: 608 QYVEYISASSTILLNLVNDILDLATVDAGIMKLNYSTIVLNDLLNEVKQSIATKMHENNI 667

Query: 349 EIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGWTSGRGQYI-SIKD 407
            I    D  L S  AD + + Q+   +LSNA+ F++ G  V +        G +I S+K+
Sbjct: 668 RIKVISDGKLGSFVADRQRLLQIFSKILSNAMDFSSKGSTVILKAA--RDNGDFIFSVKN 725

Query: 408 NGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLREGVE 467
           NG  I E    +V   F   S A +   +GVGLGL I +S +  HGG   I S   EGV 
Sbjct: 726 NGSSIPEDMCKSVFNRF--VSNAHRGQRRGVGLGLSIVESFINLHGGHVSISSS-DEGVT 782

Query: 468 VI 469
            I
Sbjct: 783 TI 784

>gi|254780450|ref|YP_003064863.1| two-component sensor histidine kinase/response regulator hybrid protein [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Back     alignment
 Score = 33.9 bits (76), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 55/275 (20%), Positives = 117/275 (42%), Gaps = 40/275 (14%)

Query: 238 TRKRAEEENLAKSRFL-------ASMSHELRTPLNAILGFSEVIELETMGPLNNETYKEY 290
           T ++A E  +A+++ L         ++H+    L AIL  S+ + L++    ++ ++ + 
Sbjct: 402 TEQKALEARMAQTQKLNAVGTLAGGIAHDFNNVLTAILLSSDHLLLQSRS--SDASFADL 459

Query: 291 IGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQ-LRAQEKNIE 349
           +   H + +  + L+ ++L  SR +  R     + ++L +++    +M+Q L ++   ++
Sbjct: 460 MEIKHNANRAAI-LVRQLLAFSRKQTMRL----TVLNLTEVIGNLRMMIQKLISEPPQVK 514

Query: 350 IFQKIDPSLSSVWADEKGMRQVILNLLSNA-------------VKFTAIGGRVHVTVGWT 396
           +    +  L  V  D     QV++NL  NA             V+   I      T  ++
Sbjct: 515 LTVDYERDLWGVKTDLSQFEQVLVNLCVNAHHAIMLKESGSLTVRTRNIPSTEIHTFNYS 574

Query: 397 SGRGQ---YISIKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHG 453
               +    + ++D G G++    P ++    +     K   +G GLGL +   I+   G
Sbjct: 575 DLPTKDMVLVEVEDTGIGMS----PDIMEKIFEPFFTTKKVGEGTGLGLSVVYGIIRQSG 630

Query: 454 GQFLIRSKLREGVEVIAILPNTRVLNFIPEDNHES 488
           G  L  S++ +G      LP      ++ E   ES
Sbjct: 631 GYILPESEVGKGTIFRIFLP-----RYVQEHTQES 660

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target495 putative two-component sensor histidine kinase transcri
315121866498 putative two-component sensor histidine kinase transcri 1 0.0
327189383511 putative two-component sensor histidine kinase protein 1 1e-166
116252525511 two-component sensor histidine kinase transcriptional r 1 1e-166
190892130511 two-component sensor histidine kinase [Rhizobium etli C 1 1e-166
86358053513 two-component sensor histidine kinase protein [Rhizobiu 1 1e-166
241205034511 histidine kinase [Rhizobium leguminosarum bv. trifolii 1 1e-165
209549672511 integral membrane sensor signal transduction histidine 1 1e-160
218682383468 probable two-component sensor histidine kinase protein 1 1e-159
222086249509 two-component sensor histidine kinase protein [Agrobact 1 1e-158
218662726 570 probable two-component sensor histidine kinase protein 1 1e-157
>gi|315121866|ref|YP_004062355.1| putative two-component sensor histidine kinase transcriptional regulatory protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 498 Back     alignment and organism information
 Score =  861 bits (2224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/498 (84%), Positives = 458/498 (91%), Gaps = 3/498 (0%)

Query: 1   MYRSRKNKEKDVGLLISPTGDHLGLEYPSKMDFDREIITLHVESLFRVSPILPLFVLLVA 60
           M  S K ++K    LIS  GD++ ++ P K  FDREII LHVESLFRVSPILPLF+LLVA
Sbjct: 1   MRISNKFQQKTTCRLISSIGDNMSIDRPPKTGFDREIINLHVESLFRVSPILPLFILLVA 60

Query: 61  NIGTWFTQNPIFPMWSLITLAVYAANLSLGKKVMNSDIKIGEVYVWRIWLLVGQIAIGLC 120
           NIGTWFTQNP+ P+WSLITLAVYAANLSLG+KV+NSDIK   VY+WR+WLL+GQIAIGLC
Sbjct: 61  NIGTWFTQNPMLPIWSLITLAVYAANLSLGQKVINSDIKTERVYIWRVWLLIGQIAIGLC 120

Query: 121 WTLLTLVEPGTWTPEYLTIYKSATLLIALSISALSNFMLPYAVFLSFFPVVVALSTQAIM 180
           WTLLTLVEPGTWTPEYLTIYKSATLLIALSISALSNFMLPYAVFLSFFPV+VALSTQAI+
Sbjct: 121 WTLLTLVEPGTWTPEYLTIYKSATLLIALSISALSNFMLPYAVFLSFFPVLVALSTQAII 180

