255764487

255764487

heat shock protein

GeneID in NCBI database:8209706Locus tag:CLIBASIA_02945
Protein GI in NCBI database:255764487Protein Accession:YP_003065115.2
Gene range:-(564296, 564955)Protein Length:219aa
Gene description:heat shock protein
COG prediction:[O] Molecular chaperone GrpE (heat shock protein)
KEGG prediction:grpE; heat shock protein; K03687 molecular chaperone GrpE
SEED prediction:Heat shock protein GrpE
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Protein chaperones;
Heat shock dnaK gene cluster extended
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN
ccccHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEHHccccccHHHHHHHHEEEcccccccEEEEEEEccEEEccEEEEccEEEEEccccccccccccccccccccccHHHHHHHHccc
ccccccHHccHHHccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccccHHHHHHHHccHHHHHHHHHHHHHcccEEEccccccccHHHHHEEEEccccccccccEEEEEEccEEccccEEEEEEEEEEccccccccccccccccccccccccccccccccc
metfmseknidkeknpsnansstaeekseinipeeslnqseEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSraldsapldlanseKKSESVLKSLIEGIEMTRREMMSTLERygvkkidakdqkfnpnmhqamfeephdtvpantIIKVVQdgyainervlRPALvsiskgktqnpteekketieqpspldieernktqtkn
metfmseknidkeknpsnansstaeekseinipeeslnqseefrDKYLRVIAEMenlrrrtdrekkdaqsysiakfardmLSVSDNLSRALDSapldlansekksesVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERvlrpalvsiskgktqnpteekketieqpspldieernktqtkn
METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANsekksesvlkslIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN
*************************************NQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAP************VLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS***********************************
*********************************EESLNQSEEFRDKYLRVIAEMENLRR***********YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISK***************QPSPLDIEERNKTQTKN
************************EEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKG*******************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQxxxxxxxxxxxxxxxxxxxxxTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN
METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN
METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target219 heat shock protein [Candidatus Liberibacter asiaticus s
315121867212 heat shock protein [Candidatus Liberibacter solanacearu 1 7e-73
15964131208 heat shock protein [Sinorhizobium meliloti 1021] Length 1 3e-51
150395240208 heat shock protein GrpE [Sinorhizobium medicae WSM419] 1 3e-50
222147324204 heat shock protein GrpE [Agrobacterium vitis S4] Length 1 4e-50
325291763211 GRPE protein [Agrobacterium sp. H13-3] Length = 211 1 8e-50
116563466211 GrpE [Agrobacterium tumefaciens] Length = 211 1 9e-49
15887680211 GRPE protein [Agrobacterium tumefaciens str. C58] Lengt 1 1e-48
227820599222 heat shock protein GrpE [Sinorhizobium fredii NGR234] L 1 2e-48
209547620210 heat shock protein GrpE [Rhizobium leguminosarum bv. tr 1 5e-48
241202763210 heat shock protein GrpE [Rhizobium leguminosarum bv. tr 1 7e-48
>gi|315121867|ref|YP_004062356.1| heat shock protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 212 Back     alignment and organism information
 Score =  277 bits (709), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 141/212 (66%), Positives = 173/212 (81%), Gaps = 7/212 (3%)

Query: 11  DKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQS 70
           +KE N SN N  + EEK   N  EE+  ++EEFR+KYLRV+A+MEN+RRRTDRE +DAQS
Sbjct: 3   EKENNHSNTNEDSVEEKINNNPLEEAQAKAEEFREKYLRVLADMENIRRRTDREIQDAQS 62

Query: 71  YSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERY 130
           YSIA FARDMLSVSDNLSRAL+S P+D     + S+S +KSLI+GIEMTRREMMSTLE+Y
Sbjct: 63  YSIAAFARDMLSVSDNLSRALNSVPIDKT---QNSDSEIKSLIDGIEMTRREMMSTLEKY 119