Query: 181 SMHVLDISLAGMLATALSFFTYITYHLFKSNVKILSCQAEKDDLIAELEVAKSLSDETRK 240
           SMHVLD+SLAGMLATALSFFTYITYHLFKSNVKILS Q+EKDDLIAELEVAKSLSD+TR+
Sbjct: 181 SMHVLDVSLAGMLATALSFFTYITYHLFKSNVKILSFQSEKDDLIAELEVAKSLSDKTRQ 240

Query: 241 RAEEENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNETYKEYIGDIHRSGQH 300
           RAEE NLAKSRFLASMSHELRTPLNAILGFSEVI LETMGPLNNETYKEYIGDIHRSGQH
Sbjct: 241 RAEEANLAKSRFLASMSHELRTPLNAILGFSEVIGLETMGPLNNETYKEYIGDIHRSGQH 300

Query: 301 LLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEKNIEIFQKIDPSLSS 360
           LLNLINEILDLSRIEAGRYELSESAISLIDI+ EC+IMLQLRAQEK IEIFQ+IDP+LSS
Sbjct: 301 LLNLINEILDLSRIEAGRYELSESAISLIDIMHECMIMLQLRAQEKYIEIFQQIDPTLSS 360

Query: 361 VWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGWTSGRGQYISIKDNGPGIAEGEIPTV 420
           VWADEKGMRQVILNLLSNAVKFT+IGG+V V VGWT+G GQYISIKDNGPGI+EGE+PTV
Sbjct: 361 VWADEKGMRQVILNLLSNAVKFTSIGGKVRVKVGWTAGGGQYISIKDNGPGISEGEMPTV 420

Query: 421 LTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLREGVEVIAILPNTRVLNF 480
           L+SFGQGSIAIKSAEQGVGLGLPI QSIMANHGGQF I+SKL+EGVEVIAILP+TRVLN 
Sbjct: 421 LSSFGQGSIAIKSAEQGVGLGLPIVQSIMANHGGQFRIKSKLQEGVEVIAILPSTRVLNN 480

Query: 481 IPED---NHESTQYKCYA 495
           + ED       +QYK YA
Sbjct: 481 VSEDASNKQNPSQYKRYA 498


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|327189383|gb|EGE56551.1| putative two-component sensor histidine kinase protein [Rhizobium etli CNPAF512] Length = 511 Back     alignment and organism information
>gi|116252525|ref|YP_768363.1| two-component sensor histidine kinase transcriptional regulatory protein [Rhizobium leguminosarum bv. viciae 3841] Length = 511 Back     alignment and organism information
>gi|190892130|ref|YP_001978672.1| two-component sensor histidine kinase [Rhizobium etli CIAT 652] Length = 511 Back     alignment and organism information
>gi|86358053|ref|YP_469945.1| two-component sensor histidine kinase protein [Rhizobium etli CFN 42] Length = 513 Back     alignment and organism information
>gi|241205034|ref|YP_002976130.1| histidine kinase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 511 Back     alignment and organism information
>gi|209549672|ref|YP_002281589.1| integral membrane sensor signal transduction histidine kinase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 511 Back     alignment and organism information
>gi|218682383|ref|ZP_03529984.1| probable two-component sensor histidine kinase protein [Rhizobium etli CIAT 894] Length = 468 Back     alignment and organism information
>gi|222086249|ref|YP_002544781.1| two-component sensor histidine kinase protein [Agrobacterium radiobacter K84] Length = 509 Back     alignment and organism information
>gi|218662726|ref|ZP_03518656.1| probable two-component sensor histidine kinase protein [Rhizobium etli IE4771] Length = 570 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target495 putative two-component sensor histidine kinase transcri
TIGR02956 968 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS 2e-40
PRK15347 921 PRK15347, PRK15347, two component system sensor kinase 6e-39
PRK11107 919 PRK11107, PRK11107, hybrid sensory histidine kinase Bar 6e-37
COG2205890 COG2205, KdpD, Osmosensitive K+ channel histidine kinas 7e-32
TIGR02966333 TIGR02966, phoR_proteo, phosphate regulon sensor kinase 2e-30
PRK11091 779 PRK11091, PRK11091, aerobic respiration control sensor 7e-28
COG5002459 COG5002, VicK, Signal transduction histidine kinase [Si 2e-27
PRK11466 914 PRK11466, PRK11466, hybrid sensory histidine kinase Tor 5e-27
PRK11100475 PRK11100, PRK11100, sensory histidine kinase CreC; Prov 3e-25
PRK09959 1197 PRK09959, PRK09959, hybrid sensory histidine kinase in 6e-25
PRK09303380 PRK09303, PRK09303, adaptive-response sensory kinase; V 7e-25
PRK11360607 PRK11360, PRK11360, sensory histidine kinase AtoS; Prov 1e-24
PRK10490895 PRK10490, PRK10490, sensor protein KdpD; Provisional 9e-23
PRK11006430 PRK11006, phoR, phosphate regulon sensor protein; Provi 2e-22
COG4251750 COG4251, COG4251, Bacteriophytochrome (light-regulated 1e-20
PRK10841 924 PRK10841, PRK10841, hybrid sensory kinase in two-compon 2e-20
TIGR01386457 TIGR01386, cztS_silS_copS, heavy metal sensor kinase 2e-20
COG4191603 COG4191, COG4191, Signal transduction histidine kinase 5e-18
COG4192673 COG4192, COG4192, Signal transduction histidine kinase 4e-17
PRK13837 828 PRK13837, PRK13837, two-component VirA-like sensor kina 6e-17
COG3852363 COG3852, NtrB, Signal transduction histidine kinase, ni 2e-15
PRK09467435 PRK09467, envZ, osmolarity sensor protein; Provisional 2e-14
PRK10604433 PRK10604, PRK10604, sensor protein RstB; Provisional 2e-13
PRK09835482 PRK09835, PRK09835, sensor kinase CusS; Provisional 6e-13
PRK10549466 PRK10549, PRK10549, signal transduction histidine-prote 3e-12
PRK10337449 PRK10337, PRK10337, sensor protein QseC; Provisional 3e-11
COG5000712 COG5000, NtrY, Signal transduction histidine kinase inv 1e-10
TIGR02938494 TIGR02938, nifL_nitrog, nitrogen fixation negative regu 1e-09
PRK11073348 PRK11073, glnL, nitrogen regulation protein NR(II); Pro 3e-08
PRK10755356 PRK10755, PRK10755, sensor protein BasS/PmrB; Provision 6e-08
PRK09470461 PRK09470, cpxA, two-component sensor protein; Provision 8e-07
PRK13557 540 PRK13557, PRK13557, histidine kinase; Provisional 1e-04
COG3290537 COG3290, CitA, Signal transduction histidine kinase reg 8e-04
smart00387111 smart00387, HATPase_c, Histidine kinase-like ATPases 2e-21
pfam02518111 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, 1e-19
cd00075103 cd00075, HATPase_c, Histidine kinase-like ATPases; This 8e-15
PRK11086542 PRK11086, PRK11086, sensory histidine kinase DcuS; Prov 0.004
PRK10364457 PRK10364, PRK10364, sensor protein ZraS; Provisional 1e-20
TIGR03785703 TIGR03785, marine_sort_HK, proteobacterial dedicated so 8e-08
COG0642336 COG0642, BaeS, Signal transduction histidine kinase [Si 4e-39
pfam0051266 pfam00512, HisKA, His Kinase A (phosphoacceptor) domain 5e-16
smart0038866 smart00388, HisKA, His Kinase A (phosphoacceptor) domai 9e-16
cd0008265 cd00082, HisKA, Histidine Kinase A (dimerization/phosph 3e-15
KOG0519 786 KOG0519, KOG0519, KOG0519, Sensory transduction histidi 9e-14
TIGR02916679 TIGR02916, PEP_his_kin, putative PEP-CTERM system histi 2e-07
PRK10618 894 PRK10618, PRK10618, phosphotransfer intermediate protei 3e-05
>gnl|CDD|163083 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS Back     alignment and domain information
>gnl|CDD|185245 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>gnl|CDD|182968 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>gnl|CDD|32387 COG2205, KdpD, Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163090 TIGR02966, phoR_proteo, phosphate regulon sensor kinase PhoR Back     alignment and domain information
>gnl|CDD|182956 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>gnl|CDD|34607 COG5002, VicK, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183148 PRK11466, PRK11466, hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>gnl|CDD|182962 PRK11100, PRK11100, sensory histidine kinase CreC; Provisional Back     alignment and domain information
>gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>gnl|CDD|181772 PRK09303, PRK09303, adaptive-response sensory kinase; Validated Back     alignment and domain information
>gnl|CDD|183098 PRK11360, PRK11360, sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>gnl|CDD|182496 PRK10490, PRK10490, sensor protein KdpD; Provisional Back     alignment and domain information
>gnl|CDD|182895 PRK11006, phoR, phosphate regulon sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|33974 COG4251, COG4251, Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>gnl|CDD|162333 TIGR01386, cztS_silS_copS, heavy metal sensor kinase Back     alignment and domain information