Query: 131 GVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT 190
           GVKKIDAK+QKFNPN+HQAMFEE ++T+P+NT+IKVVQDGYAI ER+LRPALV ISKGK 
Sbjct: 120 GVKKIDAKNQKFNPNIHQAMFEESNETIPSNTVIKVVQDGYAIGERILRPALVGISKGKN 179

Query: 191 QNPTE----EKKETIEQPSPLDIEERNKTQTK 218
           +NP E    ++ E  E+ S ++ EE N+TQTK
Sbjct: 180 KNPVEQIPSQENENKEKSSTINKEENNETQTK 211


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15964131|ref|NP_384484.1| heat shock protein [Sinorhizobium meliloti 1021] Length = 208 Back     alignment and organism information
>gi|150395240|ref|YP_001325707.1| heat shock protein GrpE [Sinorhizobium medicae WSM419] Length = 208 Back     alignment and organism information
>gi|222147324|ref|YP_002548281.1| heat shock protein GrpE [Agrobacterium vitis S4] Length = 204 Back     alignment and organism information
>gi|325291763|ref|YP_004277627.1| GRPE protein [Agrobacterium sp. H13-3] Length = 211 Back     alignment and organism information
>gi|116563466|gb|ABJ99755.1| GrpE [Agrobacterium tumefaciens] Length = 211 Back     alignment and organism information
>gi|15887680|ref|NP_353361.1| GRPE protein [Agrobacterium tumefaciens str. C58] Length = 211 Back     alignment and organism information
>gi|227820599|ref|YP_002824569.1| heat shock protein GrpE [Sinorhizobium fredii NGR234] Length = 222 Back     alignment and organism information
>gi|209547620|ref|YP_002279537.1| heat shock protein GrpE [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 210 Back     alignment and organism information
>gi|241202763|ref|YP_002973859.1| heat shock protein GrpE [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 210 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target219 heat shock protein [Candidatus Liberibacter asiaticus s
PRK14141209 PRK14141, PRK14141, heat shock protein GrpE; Provisiona 4e-58
PRK14155208 PRK14155, PRK14155, heat shock protein GrpE; Provisiona 5e-34
COG0576193 COG0576, GrpE, Molecular chaperone GrpE (heat shock pro 4e-33
PRK14150193 PRK14150, PRK14150, heat shock protein GrpE; Provisiona 9e-32
PRK14139185 PRK14139, PRK14139, heat shock protein GrpE; Provisiona 2e-28
PRK14151176 PRK14151, PRK14151, heat shock protein GrpE; Provisiona 1e-27
KOG3003236 KOG3003, KOG3003, KOG3003, Molecular chaperone of the G 2e-26
PRK14153194 PRK14153, PRK14153, heat shock protein GrpE; Provisiona 5e-25
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provisiona 2e-24
PRK14149191 PRK14149, PRK14149, heat shock protein GrpE; Provisiona 7e-21
PRK14162194 PRK14162, PRK14162, heat shock protein GrpE; Provisiona 8e-21
PRK10325197 PRK10325, PRK10325, heat shock protein GrpE; Provisiona 7e-20
PRK14161178 PRK14161, PRK14161, heat shock protein GrpE; Provisiona 3e-19
PRK14156177 PRK14156, PRK14156, heat shock protein GrpE; Provisiona 6e-18
PRK14144199 PRK14144, PRK14144, heat shock protein GrpE; Provisiona 2e-17
PRK14159176 PRK14159, PRK14159, heat shock protein GrpE; Provisiona 6e-17
PRK14143238 PRK14143, PRK14143, heat shock protein GrpE; Provisiona 6e-17
PRK14145196 PRK14145, PRK14145, heat shock protein GrpE; Provisiona 1e-15
PRK14147172 PRK14147, PRK14147, heat shock protein GrpE; Provisiona 2e-14
PRK14160211 PRK14160, PRK14160, heat shock protein GrpE; Provisiona 2e-13
PRK14157227 PRK14157, PRK14157, heat shock protein GrpE; Provisiona 1e-06
pfam01025162 pfam01025, GrpE, GrpE 3e-41
cd00446137 cd00446, GrpE, GrpE is the adenine nucleotide exchange 1e-38
PRK14158194 PRK14158, PRK14158, heat shock protein GrpE; Provisiona 2e-22
PRK14148195 PRK14148, PRK14148, heat shock protein GrpE; Provisiona 2e-17
PRK14154208 PRK14154, PRK14154, heat shock protein GrpE; Provisiona 3e-14
PRK14146215 PRK14146, PRK14146, heat shock protein GrpE; Provisiona 4e-11
PRK14163214 PRK14163, PRK14163, heat shock protein GrpE; Provisiona 1e-09