>gnl|CDD|33926 COG4191, COG4191, Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|33927 COG4192, COG4192, Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|184354 PRK13837, PRK13837, two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>gnl|CDD|33642 COG3852, NtrB, Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|181882 PRK09467, envZ, osmolarity sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|182583 PRK10604, PRK10604, sensor protein RstB; Provisional Back     alignment and domain information
>gnl|CDD|182101 PRK09835, PRK09835, sensor kinase CusS; Provisional Back     alignment and domain information
>gnl|CDD|182539 PRK10549, PRK10549, signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>gnl|CDD|182388 PRK10337, PRK10337, sensor protein QseC; Provisional Back     alignment and domain information
>gnl|CDD|34605 COG5000, NtrY, Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|131984 TIGR02938, nifL_nitrog, nitrogen fixation negative regulator NifL Back     alignment and domain information
>gnl|CDD|182947 PRK11073, glnL, nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>gnl|CDD|182702 PRK10755, PRK10755, sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>gnl|CDD|181885 PRK09470, cpxA, two-component sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|184141 PRK13557, PRK13557, histidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|33099 COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|128669 smart00387, HATPase_c, Histidine kinase-like ATPases Back     alignment and domain information
>gnl|CDD|145582 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|28956 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>gnl|CDD|182952 PRK11086, PRK11086, sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>gnl|CDD|182411 PRK10364, PRK10364, sensor protein ZraS; Provisional Back     alignment and domain information
>gnl|CDD|163497 TIGR03785, marine_sort_HK, proteobacterial dedicated sortase system histidine kinase Back     alignment and domain information
>gnl|CDD|30987 COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|144196 pfam00512, HisKA, His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>gnl|CDD|128670 smart00388, HisKA, His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>gnl|CDD|119399 cd00082, HisKA, Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase Back     alignment and domain information
>gnl|CDD|35739 KOG0519, KOG0519, KOG0519, Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163071 TIGR02916, PEP_his_kin, putative PEP-CTERM system histidine kinase Back     alignment and domain information
>gnl|CDD|182591 PRK10618, PRK10618, phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 495 putative two-component sensor histidine kinase transcri
TIGR02956 1052 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: I 100.0
PRK10841 947 hybrid sensory kinase in two-component regulatory syste 100.0
PRK11107 920 hybrid sensory histidine kinase BarA; Provisional 100.0
PRK11466 912 hybrid sensory histidine kinase TorS; Provisional 100.0
PRK11091 779 aerobic respiration control sensor protein ArcB; Provis 100.0
PRK09959 1197 hybrid sensory histidine kinase in two-component regula 100.0
TIGR02966339 phoR_proteo phosphate regulon sensor kinase PhoR; Inter 100.0
PRK09303378 adaptive-response sensory kinase; Validated 100.0
PRK10490895 sensor protein KdpD; Provisional 100.0
PRK11006431 phoR phosphate regulon sensor protein; Provisional 100.0
PRK09835482 sensor kinase CusS; Provisional 100.0
PRK10549467 signal transduction histidine-protein kinase BaeS; Prov 100.0
PRK11100475 sensory histidine kinase CreC; Provisional 100.0
PRK11360607 sensory histidine kinase AtoS; Provisional 100.0
PRK10755355 sensor protein BasS/PmrB; Provisional 100.0
PRK10337446 sensor protein QseC; Provisional 100.0
PRK09470461 cpxA two-component sensor protein; Provisional 100.0
COG2205890 KdpD Osmosensitive K+ channel histidine kinase [Signal 100.0
PRK10364455 sensor protein ZraS; Provisional 100.0
TIGR01386483 cztS_silS_copS heavy metal sensor kinase; InterPro: IPR 100.0
PRK10604433 sensor protein RstB; Provisional 100.0
PRK13557 538 histidine kinase; Provisional 100.0
PRK10815484 sensor protein PhoQ; Provisional 100.0
PRK09467437 envZ osmolarity sensor protein; Provisional 100.0
PRK13837 831 two-component VirA-like sensor kinase; Provisional 100.0
COG5002459 VicK Signal transduction histidine kinase [Signal trans 100.0
PRK11073348 glnL nitrogen regulation protein NR(II); Provisional 100.0
COG4251750 Bacteriophytochrome (light-regulated signal transductio 100.0
COG4191603 Signal transduction histidine kinase regulating C4-dica 100.0
PRK11086541 sensory histidine kinase DcuS; Provisional 100.0
COG0642336 BaeS Signal transduction histidine kinase [Signal trans 99.97
COG3852363 NtrB Signal transduction histidine kinase, nitrogen spe 99.97
TIGR02916696 PEP_his_kin putative PEP-CTERM system histidine kinase; 99.97
COG5000712 NtrY Signal transduction histidine kinase involved in n 99.95
COG4192673 Signal transduction histidine kinase regulating phospho 99.93
PRK10618 881 phosphotransfer intermediate protein in two-component r 99.89
COG3290537 CitA Signal transduction histidine kinase regulating ci 99.87
TIGR02938496 nifL_nitrog nitrogen fixation negative regulator NifL; 99.85
KOG0519 786 consensus 99.84
PRK13560807 hypothetical protein; Provisional 99.81
PRK10935568 nitrate/nitrite sensor protein NarQ; Provisional 99.79
PRK11644497 sensory histidine kinase UhpB; Provisional 99.77
PRK10600569 nitrate/nitrite sensor protein NarX; Provisional 99.7
COG3850574 NarQ Signal transduction histidine kinase, nitrate/nitr 99.62
COG2972456 Predicted signal transduction protein with a C-terminal 99.57
COG3851497 UhpB Signal transduction histidine kinase, glucose-6-ph 99.56
COG3920221 Signal transduction histidine kinase [Signal transducti 99.37
PRK13559363 hypothetical protein; Provisional 99.04
COG4564459 Signal transduction histidine kinase [Signal transducti 98.97
KOG0787414 consensus 98.93
KOG0519 786 consensus 98.04
COG5385214 Uncharacterized protein conserved in bacteria [Function 94.24
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine kina 99.91
pfam02518111 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-l 99.9
cd00075103 HATPase_c Histidine kinase-like ATPases; This family in 99.86
PRK03660146 anti-sigma F factor; Provisional 99.21
COG1389 538 DNA topoisomerase VI, subunit B [DNA replication, recom 98.5
PRK04184 533 DNA topoisomerase VI subunit B; Validated 98.32
PRK04069158 serine-protein kinase RsbW; Provisional 98.29
TIGR01052 662 top6b DNA topoisomerase VI, B subunit; InterPro: IPR005 98.04
COG2172146 RsbW Anti-sigma regulatory factor (Ser/Thr protein kina 97.83
TIGR01925137 spIIAB anti-sigma F factor; InterPro: IPR010194 This en 97.36
COG5381184 Uncharacterized protein conserved in bacteria [Function 95.8
TIGR01924161 rsbW_low_gc anti-sigma B factor; InterPro: IPR010193 Th 94.19
PRK05559633 DNA topoisomerase IV subunit B; Reviewed 93.51
TIGR01058 655 parE_Gpos DNA topoisomerase IV, B subunit; InterPro: IP 92.02
COG4585365 Signal transduction histidine kinase [Signal transducti 99.71
PRK10547 662 chemotaxis protein CheA; Provisional 99.59
COG0643 716 CheA Chemotaxis protein histidine kinase and related ki 99.51
COG3275557 LytS Putative regulator of cell autolysis [Signal trans 99.18
pfam0051266 HisKA His Kinase A (phosphoacceptor) domain. dimerizati 99.18
smart0038866 HisKA His Kinase A (phosphoacceptor) domain. Dimerisati 98.94
cd0008265 HisKA Histidine Kinase A (dimerization/phosphoacceptor) 98.81
PRK00095612 mutL DNA mismatch repair protein; Reviewed 97.62
TIGR00585 367 mutl DNA mismatch repair protein MutL; InterPro: IPR014 97.52
PRK05218612 heat shock protein 90; Provisional 95.18
COG0326623 HtpG Molecular chaperone, HSP90 family [Posttranslation 94.56
PTZ00130 824 heat shock protein 90; Provisional 93.05
COG0323 638 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA 96.96
PRK05644725 gyrB DNA gyrase subunit B; Validated 94.17
KOG1979694 consensus 93.99
smart00433594 TOP2c TopoisomeraseII. Eukaryotic DNA topoisomerase II, 92.1
pfam10090181 DUF2328 Uncharacterized protein conserved in bacteria ( 96.59
PTZ00272701 heat shock protein 83 kDa (Hsp83); Provisional 94.01
KOG1978672 consensus 92.75
PTZ00109941 DNA gyrase subunit b; Provisional 92.0
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: IPR014302 This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC) Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR; InterPro: IPR014310 Members of this protein are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter found in most Proteobacteria, and related proteins from Gram-positive organisms are excluded Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>PRK09835 sensor kinase CusS; Provisional Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>PRK10337 sensor protein QseC; Provisional Back     alignment and domain information
>PRK09470 cpxA two-component sensor protein; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>TIGR01386 cztS_silS_copS heavy metal sensor kinase; InterPro: IPR006290 Members of this family contain a sensor histidine kinase domain (IPR003661 from INTERPRO) and a domain found in bacterial signal proteins (IPR003660 from INTERPRO) Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK10815 sensor protein PhoQ; Provisional Back     alignment and domain information
>PRK09467 envZ osmolarity sensor protein; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase; InterPro: IPR014265 Proteins in this entry are putative periplasmic sensor signal transduction histidine kinases Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>COG4192 Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL; InterPro: IPR014285 NifL modulates the activity of the nitrogen fixation positive regulator protein NifA, acting as a negative regulator by binding NifA Back     alignment and domain information
>KOG0519 consensus Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PRK10935 nitrate/nitrite sensor protein NarQ; Provisional Back     alignment and domain information
>PRK11644 sensory histidine kinase UhpB; Provisional Back     alignment and domain information
>PRK10600 nitrate/nitrite sensor protein NarX; Provisional Back     alignment and domain information
>COG3850 NarQ Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] Back     alignment and domain information
>COG2972 Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3851 UhpB Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms] Back     alignment and domain information
>COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>COG4564 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0787 consensus Back     alignment and domain information
>KOG0519 consensus Back     alignment and domain information
>COG5385 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00387 HATPase_c Histidine kinase-like ATPases Back     alignment and domain information
>pfam02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>PRK03660 anti-sigma F factor; Provisional Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>PRK04069 serine-protein kinase RsbW; Provisional Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit; InterPro: IPR005734 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>COG2172 RsbW Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01925 spIIAB anti-sigma F factor; InterPro: IPR010194 This entry describes the SpoIIAB anti-sigma F factor Back     alignment and domain information
>COG5381 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR01924 rsbW_low_gc anti-sigma B factor; InterPro: IPR010193 This entry describes the anti-sigma B factor also known as serine-protein kinase RsbW Back     alignment and domain information
>PRK05559 DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>TIGR01058 parE_Gpos DNA topoisomerase IV, B subunit; InterPro: IPR005740 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10547 chemotaxis protein CheA; Provisional Back     alignment and domain information
>COG0643 CheA Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG3275 LytS Putative regulator of cell autolysis [Signal transduction mechanisms] Back     alignment and domain information
>pfam00512 HisKA His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>smart00388 HisKA His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>cd00082 HisKA Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase Back     alignment and domain information
>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL; InterPro: IPR014763 This entry represents DNA mismatch repair proteins, such as MutL Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05644 gyrB DNA gyrase subunit B; Validated Back     alignment and domain information
>KOG1979 consensus Back     alignment and domain information
>smart00433 TOP2c TopoisomeraseII Back     alignment and domain information
>pfam10090 DUF2328 Uncharacterized protein conserved in bacteria (DUF2328) Back     alignment and domain information
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>KOG1978 consensus Back     alignment and domain information
>PTZ00109 DNA gyrase subunit b; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target495 putative two-component sensor histidine kinase transcri
3dge_A258 Structure Of A Histidine Kinase-Response Regulator 4e-69
2c2a_A258 Structure Of The Entire Cytoplasmic Portion Of A Se 5e-69
>gi|251836869|pdb|3DGE|A Chain A, Structure Of A Histidine Kinase-Response Regulator Complex Reveals Insights Into Two-Component Signaling And A Novel Cis-Autophosphorylation Mechanism Length = 258 Back     alignment and structure
 Score =  267 bits (682), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 74/252 (29%), Positives = 125/252 (49%), Gaps = 6/252 (2%)

Query: 232 KSLSDETRKRAEEENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNETYKEYI 291
                +  +R +  +  K+ F+A++SHELRTPL AI  ++E I    +G L+  T KE++
Sbjct: 3   NVTESKELERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNS-LGELDLSTLKEFL 61

Query: 292 GDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEKNIEIF 351
             I     HL NL+NE+LD SR+E    +++   + L D+V   +  ++  A   N+ + 
Sbjct: 62  EVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVL 121

Query: 352 QKID-PSLSSVWADEKGMRQVILNLLSNAVKFTAIGGR---VHVTVGWTSGRGQYISIKD 407
            + + P     + D   +RQV+LNLL+N VK++        V V +      G  I ++D
Sbjct: 122 FESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILD-EKDGGVLIIVED 180

Query: 408 NGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLREGVE 467
           NG GI +     +   F +   ++     G GLGL I + I+  HGG+  + S++ +G  
Sbjct: 181 NGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSR 240

Query: 468 VIAILPNTRVLN 479
               +P  R   
Sbjct: 241 FFVWIPKDRAGE 252


>gi|83754490|pdb|2C2A|A Chain A, Structure Of The Entire Cytoplasmic Portion Of A Sensor Histidine Kinase Protein Length = 258 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target495 putative two-component sensor histidine kinase transcri
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, selenom 4e-54
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase domain, A 2e-50
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bundle, c 5e-44
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kin 1e-41
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinase, ph 2e-39
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozyme 1; 7e-32
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-bind 1e-30
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozyme 3; 2e-28
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif r 8e-25
1b3q_A 379 Protein (chemotaxis protein CHEA); histine kinase, sign 8e-13
3ehh_A218 Sensor kinase (YOCF protein); four-helix bundle, GHL AT 2e-06
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduction, 1e-26
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein (ENVZ 2e-24
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding domain, 6e-24
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, transf 1e-19
1r62_A160 Nitrogen regulation protein NR(II); PII, histidine kina 4e-19
1mu5_A 471 Type II DNA topoisomerase VI subunit B; GHKL ATPase, he 2e-12
1i58_A189 Chemotaxis protein CHEA; beta-alpha sandwich, signaling 2e-08
2q2e_B 621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO1 2e-06
2zbk_B 530 Type 2 DNA topoisomerase 6 subunit B; DNA binding prote 1e-09
1joy_A67 Protein (ENVZ_ecoli); histidine kinase, sensory transdu 2e-09
1ixm_A192 SPO0B, protein (sporulation response regulatory protein 5e-08
>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Length = 258 Back     alignment and structure
 Score =  207 bits (529), Expect = 4e-54
 Identities = 73/250 (29%), Positives = 124/250 (49%), Gaps = 8/250 (3%)

Query: 241 RAEEENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNETYKEYIGDIHRSGQH 300
           R +  +  K+ F+A++SHELRTPL AI  ++E I   ++G L+  T KE++  I     H
Sbjct: 12  RLKRIDRMKTEFIANISHELRTPLTAIKAYAETI-YNSLGELDLSTLKEFLEVIIDQSNH 70

Query: 301 LLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEKNIEIFQKIDPSLS- 359
           L NL+NE+LD SR+E    +++   + L D+V   +  ++  A   N+ +  + +     
Sbjct: 71  LENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPV 130

Query: 360 SVWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGWTSGRGQY--ISIKDNGPGIAEGEI 417
             + D   +RQV+LNLL+N VK++               +     I ++DNG GI +   
Sbjct: 131 EAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAK 190

Query: 418 PTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLREGVEVIAILPNTRV 477
             +   F +   ++     G GLGL I + I+  HGG+  + S++ +G      +P  R 
Sbjct: 191 DRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDRA 250