PRK14164218 PRK14164, PRK14164, heat shock protein GrpE; Provisiona 2e-07
PRK14142223 PRK14142, PRK14142, heat shock protein GrpE; Provisiona 3e-06
>gnl|CDD|172630 PRK14141, PRK14141, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184541 PRK14155, PRK14155, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|30921 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184539 PRK14150, PRK14150, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184532 PRK14139, PRK14139, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|172640 PRK14151, PRK14151, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|38213 KOG3003, KOG3003, KOG3003, Molecular chaperone of the GrpE family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184540 PRK14153, PRK14153, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184533 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184538 PRK14149, PRK14149, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184545 PRK14162, PRK14162, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|182379 PRK10325, PRK10325, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|172649 PRK14161, PRK14161, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184542 PRK14156, PRK14156, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184535 PRK14144, PRK14144, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|172647 PRK14159, PRK14159, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184534 PRK14143, PRK14143, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184536 PRK14145, PRK14145, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184537 PRK14147, PRK14147, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184544 PRK14160, PRK14160, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184543 PRK14157, PRK14157, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|144566 pfam01025, GrpE, GrpE Back     alignment and domain information
>gnl|CDD|73207 cd00446, GrpE, GrpE is the adenine nucleotide exchange factor of DnaK (Hsp70)-type ATPases Back     alignment and domain information
>gnl|CDD|172646 PRK14158, PRK14158, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|172637 PRK14148, PRK14148, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|172642 PRK14154, PRK14154, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|172635 PRK14146, PRK14146, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184546 PRK14163, PRK14163, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184547 PRK14164, PRK14164, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|172631 PRK14142, PRK14142, heat shock protein GrpE; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 219 heat shock protein [Candidatus Liberibacter asiaticus s
PRK10325197 heat shock protein GrpE; Provisional 100.0
COG0576193 GrpE Molecular chaperone GrpE (heat shock protein) [Pos 100.0
pfam01025162 GrpE GrpE. 100.0
cd00446137 GrpE GrpE is the adenine nucleotide exchange factor of 100.0
KOG3003236 consensus 100.0
>PRK10325 heat shock protein GrpE; Provisional Back     alignment and domain information
>COG0576 GrpE Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam01025 GrpE GrpE Back     alignment and domain information
>cd00446 GrpE GrpE is the adenine nucleotide exchange factor of DnaK (Hsp70)-type ATPases Back     alignment and domain information
>KOG3003 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target219 heat shock protein [Candidatus Liberibacter asiaticus s
1dkg_A197 Crystal Structure Of The Nucleotide Exchange Factor 1e-21
3a6m_A177 Crystal Structure Of Grpe From Thermus Thermophilus 1e-18
>gi|2392281|pdb|1DKG|A Chain A, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 197 Back     alignment and structure
 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 55/190 (28%), Positives = 98/190 (51%), Gaps = 9/190 (4%)

Query: 2   ETFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFR-DKYLRVIAEMENLRRR 60
           E  M +    +   P  +         ++   E  L +++    D  LRV AEMENLRRR
Sbjct: 16  EIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLRRR 75

Query: 61  TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120
           T+ + + A  +++ KF  ++L V D+L RAL+ A              + +++E IE+T 
Sbjct: 76  TELDIEKAHKFALEKFINELLPVIDSLDRALEVADKA--------NPDMSAMVEDIELTL 127

Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180
           + M+  + ++GV+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R 
Sbjct: 128 KSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRA 187

Query: 181 ALVSISKGKT 190
           A+V+++K K 
Sbjct: 188 AMVTVAKAKA 197


gi|283806832|pdb|3A6M|A Chain A, Crystal Structure Of Grpe From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target219 heat shock protein [Candidatus Liberibacter asiaticus s
3a6m_A177 Protein GRPE, HSP-70 cofactor; coiled-coil, four-helix 2e-28
1dkg_A197 Nucleotide exchange factor GRPE; HSP70, GRPE, nucleotid 1e-21
>3a6m_A Protein GRPE, HSP-70 cofactor; coiled-coil, four-helix bundle, dimer, chaperone, cytoplasm, stress response; 3.23A {Thermus thermophilus HB8} Length = 177 Back     alignment and structure
 Score =  121 bits (304), Expect = 2e-28
 Identities = 46/192 (23%), Positives = 86/192 (44%), Gaps = 15/192 (7%)

Query: 5   MSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRRTDRE 64
           M E+N +              +  E  + + +  + +  +DKYLR++A+ +N R+R + E
Sbjct: 1   MEERNHENTLEKDLEAVGQEAQALEERL-KAAEEELKGLKDKYLRLLADFDNYRKRMEEE 59

Query: 65  KKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMM 124
            K  +   + K  R +L V D+L RAL+ A     +             +G+   R    
Sbjct: 60  LKAREREGVLKALRALLPVLDDLDRALEFAEASPESI-----------RQGVRAIRDGFF 108

Query: 125 STLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVS 184
             L   GV+++  + + F+P  H+A+   P        + KV Q G+ + E ++RPA V+
Sbjct: 109 RILAGLGVEEVPGEGEAFDPRYHEAVGLLP---GEPGKVAKVFQRGFRMGEALVRPARVA 165

Query: 185 ISKGKTQNPTEE 196
           + + K +    E
Sbjct: 166 VGEEKREEADLE 177


>1dkg_A Nucleotide exchange factor GRPE; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: b.73.1.1 h.1.9.1 Length = 197 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target219 heat shock protein [Candidatus Liberibacter asiaticus s
1dkg_A197 Nucleotide exchange factor GRPE; HSP70, GRPE, nucleotid 100.0
3a6m_A177 Protein GRPE, HSP-70 cofactor; coiled-coil, four-helix 100.0
>1dkg_A Nucleotide exchange factor GRPE; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: b.73.1.1 h.1.9.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=332.31  Aligned_cols=148  Identities=34%  Similarity=0.608  Sum_probs=137.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             99999999999999999889999999999999999964243343203157899999972122233210111278998764
Q gi|255764487|r   35 ESLNQSEEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIE  114 (219)
Q Consensus        35 ~~~~e~~elkdk~lR~~AE~eN~rkR~~ke~~~~~~~a~~~~~~~lL~v~D~lerAl~~~~~~~~~~~~~~~~~~~~~~~  114 (219)
                      ++.....+++++|+|++|||+|||||++++++++++||+++|+++||||+|+|+||+.+...        .+..+++|++
T Consensus        50 ~l~~~~~~~kd~~lR~~Ae~eN~rkR~~ke~~~~~~~a~~~~~~~lLpv~DnlerAl~~~~~--------~~~~~~~~~~  121 (197)
T 1dkg_A           50 QLAEAQTRERDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADK--------ANPDMSAMVE  121 (197)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSGGGHHHHSHHHHHHHHHHHHCC--------------CHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCC--------CCHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999970314599999852101--------1234555652


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEEEEECCCEEECCEEEECCEEEEECCCC
Q ss_conf             4799999999998641100013688875700577752243458977459999708817756782000248604888
Q gi|255764487|r  115 GIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT  190 (219)
Q Consensus       115 Gi~mi~k~l~~~L~~~GV~~i~~~G~~FDP~~HeAi~~~~~~~~~~~tVi~v~q~GY~l~~rvlRpA~V~Vsk~~~  190 (219)
                      ||.||+++|.++|+++||++|+++|++|||++||||++++++++++|||++|+|+||+|||||||||+|+|||+|+
T Consensus       122 Gv~~i~~~l~~~L~~~gv~~i~~~G~~FDP~~HeAv~~~~~~~~~~~~Vv~v~q~GY~l~~rvlRpA~V~Vsk~~~  197 (197)
T 1dkg_A          122 DIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTVAKAKA  197 (197)
T ss_dssp             HHHHHHHHHHHHHTTTTEEEECCCSSBCCTTSEEEEEEEECSSSCTTBEEEEEECEEEETTEEEECEEEEEEECCC
T ss_pred             HHHHHHHHHHHHHHHCCCEEECCCCCCCCCHHHEEEEEECCCCCCCCEEEEEEECCCEECCEECCCCEEEEECCCC
T ss_conf             1999999999999972973313578998925860666753799991958999667908799971175589807999



>3a6m_A Protein GRPE, HSP-70 cofactor; coiled-coil, four-helix bundle, dimer, chaperone, cytoplasm, stress response; 3.23A {Thermus thermophilus HB8} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 219 heat shock protein [Candidatus Liberibacter asiaticus s
d1dkga159 b.73.1.1 (A:139-197) Head domain of nucleotide exchange 3e-18
>d1dkga1 b.73.1.1 (A:139-197) Head domain of nucleotide exchange factor GrpE {Escherichia coli [TaxId: 562]} Length = 59 Back     information, alignment and structure

class: All beta proteins
fold: Head domain of nucleotide exchange factor GrpE
superfamily: Head domain of nucleotide exchange factor GrpE
family: Head domain of nucleotide exchange factor GrpE
domain: Head domain of nucleotide exchange factor GrpE
species: Escherichia coli [TaxId: 562]
 Score = 85.8 bits (213), Expect = 3e-18
 Identities = 19/58 (32%), Positives = 34/58 (58%)

Query: 132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGK 189
           V+ I   +   +PN+HQA+     D V    ++ ++Q GY +N R +R A+V+++K K
Sbjct: 1   VEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTVAKAK 58


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target219 heat shock protein [Candidatus Liberibacter asiaticus s
d1dkga159 Head domain of nucleotide exchange factor GrpE {Escheri 99.79
>d1dkga1 b.73.1.1 (A:139-197) Head domain of nucleotide exchange factor GrpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Head domain of nucleotide exchange factor GrpE
superfamily: Head domain of nucleotide exchange factor GrpE
family: Head domain of nucleotide exchange factor GrpE
domain: Head domain of nucleotide exchange factor GrpE
species: Escherichia coli [TaxId: 562]
Probab=99.79  E-value=1.8e-20  Score=148.51  Aligned_cols=59  Identities=32%  Similarity=0.611  Sum_probs=56.9

Q ss_pred             HCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEEEEECCCEEECCEEEECCEEEEECCCC
Q ss_conf             00013688875700577752243458977459999708817756782000248604888
Q gi|255764487|r  132 VKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT  190 (219)
Q Consensus       132 V~~i~~~G~~FDP~~HeAi~~~~~~~~~~~tVi~v~q~GY~l~~rvlRpA~V~Vsk~~~  190 (219)
                      |+.|+++|++|||++||||+++++++.++|||++|+|+||+|+|||||||+|+|||+|+
T Consensus         1 ve~i~~~g~~FDP~~HeAv~~~~~~~~~~~~I~~v~~~GY~~~~rvlRpA~V~V~k~~s   59 (59)
T d1dkga1           1 VEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTVAKAKA   59 (59)
T ss_dssp             EEEECCCSSBCCTTSEEEEEEEECSSSCTTBEEEEEECEEEETTEEEECEEEEEEECCC
T ss_pred             CCEECCCCCCCCHHHCEEEEEECCCCCCCCEEEEEEECCCEECCEEEECCEEEEECCCC
T ss_conf             92507789988977910705865799998989999807949899993164899945899



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 219 heat shock protein [Candidatus Liberibacter asiati
3a6m_A_35-11581 (A:35-115) Protein GRPE, HSP-70 cofactor; coiled-c 2e-19
1dkg_A_138-19760 (A:138-197) Nucleotide exchange factor GRPE; HSP70 4e-19
3a6m_A_116-17762 (A:116-177) Protein GRPE, HSP-70 cofactor; coiled- 1e-16
>3a6m_A (A:35-115) Protein GRPE, HSP-70 cofactor; coiled-coil, four-helix bundle, dimer, chaperone, cytoplasm, stress response; 3.23A {Thermus thermophilus HB8}Length = 81 Back     alignment and structure
 Score = 90.5 bits (225), Expect = 2e-19
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 11/91 (12%)

Query: 41  EEFRDKYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLAN 100
           +  +DKYLR++A+ +N R+R + E K  +   + K  R +L V D+L RAL+ A      
Sbjct: 2   KGLKDKYLRLLADFDNYRKRMEEELKAREREGVLKALRALLPVLDDLDRALEFAEAS--- 58

Query: 101 SEKKSESVLKSLIEGIEMTRREMMSTLERYG 131
                    +S+ +G+   R      L   G
Sbjct: 59  --------PESIRQGVRAIRDGFFRILAGLG 81


>1dkg_A (A:138-197) Nucleotide exchange factor GRPE; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli}Length = 60 Back     alignment and structure
>3a6m_A (A:116-177) Protein GRPE, HSP-70 cofactor; coiled-coil, four-helix bundle, dimer, chaperone, cytoplasm, stress response; 3.23A {Thermus thermophilus HB8}Length = 62 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target219 heat shock protein [Candidatus Liberibacter asiaticus s
1dkg_A_138-19760 Nucleotide exchange factor GRPE; HSP70, GRPE, nucl 99.81
3a6m_A_116-17762 Protein GRPE, HSP-70 cofactor; coiled-coil, four-h 99.76
3a6m_A_35-11581 Protein GRPE, HSP-70 cofactor; coiled-coil, four-h 99.79
>1dkg_A (A:138-197) Nucleotide exchange factor GRPE; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} Back     alignment and structure
Probab=99.81  E-value=9.1e-21  Score=152.88  Aligned_cols=60  Identities=33%  Similarity=0.638  Sum_probs=58.4

Q ss_pred             HHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEEEEECCCEEECCEEEECCEEEEECCCC
Q ss_conf             100013688875700577752243458977459999708817756782000248604888
Q gi|255764487|r  131 GVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRPALVSISKGKT  190 (219)
Q Consensus       131 GV~~i~~~G~~FDP~~HeAi~~~~~~~~~~~tVi~v~q~GY~l~~rvlRpA~V~Vsk~~~  190 (219)
                      ||++|+++|++|||++||||+++++++.++|||++|+|+||+|+|||||||+|+|||+++
T Consensus         1 Gi~~i~~~G~~FDp~~HeAv~~~~~~~~~~~~V~~v~~~GY~~~~rvlRpA~V~V~k~~a   60 (60)
T 1dkg_A            1 GVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTVAKAKA   60 (60)
T ss_dssp             TEEEECCCSSBCCTTSEEEEEEEECSSSCTTBEEEEEECEEEETTEEEECEEEEEEECCC
T ss_pred             CCCCCCCCCCCCCCCCCEEEEEECCCCCCCCEEEEEEECCEEECCEECCCCEEEEECCCC
T ss_conf             983236578888976124410305899995968999717848899972074699917999



>3a6m_A (A:116-177) Protein GRPE, HSP-70 cofactor; coiled-coil, four-helix bundle, dimer, chaperone, cytoplasm, stress response; 3.23A {Thermus thermophilus HB8} Back     alignment and structure
>3a6m_A (A:35-115) Protein GRPE, HSP-70 cofactor; coiled-coil, four-helix bundle, dimer, chaperone, cytoplasm, stress response; 3.23A {Thermus thermophilus HB8} Back     alignment and structure