Query: 478 LNFIPEDNHE 487
                EDN +
Sbjct: 251 ----GEDNRQ 256


>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Length = 222 Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Length = 244 Back     alignment and structure
>1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Length = 388 Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transferase, two-component regulatory system; 3.80A {Thermotoga maritima} Length = 349 Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozyme 1; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Length = 407 Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Length = 394 Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozyme 3; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: LPA ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Length = 419 Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Length = 394 Back     alignment and structure
>1b3q_A Protein (chemotaxis protein CHEA); histine kinase, signal transduction, multi- domains protein; 2.60A {Thermotoga maritima} SCOP: a.30.2.1 b.40.7.1 d.122.1.3 PDB: 2ch4_A* Length = 379 Back     alignment and structure
>3ehh_A Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* Length = 218 Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Length = 152 Back     alignment and structure
>1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli} SCOP: d.122.1.3 Length = 161 Back     alignment and structure
>1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Length = 150 Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Length = 152 Back     alignment and structure
>1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transferase; 1.60A {Escherichia coli K12} SCOP: d.122.1.3 Length = 160 Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Length = 471 Back     alignment and structure
>1i58_A Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} SCOP: d.122.1.3 PDB: 1i59_A* 1i5a_A* 1i5b_A* 1i5c_A* 1i5d_A* Length = 189 Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Length = 621 Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Length = 530 Back     alignment and structure
>1joy_A Protein (ENVZ_ecoli); histidine kinase, sensory transduction, osmolarity sensor protein, inner membrane, phosphorylation, transferase; NMR {Escherichia coli} SCOP: a.30.2.1 Length = 67 Back     alignment and structure
>1ixm_A SPO0B, protein (sporulation response regulatory protein); phosphotransferase, two component system; 2.60A {Bacillus subtilis} SCOP: d.123.1.1 PDB: 2ftk_A* 1f51_A Length = 192 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target495 putative two-component sensor histidine kinase transcri
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, selenom 100.0
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bundle, c 100.0
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinase, ph 100.0
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase domain, A 100.0
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kin 100.0
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-bind 100.0
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif r 100.0
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozyme 1; 99.98
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozyme 3; 99.97
1b3q_A 379 Protein (chemotaxis protein CHEA); histine kinase, sign 99.94
3ehh_A218 Sensor kinase (YOCF protein); four-helix bundle, GHL AT 99.8
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding domain, 99.97
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, transf 99.97
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduction, 99.96
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein (ENVZ 99.96
1r62_A160 Nitrogen regulation protein NR(II); PII, histidine kina 99.95
3ehg_A128 Sensor kinase (YOCF protein); GHL ATPase domain, transf 99.41
3n0r_A 286 Response regulator; sigma factor, receiver, two-compone 97.96
1ixm_A192 SPO0B, protein (sporulation response regulatory protein 99.71
2zbk_B 530 Type 2 DNA topoisomerase 6 subunit B; DNA binding prote 99.66
1mu5_A 471 Type II DNA topoisomerase VI subunit B; GHKL ATPase, he 99.63
1th8_A145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, 99.46
3ke6_A399 Protein RV1364C/MT1410; anti-sigma factor, anti-sigma f 98.71
2q2e_B 621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO1 98.29
3h4l_A 367 DNA mismatch repair protein PMS1; ATP binding, DNA repa 97.66
3na3_A 348 DNA mismatch repair protein MLH1; MUTL protein homolog 97.5
1h7s_A 365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatc 97.45
1zxm_A 400 TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; G 96.79
1kij_A 390 DNA gyrase subunit B; topoisomerase, gyrase B-coumarin 96.55
1pvg_A 418 DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 96.5
1ei1_A 391 DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HE 96.5
2cg9_A 677 ATP-dependent molecular chaperone HSP82; chaperone comp 96.46
3cwv_A 369 DNA gyrase, B subunit, truncated; structural genomics, 96.4
3g7e_A203 DNA gyrase subunit B; isomerase; HET: DNA B46; 2.20A {E 96.13
3peh_A281 Endoplasmin homolog; structural genomics, structural ge 95.31
2o1u_A 666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP- 95.12
1s16_A 390 Topoisomerase IV subunit B; two-domain protein complexe 94.93
3fv5_A201 DNA topoisomerase 4 subunit B; topoisomerase IV B subun 94.56
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycle, ca 93.38
3g75_A184 DNA gyrase subunit B; antibiotic resistance, isomerase; 93.33
1i58_A189 Chemotaxis protein CHEA; beta-alpha sandwich, signaling 99.54
1joy_A67 Protein (ENVZ_ecoli); histidine kinase, sensory transdu 98.78
1b63_A 333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Esc 97.21
3ied_A272 Heat shock protein; HSP90, chaperone, structural genomi 96.16
1y4s_A 559 Chaperone protein HTPG; HSP90, molecular chaperone, ATP 96.12
2ioq_A 624 Chaperone protein HTPG; heat shock protein, HSP90; 3.50 95.56
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1 94.91
1uyl_A236 HSP 86, heat shock protein HSP 90-alpha; ATPase, chaper 94.65
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; HET: 94.62
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, cytopl 94.5
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, liga 94.47
2no2_A107 HIP-I, huntingtin-interacting protein 1; clathrin light 95.67
>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=449.17  Aligned_cols=236  Identities=31%  Similarity=0.508  Sum_probs=215.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99999999889999977642013899999999985033687893789999999999999999999999999874220015
Q gi|254780701|r  241 RAEEENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNETYKEYIGDIHRSGQHLLNLINEILDLSRIEAGRYE  320 (495)
Q Consensus       241 ~ae~a~~~Ks~FlA~~SHELRTPL~aI~g~~elL~~~~~~~~~~~~~~~~l~~i~~s~~~L~~Li~~lLdlsrleag~~~  320 (495)
                      +.++.+++|++|++++||||||||++|.||+++|.+.. ...+++++++|++.|.+++++|..||+++||+||+|+|.++
T Consensus        12 rl~~~~~~k~~f~a~isHELrtPL~~I~~~~~~l~~~~-~~~~~~~~~~~l~~i~~~~~rl~~li~~lL~~sr~e~~~~~   90 (258)
T 2c2a_A           12 RLKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSL-GELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQ   90 (258)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHTG-GGCCTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             99999999999999979998589999999999997145-56999999999999999999999999999999844279987


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCH-HCCCCHHHHHHHHHHHHHHHHHCCCCCC---EEEEEEEEE
Q ss_conf             653101199999999999999997311221000367610-1047989999887776556886067988---799999997
Q gi|254780701|r  321 LSESAISLIDIVRECIIMLQLRAQEKNIEIFQKIDPSLS-SVWADEKGMRQVILNLLSNAVKFTAIGG---RVHVTVGWT  396 (495)
Q Consensus       321 l~~~~v~L~~li~~~~~~~~~~A~~~~~~l~~~~~~~~~-~v~~D~~~L~qvl~NLi~NAiK~T~~gG---~V~v~~~~~  396 (495)
                      ++.+++|+.+++++++..+.+.+..+++.+.++.+++.| .+++|+.+|+||+.||++||+|||++||   .|.+.+.. 
T Consensus        91 l~~~~~~l~~l~~~~~~~~~~~~~~~~i~l~~~~~~~~~~~v~~D~~~l~qvl~NLl~NAik~t~~g~~~~~i~v~~~~-  169 (258)
T 2c2a_A           91 INREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDE-  169 (258)
T ss_dssp             CCCEEEEHHHHHHHHHHHHHHHHHHTTCEEEEEESSCSCCEEEECHHHHHHHHHHHHHHHHHTCCTTCTTCEEEEEEEE-
T ss_pred             CEEEEECHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCEEEEECHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEE-
T ss_conf             4215876999999999999999997697899970899866999879999999999999999855358982489999960-


Q ss_pred             CCCEEEEEEEECCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCEEEEEEECCCCEEEEEEECHHH
Q ss_conf             69859999987899789878544226523157776789998880589999999961985999979899529889847247
Q gi|254780701|r  397 SGRGQYISIKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLREGVEVIAILPNTR  476 (495)
Q Consensus       397 ~~~~~~i~V~DtG~GI~~e~~~~iF~~F~r~~~~~~~~~~GtGLGLaIvk~lve~hgG~i~v~S~~G~Gt~f~v~LP~~~  476 (495)
                      .++.+.|+|+|+|+|||++++++||+||||++++.++..+|+||||+|||+|+++|||+|+++|++|+||+|+++||..+
T Consensus       170 ~~~~~~i~V~D~G~GI~~e~~~~iF~~F~r~~~~~~~~~~G~GLGL~i~k~iv~~hgG~I~v~S~~g~Gt~f~i~lP~~~  249 (258)
T 2c2a_A          170 KDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDR  249 (258)
T ss_dssp             ETTEEEEEEEECSSCCCGGGTTGGGSTTCCCC---------CCCTHHHHHHHHHHTTCEEEEEEETTTEEEEEEEEECCC
T ss_pred             CCCEEEEEEEECCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCEEEEEEEECCC
T ss_conf             59989999998289889899998745988288888899994048999999999983998999955999269999961897


Q ss_pred             CC
Q ss_conf             07
Q gi|254780701|r  477 VL  478 (495)
Q Consensus       477 ~~  478 (495)
                      ..
T Consensus       250 ~~  251 (258)
T 2c2a_A          250 AG  251 (258)
T ss_dssp             --
T ss_pred             CC
T ss_conf             57



>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transferase, two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Back     alignment and structure
>1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozyme 1; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozyme 3; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: LPA ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Back     alignment and structure
>1b3q_A Protein (chemotaxis protein CHEA); histine kinase, signal transduction, multi- domains protein, transferase; 2.60A {Thermotoga maritima} SCOP: a.30.2.1 b.40.7.1 d.122.1.3 PDB: 2ch4_A* Back     alignment and structure
>3ehh_A Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* Back     alignment and structure
>1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Back     alignment and structure
>1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 Back     alignment and structure
>1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transferase; 1.60A {Escherichia coli K12} SCOP: d.122.1.3 Back     alignment and structure
>3ehg_A Sensor kinase (YOCF protein); GHL ATPase domain, transferase; HET: ATP; 1.74A {Bacillus subtilis} Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} Back     alignment and structure
>1ixm_A SPO0B, protein (sporulation response regulatory protein); phosphotransferase, two component system; 2.60A {Bacillus subtilis} SCOP: d.123.1.1 PDB: 2ftk_A* 1f51_A Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Back     alignment and structure
>1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* Back     alignment and structure
>3ke6_A Protein RV1364C/MT1410; anti-sigma factor, anti-sigma factor antagonist, phosphatase serine kinase, ATPase, unknown function; 2.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Back     alignment and structure
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Back     alignment and structure
>1zxm_A TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; GHKL nucleotide-binding fold; HET: DNA ANP; 1.87A {Homo sapiens} PDB: 1zxn_A* Back     alignment and structure
>1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure