254780703

254780703

putative phosphate transport system protein

GeneID in NCBI database:8209707Locus tag:CLIBASIA_02950
Protein GI in NCBI database:254780703Protein Accession:YP_003065116.1
Gene range:+(563455, 564144)Protein Length:229aa
Gene description:putative phosphate transport system protein
COG prediction:[P] Phosphate uptake regulator
KEGG prediction:phoU; putative phosphate transport system protein; K02039 phosphate transport system protein
SEED prediction:Phosphate transport system regulatory protein PhoU
Pathway involved in KEGG:not defined
Subsystem involved in SEED:High affinity phosphate transporter and control of PHO regulon;
Phosphate metabolism
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MSCHILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDKAIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLVWTIEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPRNITLCTHLLFCSKNIERIGDHVTNIAETIHYMTTGVQPYKERVRKEDCE
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc
cccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccccccccc
MSCHILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDKAIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFgvprklvwtiEPLAELSLEQLSEILDVygsrstektqSICNRDGELDAMHTSLFRELLTYMmedprnitlcthLLFCSKNIERIGDHVTNIAETIHYMttgvqpykervrkedce
MSCHILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGdtvlahkvidndvVLDQLERDIGDKAIItiakrqpmasdLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLVWTIEPLAELSLEQLSEILDVYgsrstektqsicnrdgeldAMHTSLFRELLTYMMEDPRNITLCTHLLFCSKNIERIGDHVTNIAETIHymttgvqpykervrkedce
MSCHILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDKAIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLVWTIEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPRNITLCTHLLFCSKNIERIGDHVTNIAETIHYMTTGVQPYKERVRKEDCE
**CHILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDKAIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLA***********WTIEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPRNITLCTHLLFCSKNIERIGDHVTNIAETIHYMTTGV*************
MSCHILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDKAIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLVWTIEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPRNITLCTHLLFCSKNIERIGDHVTNIAETIHYMTTGVQPY**********
*SCHILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDKAIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLVWTIEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPRNITLCTHLLFCSKNIERIGDHVTNIAETIHYMTTGV*************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSCHILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDKAIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLVWTIEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPRNITLCTHLLFCSKNIERIGDHVTNIAETIHYMTTGVQPYKERVRKEDCE
MSCHILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDKAIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLVWTIEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPRNITLCTHLLFCSKNIERIGDHVTNIAETIHYMTTGVQPYKERVRKEDCE
MSCHILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDKAIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLVWTIEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPRNITLCTHLLFCSKNIERIGDHVTNIAETIHYMTTGVQPYKERVRKEDCE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target229 putative phosphate transport system protein [Candidatus
315121868229 putative phosphate transport system protein [Candidatus 1 1e-118
116250318237 phosphate transport system protein [Rhizobium leguminos 1 2e-88
222084783237 phosphate transport system regulatory protein PhoU [Agr 1 6e-88
241202936237 phosphate uptake regulator, PhoU [Rhizobium leguminosar 1 7e-88
209547781237 phosphate uptake regulator, PhoU [Rhizobium leguminosar 1 3e-87
86356167237 phosphate uptake transcriptional regulator protein [Rhi 1 4e-87
307307004266 phosphate uptake regulator, PhoU [Sinorhizobium melilot 1 1e-85
150395351237 phosphate uptake regulator PhoU [Sinorhizobium medicae 1 2e-85
222147388235 phosphate transport system regulatory protein PhoU [Agr 1 2e-85
325291857241 phosphate transport system regulatory protein [Agrobact 1 2e-85
>gi|315121868|ref|YP_004062357.1| putative phosphate transport system protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 229 Back     alignment and organism information
 Score =  427 bits (1098), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 205/229 (89%), Positives = 220/229 (96%)

Query: 1   MSCHILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLE 60
           MSCHILSAYDEELDFLS RIVEMG++SR+MVDSSVRAFIEGD VLAHKVIDND+VLDQL+
Sbjct: 1   MSCHILSAYDEELDFLSHRIVEMGVISRRMVDSSVRAFIEGDAVLAHKVIDNDIVLDQLK 60

Query: 61  RDIGDKAIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKL 120
           RDIGDKAIITIAKRQPMASDLREIVGSI+IAADLERIGDLAKNTAKRVLALQMFGVPRKL
Sbjct: 61  RDIGDKAIITIAKRQPMASDLREIVGSIRIAADLERIGDLAKNTAKRVLALQMFGVPRKL 120

Query: 121 VWTIEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPR 180
           V  IEPLA+LSLEQ+SEIL+VYG+RS EKTQ IC+RDGELDAMHTSLFR+LLTYMMEDPR
Sbjct: 121 VLAIEPLADLSLEQISEILEVYGNRSIEKTQLICSRDGELDAMHTSLFRKLLTYMMEDPR 180

Query: 181 NITLCTHLLFCSKNIERIGDHVTNIAETIHYMTTGVQPYKERVRKEDCE 229
           NI LCTHLLFCSKNIERIGDHVTNIAETIHYMTTG+QP+ E +RKEDCE
Sbjct: 181 NIILCTHLLFCSKNIERIGDHVTNIAETIHYMTTGIQPHIEGLRKEDCE 229


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116250318|ref|YP_766156.1| phosphate transport system protein [Rhizobium leguminosarum bv. viciae 3841] Length = 237 Back     alignment and organism information
>gi|222084783|ref|YP_002543312.1| phosphate transport system regulatory protein PhoU [Agrobacterium radiobacter K84] Length = 237 Back     alignment and organism information
>gi|241202936|ref|YP_002974032.1| phosphate uptake regulator, PhoU [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 237 Back     alignment and organism information
>gi|209547781|ref|YP_002279698.1| phosphate uptake regulator, PhoU [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 237 Back     alignment and organism information
>gi|86356167|ref|YP_468059.1| phosphate uptake transcriptional regulator protein [Rhizobium etli CFN 42] Length = 237 Back     alignment and organism information
>gi|307307004|ref|ZP_07586743.1| phosphate uptake regulator, PhoU [Sinorhizobium meliloti BL225C] Length = 266 Back     alignment and organism information
>gi|150395351|ref|YP_001325818.1| phosphate uptake regulator PhoU [Sinorhizobium medicae WSM419] Length = 237 Back     alignment and organism information
>gi|222147388|ref|YP_002548345.1| phosphate transport system regulatory protein PhoU [Agrobacterium vitis S4] Length = 235 Back     alignment and organism information
>gi|325291857|ref|YP_004277721.1| phosphate transport system regulatory protein [Agrobacterium sp. H13-3] Length = 241 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target229 putative phosphate transport system protein [Candidatus
TIGR02135212 TIGR02135, phoU_full, phosphate transport system regula 2e-54
PRK11115236 PRK11115, PRK11115, transcriptional regulator PhoU; Pro 5e-33
COG1283533 COG1283, NptA, Na+/phosphate symporter [Inorganic ion t 5e-04
COG0704240 COG0704, PhoU, Phosphate uptake regulator [Inorganic io 8e-42
pfam0189587 pfam01895, PhoU, PhoU domain 7e-15
pfam0189587 pfam01895, PhoU, PhoU domain 2e-11
>gnl|CDD|162721 TIGR02135, phoU_full, phosphate transport system regulatory protein PhoU Back     alignment and domain information
>gnl|CDD|182974 PRK11115, PRK11115, transcriptional regulator PhoU; Provisional Back     alignment and domain information
>gnl|CDD|31474 COG1283, NptA, Na+/phosphate symporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31048 COG0704, PhoU, Phosphate uptake regulator [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|145194 pfam01895, PhoU, PhoU domain Back     alignment and domain information
>gnl|CDD|145194 pfam01895, PhoU, PhoU domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 229 putative phosphate transport system protein [Candidatus
PRK11115236 transcriptional regulator PhoU; Provisional 100.0
TIGR02135213 phoU_full phosphate transport system regulatory protein 100.0
COG0704240 PhoU Phosphate uptake regulator [Inorganic ion transpor 100.0
COG1283533 NptA Na+/phosphate symporter [Inorganic ion transport a 99.92
pfam01865214 PhoU_div Protein of unknown function DUF47. This family 98.96
COG1392217 Phosphate transport regulator (distant homolog of PhoU) 98.78
TIGR00153229 TIGR00153 conserved hypothetical protein TIGR00153; Int 91.54
TIGR02135213 phoU_full phosphate transport system regulatory protein 99.35
PRK11115236 transcriptional regulator PhoU; Provisional 99.19
COG0704240 PhoU Phosphate uptake regulator [Inorganic ion transpor 99.16
pfam0189587 PhoU PhoU domain. This family contains phosphate regula 99.12
COG3273204 Uncharacterized conserved protein [Function unknown] 98.46
pfam0189587 PhoU PhoU domain. This family contains phosphate regula 99.17
COG1283533 NptA Na+/phosphate symporter [Inorganic ion transport a 98.28
COG3273204 Uncharacterized conserved protein [Function unknown] 97.7
pfam01865214 PhoU_div Protein of unknown function DUF47. This family 94.37
COG1392217 Phosphate transport regulator (distant homolog of PhoU) 92.97
TIGR01013497 2a58 sodium-dependent inorganic phosphate (Pi) transpor 93.1
>PRK11115 transcriptional regulator PhoU; Provisional Back     alignment and domain information
>TIGR02135 phoU_full phosphate transport system regulatory protein PhoU; InterPro: IPR008170 This family describes PhoU, a regulatory protein of unknown mechanism for high-affinity phosphate ABC transporter systems Back     alignment and domain information
>COG0704 PhoU Phosphate uptake regulator [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1283 NptA Na+/phosphate symporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam01865 PhoU_div Protein of unknown function DUF47 Back     alignment and domain information
>COG1392 Phosphate transport regulator (distant homolog of PhoU) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00153 TIGR00153 conserved hypothetical protein TIGR00153; InterPro: IPR002727 This family includes prokaryotic proteins of unknown function, as well as a protein annotated as the pit accessory protein from Sinorhizobium meliloti (O30498 from SWISSPROT) Back     alignment and domain information
>TIGR02135 phoU_full phosphate transport system regulatory protein PhoU; InterPro: IPR008170 This family describes PhoU, a regulatory protein of unknown mechanism for high-affinity phosphate ABC transporter systems Back     alignment and domain information
>PRK11115 transcriptional regulator PhoU; Provisional Back     alignment and domain information
>COG0704 PhoU Phosphate uptake regulator [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam01895 PhoU PhoU domain Back     alignment and domain information
>COG3273 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam01895 PhoU PhoU domain Back     alignment and domain information
>COG1283 NptA Na+/phosphate symporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3273 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam01865 PhoU_div Protein of unknown function DUF47 Back     alignment and domain information
>COG1392 Phosphate transport regulator (distant homolog of PhoU) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01013 2a58 sodium-dependent inorganic phosphate (Pi) transporter; InterPro: IPR003841 This family includes the mammalian type II renal Na+/Pi-cotransporters and other proteins from lower eukaryotes and bacteria some of which are also Na+/Pi-cotransporters Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target229 putative phosphate transport system protein [Candidatus
1t8b_A227 Crystal Structure Of Refolded Phou-Like Protein (Gi 2e-40
1t72_A227 Crystal Structure Of Phosphate Transport System Pro 3e-39
1xwm_A217 The Crystal Structure Of Phou (Phosphate Uptake Reg 1e-33
2i0m_A216 Crystal Structure Of The Phosphate Transport System 2e-31
1sum_B235 Crystal Structure Of A Hypothetical Protein At 2.0 8e-27
1xwm_A217 The Crystal Structure Of Phou (Phosphate Uptake Reg 5e-04
1vct_A205 Crystal Structure Of Putative Potassium Channel Rel 7e-04
>gi|58176769|pdb|1T8B|A Chain A, Crystal Structure Of Refolded Phou-Like Protein (Gi 2983430) From Aquifex Aeolicus Length = 227 Back     alignment and structure
 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 71/216 (32%), Positives = 123/216 (56%), Gaps = 1/216 (0%)

Query: 11  EELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDKAIIT 70
           +EL+    ++++M  + ++ +D +  A  + +  LA +VI  D  +D LE DI  + I  
Sbjct: 11  KELEETKEQVIKMAKLVQEAIDKATEALNKQNVELAEEVIKGDDTIDLLEVDIERRCIRM 70

Query: 71  IAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLVWTIEPLAEL 130
           IA  QP A DLR I+G  KI +DLER+GD A+N A+R + L      +  V  I  ++E+
Sbjct: 71  IALYQPEAGDLRMIMGIYKIVSDLERMGDEAENIAERAILLAEEPPLKPYV-NINFMSEI 129

Query: 131 SLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPRNITLCTHLLF 190
             E +++ +  +  + T   + +  +D  +D ++  L REL+TY++EDPRNI    HL F
Sbjct: 130 VKEMVNDSVISFIQQDTLLAKKVIEKDDTVDELYHQLERELMTYVLEDPRNIKRAMHLSF 189

Query: 191 CSKNIERIGDHVTNIAETIHYMTTGVQPYKERVRKE 226
            +++ ERI DH  N+AE   Y++ G     + ++++
Sbjct: 190 VARHYERIADHAENVAEAAIYLSEGEIVKHQHIKEK 225


>gi|58176751|pdb|1T72|A Chain A, Crystal Structure Of Phosphate Transport System Protein Phou From Aquifex Aeolicus Length = 227 Back     alignment and structure
>gi|60594474|pdb|1XWM|A Chain A, The Crystal Structure Of Phou (Phosphate Uptake Regulator), Structural Genomics Length = 217 Back     alignment and structure
gi|116667927|pdb|2I0M|A Chain A, Crystal Structure Of The Phosphate Transport System Regulatory Protein Phou From Streptococcus Pneumoniae Length = 216 Back     alignment and structure
gi|52695574|pdb|1SUM|B Chain B, Crystal Structure Of A Hypothetical Protein At 2.0 A Resolution Length = 235 Back     alignment and structure
>gi|60594474|pdb|1XWM|A Chain A, The Crystal Structure Of Phou (Phosphate Uptake Regulator), Structural Genomics Length = 217 Back     alignment and structure
gi|62738121|pdb|1VCT|A Chain A, Crystal Structure Of Putative Potassium Channel Related Protein From Pyrococcus Horikoshii Length = 205 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target229 putative phosphate transport system protein [Candidatus
2i0m_A216 Phosphate transport system protein PHOU; zinc-binding p 2e-40
1sum_B235 Phosphate transport system protein PHOU homolog 2; ABC 4e-39
1t72_A227 Phosphate transport system protein PHOU homolog; helix 4e-38
1xwm_A217 PHOU, phosphate uptake regulator; negative phosphate up 7e-36
1xwm_A217 PHOU, phosphate uptake regulator; negative phosphate up 1e-05
1vct_A205 Hypothetical protein PH0236; helix rich, structural gen 5e-13
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carr 8e-05
>2i0m_A Phosphate transport system protein PHOU; zinc-binding protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pneumoniae TIGR4} Length = 216 Back     alignment and structure
 Score =  161 bits (407), Expect = 2e-40
 Identities = 55/209 (26%), Positives = 103/209 (49%), Gaps = 1/209 (0%)

Query: 7   SAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDK 66
           + +D EL  L +  + +G +  +    ++ A    D  +A  +I+ D  ++Q +  I   
Sbjct: 3   NQFDLELHELEQSFLGLGQLVLETASKALLALASKDKEMAELIINKDHAINQGQSAIELT 62

Query: 67  AIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLVWTIEP 126
               +A +QP  SDLR ++  +   +DLER+GD     AK VL L+   +       +  
Sbjct: 63  CARLLALQQPQVSDLRFVISIMSSCSDLERMGDHMAGIAKAVLQLKENQLAPDEE-QLHQ 121

Query: 127 LAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPRNITLCT 186
           + +LSL  L+++L  +      K  SI  +D ++D  + +L +E++  M +   +I   T
Sbjct: 122 MGKLSLSMLADLLVAFPLHQASKAISIAQKDEQIDQYYYALSKEIIGLMKDQETSIPNGT 181

Query: 187 HLLFCSKNIERIGDHVTNIAETIHYMTTG 215
             L+   ++ER  D++ NI E + Y+ TG
Sbjct: 182 QYLYIIGHLERFADYIANICERLVYLETG 210


>1sum_B Phosphate transport system protein PHOU homolog 2; ABC transport, PST, structural genomics, berkeley structural genomics center, BSGC; 2.00A {Thermotoga maritima} SCOP: a.7.12.1 Length = 235 Back     alignment and structure
>1t72_A Phosphate transport system protein PHOU homolog; helix bundle, structural genomics, BSGC structure funded by NIH, protein structure initiative; 2.90A {Aquifex aeolicus} SCOP: a.7.12.1 PDB: 1t8b_A Length = 227 Back     alignment and structure
>1xwm_A PHOU, phosphate uptake regulator; negative phosphate uptake regulator, structural genomics, protein structure initiative, PSI; 2.50A {Geobacillus stearothermophilus} SCOP: a.7.12.1 Length = 217 Back     alignment and structure
>1xwm_A PHOU, phosphate uptake regulator; negative phosphate uptake regulator, structural genomics, protein structure initiative, PSI; 2.50A {Geobacillus stearothermophilus} SCOP: a.7.12.1 Length = 217 Back     alignment and structure
>1vct_A Hypothetical protein PH0236; helix rich, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.85A {Pyrococcus horikoshii} SCOP: a.7.12.1 d.286.1.1 PDB: 2bkn_A 2bko_A 2bkp_A Length = 205 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target229 putative phosphate transport system protein [Candidatus
1sum_B235 Phosphate transport system protein PHOU homolog 2; ABC 100.0
1xwm_A217 PHOU, phosphate uptake regulator; negative phosphate up 100.0
1t72_A227 Phosphate transport system protein PHOU homolog; helix 100.0
2i0m_A216 Phosphate transport system protein PHOU; zinc-binding p 100.0
2olt_A227 Hypothetical protein; NP_719307.1, DUF47, structural ge 99.21
3l39_A227 Putative PHOU-like phosphate regulatory protein; BT4638 98.94
1vct_A205 Hypothetical protein PH0236; helix rich, structural gen 99.15
1xwm_A217 PHOU, phosphate uptake regulator; negative phosphate up 99.06
1t72_A227 Phosphate transport system protein PHOU homolog; helix 99.03
1sum_B 235 Phosphate transport system protein PHOU homolog 2; ABC 99.01
2i0m_A216 Phosphate transport system protein PHOU; zinc-binding p 98.95
1vct_A205 Hypothetical protein PH0236; helix rich, structural gen 98.68
2olt_A227 Hypothetical protein; NP_719307.1, DUF47, structural ge 96.35
3l39_A227 Putative PHOU-like phosphate regulatory protein; BT4638 92.69
>1sum_B Phosphate transport system protein PHOU homolog 2; ABC transport, PST, structural genomics, berkeley structural genomics center, BSGC; 2.00A {Thermotoga maritima} SCOP: a.7.12.1 Back     alignment and structure
Probab=100.00  E-value=8.9e-43  Score=323.20  Aligned_cols=217  Identities=29%  Similarity=0.407  Sum_probs=206.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             89999999999999999999999999999999996499999999984799999999999999999971397624655542
Q gi|254780703|r    6 LSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDKAIITIAKRQPMASDLREIV   85 (229)
Q Consensus         6 ~~~f~~~L~~l~~~i~~m~~~v~~~l~~~~~al~~~D~~~a~~v~~~d~~id~~~~~I~~~~~~lLa~~qPva~DLR~i~   85 (229)
                      .+.|+++|+++++++.+||.+|.+|+..++++|.++|+++|++|++.|+.||.++.+|+++|+.+++++||+|.|||.+.
T Consensus         2 ~~~~~~~l~~l~~~i~~M~~~v~~~l~~a~~al~~~D~~~a~~V~~~d~~Id~l~~~I~~~~~~~la~~~p~a~dlr~i~   81 (235)
T 1sum_B            2 NRLLNEKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAMEVLGLFSPIGKPLLTVT   81 (235)
T ss_dssp             CCTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCSHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHH
T ss_conf             67899999999999999999999999999999986999999999982899999999999999988742598467888999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             59999999999999999999999983102653101334467799999999876443221125899999999999999999
Q gi|254780703|r   86 GSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLVWTIEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHT  165 (229)
Q Consensus        86 ~~~~i~~dlERIgD~a~~Ia~~~~~~~~~~~~~~~~~~l~~m~~~v~~m~~~a~~af~~~d~~~a~~i~~~e~~id~l~~  165 (229)
                      +++++++++|||||||.+||+.+..... ..+.+....+.+|++.+.+|++.+++||.+.|.+.|.++++.+++||++|+
T Consensus        82 ~~l~i~~dlERIGD~a~nIa~~~~~~~~-~~~~~~~~~i~~m~~~v~~m~~~a~~a~~~~D~~~a~~v~~~~~~id~~~~  160 (235)
T 1sum_B           82 AGIRVAELIENIADKCHDIAKNVLELME-EPPLKPLEDIPAMANQTSEMLKFALRMFADVNVEKSFEVCRMDSKVDDLYE  160 (235)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHTT-SCCCSCCSHHHHHHHHHHHHHHHHHHHHHSCCHHHHTHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999887300-346562899999999999999999999984569999999998578899999


Q ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEECCCCCCCCC
Q ss_conf             9999999853217898899999999998687999999999866665310212231135
Q gi|254780703|r  166 SLFRELLTYMMEDPRNITLCTHLLFCSKNIERIGDHVTNIAETIHYMTTGVQPYKERV  223 (229)
Q Consensus       166 ~l~~~~~~~l~~~~~~~~~~~~~~~i~r~lERigDh~~nIae~iif~~tG~~~~~~~~  223 (229)
                      ++++.++.++.++|+++..++.+++++++||||||||+||||+|+|++||+++++...
T Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~i~~~lERigDh~~NIaE~viy~~tG~~~~~~~~  218 (235)
T 1sum_B          161 KVREELLLYMMESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQGEAYKCYHD  218 (235)
T ss_dssp             HHHHHHHHHHHHCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCEEEETT
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEECCCC
T ss_conf             9999999998869674999999999999999999999999999999992800001770



>1xwm_A PHOU, phosphate uptake regulator; negative phosphate uptake regulator, structural genomics, protein structure initiative, PSI; 2.50A {Geobacillus stearothermophilus} SCOP: a.7.12.1 Back     alignment and structure
>1t72_A Phosphate transport system protein PHOU homolog; helix bundle, structural genomics, BSGC structure funded by NIH, protein structure initiative; 2.90A {Aquifex aeolicus} SCOP: a.7.12.1 PDB: 1t8b_A Back     alignment and structure
>2i0m_A Phosphate transport system protein PHOU; zinc-binding protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pneumoniae TIGR4} Back     alignment and structure
>2olt_A Hypothetical protein; NP_719307.1, DUF47, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.00A {Shewanella oneidensis mr-1} PDB: 2iiu_A* Back     alignment and structure
>3l39_A Putative PHOU-like phosphate regulatory protein; BT4638, structural genomics, joint center for structural genomics, JCSG; 1.93A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1vct_A Hypothetical protein PH0236; helix rich, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.85A {Pyrococcus horikoshii} SCOP: a.7.12.1 d.286.1.1 PDB: 2bkn_A 2bko_A 2bkp_A Back     alignment and structure
>1xwm_A PHOU, phosphate uptake regulator; negative phosphate uptake regulator, structural genomics, protein structure initiative, PSI; 2.50A {Geobacillus stearothermophilus} SCOP: a.7.12.1 Back     alignment and structure
>1t72_A Phosphate transport system protein PHOU homolog; helix bundle, structural genomics, BSGC structure funded by NIH, protein structure initiative; 2.90A {Aquifex aeolicus} SCOP: a.7.12.1 PDB: 1t8b_A Back     alignment and structure
>1sum_B Phosphate transport system protein PHOU homolog 2; ABC transport, PST, structural genomics, berkeley structural genomics center, BSGC; 2.00A {Thermotoga maritima} SCOP: a.7.12.1 Back     alignment and structure
>2i0m_A Phosphate transport system protein PHOU; zinc-binding protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pneumoniae TIGR4} Back     alignment and structure
>1vct_A Hypothetical protein PH0236; helix rich, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.85A {Pyrococcus horikoshii} SCOP: a.7.12.1 d.286.1.1 PDB: 2bkn_A 2bko_A 2bkp_A Back     alignment and structure
>2olt_A Hypothetical protein; NP_719307.1, DUF47, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.00A {Shewanella oneidensis mr-1} PDB: 2iiu_A* Back     alignment and structure
>3l39_A Putative PHOU-like phosphate regulatory protein; BT4638, structural genomics, joint center for structural genomics, JCSG; 1.93A {Bacteroides thetaiotaomicron} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 229 putative phosphate transport system protein [Candidatus
d1t72a_215 a.7.12.1 (A:) Phosphate transport system protein PhoU { 1e-39
d1sumb_225 a.7.12.1 (B:) PhoU homolog TM1734 {Thermotoga maritima 2e-38
d1xwma_212 a.7.12.1 (A:) Phosphate transport system protein PhoU { 2e-38
d1t72a_215 a.7.12.1 (A:) Phosphate transport system protein PhoU { 2e-07
d1xwma_212 a.7.12.1 (A:) Phosphate transport system protein PhoU { 1e-05
d1vcta199 a.7.12.1 (A:9-107) Hypothetical protein PH0236, N-termi 3e-13
d1vcta199 a.7.12.1 (A:9-107) Hypothetical protein PH0236, N-termi 1e-10
>d1t72a_ a.7.12.1 (A:) Phosphate transport system protein PhoU {Aquifex aeolicus [TaxId: 63363]} Length = 215 Back     information, alignment and structure

class: All alpha proteins
fold: Spectrin repeat-like
superfamily: PhoU-like
family: PhoU-like
domain: Phosphate transport system protein PhoU
species: Aquifex aeolicus [TaxId: 63363]
 Score =  156 bits (396), Expect = 1e-39
 Identities = 72/207 (34%), Positives = 118/207 (57%), Gaps = 1/207 (0%)

Query: 9   YDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDKAI 68
             +EL+    ++++M  + ++ +D +  A  + +  LA +VI  D  +D LE DI  + I
Sbjct: 9   LFKELEETKEQVIKMAKLVQEAIDKATEALNKQNVELAEEVIKGDDTIDLLEVDIERRCI 68

Query: 69  ITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLVWTIEPLA 128
             IA  QP A DLR I+G  KI +DLER+GD A+N A+R + L     P K    I  ++
Sbjct: 69  RMIALYQPEAGDLRMIMGIYKIVSDLERMGDEAENIAERAI-LLAEEPPLKPYVNINFMS 127

Query: 129 ELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPRNITLCTHL 188
           E+  E +++ +  +  + T   + +  +D  +D ++  L REL+TY++EDPRNI    HL
Sbjct: 128 EIVKEMVNDSVISFIQQDTLLAKKVIEKDDTVDELYHQLERELMTYVLEDPRNIKRAMHL 187

Query: 189 LFCSKNIERIGDHVTNIAETIHYMTTG 215
            F +++ ERI DH  N+AE   Y++ G
Sbjct: 188 SFVARHYERIADHAENVAEAAIYLSEG 214


>d1sumb_ a.7.12.1 (B:) PhoU homolog TM1734 {Thermotoga maritima [TaxId: 2336]} Length = 225 Back     information, alignment and structure
>d1xwma_ a.7.12.1 (A:) Phosphate transport system protein PhoU {Bacillus stearothermophilus [TaxId: 1422]} Length = 212 Back     information, alignment and structure
>d1t72a_ a.7.12.1 (A:) Phosphate transport system protein PhoU {Aquifex aeolicus [TaxId: 63363]} Length = 215 Back     information, alignment and structure
>d1xwma_ a.7.12.1 (A:) Phosphate transport system protein PhoU {Bacillus stearothermophilus [TaxId: 1422]} Length = 212 Back     information, alignment and structure
>d1vcta1 a.7.12.1 (A:9-107) Hypothetical protein PH0236, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 99 Back     information, alignment and structure
>d1vcta1 a.7.12.1 (A:9-107) Hypothetical protein PH0236, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 99 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target229 putative phosphate transport system protein [Candidatus
d1sumb_225 PhoU homolog TM1734 {Thermotoga maritima [TaxId: 2336]} 100.0
d1xwma_212 Phosphate transport system protein PhoU {Bacillus stear 100.0
d1t72a_215 Phosphate transport system protein PhoU {Aquifex aeolic 100.0
d1vcta199 Hypothetical protein PH0236, N-terminal domain {Pyrococ 99.55
d1sumb_225 PhoU homolog TM1734 {Thermotoga maritima [TaxId: 2336]} 99.1
d1vcta199 Hypothetical protein PH0236, N-terminal domain {Pyrococ 99.5
d1xwma_212 Phosphate transport system protein PhoU {Bacillus stear 99.06
d1t72a_215 Phosphate transport system protein PhoU {Aquifex aeolic 99.05
>d1sumb_ a.7.12.1 (B:) PhoU homolog TM1734 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: All alpha proteins
fold: Spectrin repeat-like
superfamily: PhoU-like
family: PhoU-like
domain: PhoU homolog TM1734
species: Thermotoga maritima [TaxId: 2336]
Probab=100.00  E-value=3.2e-43  Score=324.67  Aligned_cols=214  Identities=29%  Similarity=0.421  Sum_probs=204.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             99999999999999999999999999999999964999999999847999999999999999999713976246555425
Q gi|254780703|r    7 SAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDKAIITIAKRQPMASDLREIVG   86 (229)
Q Consensus         7 ~~f~~~L~~l~~~i~~m~~~v~~~l~~~~~al~~~D~~~a~~v~~~d~~id~~~~~I~~~~~~lLa~~qPva~DLR~i~~   86 (229)
                      +-|+++|+++++++.+||..|.+|+..++.+|.++|+++|++|++.|+.||.++.+|+++|+.++|++||+|+|||.+.+
T Consensus         2 r~~~~~l~~l~~~i~~M~~~v~~~l~~a~~al~~~D~~~a~~V~~~d~~Id~l~~~I~~~~~~~la~~~p~a~dlR~i~~   81 (225)
T d1sumb_           2 RLLNEKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAMEVLGLFSPIGKPLLTVTA   81 (225)
T ss_dssp             CTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCSHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
T ss_conf             62799999999999999999999999999999869999999999717779999999999999877116973257898778


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999831026531013344677999999998764432211258999999999999999999
Q gi|254780703|r   87 SIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLVWTIEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTS  166 (229)
Q Consensus        87 ~~~i~~dlERIgD~a~~Ia~~~~~~~~~~~~~~~~~~l~~m~~~v~~m~~~a~~af~~~d~~~a~~i~~~e~~id~l~~~  166 (229)
                      ++++++++|||||||.+||+.+..... ..+.+....+.+|++.+.+|+..+++||.++|.++|.++++.+++||++|++
T Consensus        82 ~l~i~~dlERIgD~a~~Ia~~~~~~~~-~~~~~~~~~i~~m~~~~~~m~~~a~~a~~~~d~~~a~~v~~~d~~id~l~~~  160 (225)
T d1sumb_          82 GIRVAELIENIADKCHDIAKNVLELME-EPPLKPLEDIPAMANQTSEMLKFALRMFADVNVEKSFEVCRMDSKVDDLYEK  160 (225)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHTT-SCCCSCCSHHHHHHHHHHHHHHHHHHHHHSCCHHHHTHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999988999988620-3565506799999999999999999999875699999999978889999999


Q ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEECCCCCCC
Q ss_conf             9999998532178988999999999986879999999998666653102122311
Q gi|254780703|r  167 LFRELLTYMMEDPRNITLCTHLLFCSKNIERIGDHVTNIAETIHYMTTGVQPYKE  221 (229)
Q Consensus       167 l~~~~~~~l~~~~~~~~~~~~~~~i~r~lERigDh~~nIae~iif~~tG~~~~~~  221 (229)
                      +++.++.++.++++++..++.+++++++||||||||+||||+|+|++||+.+++.
T Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~i~~~lERIgDh~~nIaE~v~y~~~G~~~~~~  215 (225)
T d1sumb_         161 VREELLLYMMESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQGEAYKCY  215 (225)
T ss_dssp             HHHHHHHHHHHCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCEEEE
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEC
T ss_conf             9999999988598739999999999999999999999999999999818310115



>d1xwma_ a.7.12.1 (A:) Phosphate transport system protein PhoU {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1t72a_ a.7.12.1 (A:) Phosphate transport system protein PhoU {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vcta1 a.7.12.1 (A:9-107) Hypothetical protein PH0236, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sumb_ a.7.12.1 (B:) PhoU homolog TM1734 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vcta1 a.7.12.1 (A:9-107) Hypothetical protein PH0236, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xwma_ a.7.12.1 (A:) Phosphate transport system protein PhoU {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1t72a_ a.7.12.1 (A:) Phosphate transport system protein PhoU {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 229 putative phosphate transport system protein [Candi
1t72_A_227 (A:) Phosphate transport system protein PHOU homol 7e-36
1xwm_A_217 (A:) PHOU, phosphate uptake regulator; negative ph 4e-34
2i0m_A_216 (A:) Phosphate transport system protein PHOU; zinc 1e-33
1sum_B_235 (B:) Phosphate transport system protein PHOU homol 5e-33
3l39_A_227 (A:) Putative PHOU-like phosphate regulatory prote 1e-30
2olt_A_227 (A:) Hypothetical protein; NP_719307.1, DUF47, str 5e-29
1t72_A_227 (A:) Phosphate transport system protein PHOU homol 0.001
3l39_A_227 (A:) Putative PHOU-like phosphate regulatory prote 3e-05
1vct_A_1-107107 (A:1-107) Hypothetical protein PH0236; helix rich, 8e-13
1vct_A_1-107107 (A:1-107) Hypothetical protein PH0236; helix rich, 2e-17
>1t72_A (A:) Phosphate transport system protein PHOU homolog; helix bundle, structural genomics, BSGC structure funded by NIH, protein structure initiative; 2.90A {Aquifex aeolicus}Length = 227 Back     alignment and structure
 Score =  144 bits (365), Expect = 7e-36
 Identities = 70/224 (31%), Positives = 118/224 (52%), Gaps = 1/224 (0%)

Query: 4   HILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDI 63
                  +EL+    ++++   + ++ +D +  A  + +  LA +VI  D  +D LE DI
Sbjct: 4   GGGXKLFKELEETKEQVIKXAKLVQEAIDKATEALNKQNVELAEEVIKGDDTIDLLEVDI 63

Query: 64  GDKAIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLVWT 123
             + I  IA  QP A DLR I G  KI +DLER GD A+N A+R + L      +  V  
Sbjct: 64  ERRCIRXIALYQPEAGDLRXIXGIYKIVSDLERXGDEAENIAERAILLAEEPPLKPYVN- 122

Query: 124 IEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPRNIT 183
           I   +E+  E +++ +  +  + T   + +  +D  +D ++  L REL TY++EDPRNI 
Sbjct: 123 INFXSEIVKEXVNDSVISFIQQDTLLAKKVIEKDDTVDELYHQLERELXTYVLEDPRNIK 182

Query: 184 LCTHLLFCSKNIERIGDHVTNIAETIHYMTTGVQPYKERVRKED 227
              HL F +++ ERI DH  N+AE   Y++ G     + ++++ 
Sbjct: 183 RAXHLSFVARHYERIADHAENVAEAAIYLSEGEIVKHQHIKEKG 226


>1xwm_A (A:) PHOU, phosphate uptake regulator; negative phosphate uptake regulator, structural genomics, protein structure initiative, PSI; 2.50A {Geobacillus stearothermophilus}Length = 217 Back     alignment and structure
>2i0m_A (A:) Phosphate transport system protein PHOU; zinc-binding protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pneumoniae TIGR4}Length = 216 Back     alignment and structure
>1sum_B (B:) Phosphate transport system protein PHOU homolog 2; ABC transport, PST, structural genomics, berkeley structural genomics center, BSGC; 2.00A {Thermotoga maritima}Length = 235 Back     alignment and structure
>3l39_A (A:) Putative PHOU-like phosphate regulatory protein; BT4638, structural genomics, joint center for structural genomics, JCSG; 1.93A {Bacteroides thetaiotaomicron}Length = 227 Back     alignment and structure
>2olt_A (A:) Hypothetical protein; NP_719307.1, DUF47, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.00A {Shewanella oneidensis mr-1} PDB: 2iiu_A*Length = 227 Back     alignment and structure
>1t72_A (A:) Phosphate transport system protein PHOU homolog; helix bundle, structural genomics, BSGC structure funded by NIH, protein structure initiative; 2.90A {Aquifex aeolicus}Length = 227 Back     alignment and structure
>3l39_A (A:) Putative PHOU-like phosphate regulatory protein; BT4638, structural genomics, joint center for structural genomics, JCSG; 1.93A {Bacteroides thetaiotaomicron}Length = 227 Back     alignment and structure
>1vct_A (A:1-107) Hypothetical protein PH0236; helix rich, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.85A {Pyrococcus horikoshii}Length = 107 Back     alignment and structure
>1vct_A (A:1-107) Hypothetical protein PH0236; helix rich, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.85A {Pyrococcus horikoshii}Length = 107 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target229 putative phosphate transport system protein [Candidatus
1t72_A_227 Phosphate transport system protein PHOU homolog; h 100.0
1sum_B_235 Phosphate transport system protein PHOU homolog 2; 100.0
1xwm_A_217 PHOU, phosphate uptake regulator; negative phospha 100.0
2i0m_A_216 Phosphate transport system protein PHOU; zinc-bind 100.0
2olt_A_227 Hypothetical protein; NP_719307.1, DUF47, structur 99.96
3l39_A_227 Putative PHOU-like phosphate regulatory protein; B 99.95
1vct_A_1-107107 Hypothetical protein PH0236; helix rich, structura 99.62
1vct_A_1-107107 Hypothetical protein PH0236; helix rich, structura 99.49
1xwm_A_217 PHOU, phosphate uptake regulator; negative phospha 98.97
2i0m_A_216 Phosphate transport system protein PHOU; zinc-bind 98.91
1t72_A_227 Phosphate transport system protein PHOU homolog; h 98.85
2olt_A_227 Hypothetical protein; NP_719307.1, DUF47, structur 98.59
3l39_A_227 Putative PHOU-like phosphate regulatory protein; B 98.51
1sum_B_235 Phosphate transport system protein PHOU homolog 2; 99.15
>1t72_A (A:) Phosphate transport system protein PHOU homolog; helix bundle, structural genomics, BSGC structure funded by NIH, protein structure initiative; 2.90A {Aquifex aeolicus} Back     alignment and structure
Probab=100.00  E-value=3.1e-37  Score=284.74  Aligned_cols=226  Identities=31%  Similarity=0.437  Sum_probs=217.6

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             11378999999999999999999999999999999999649999999998479999999999999999997139762465
Q gi|254780703|r    2 SCHILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDKAIITIAKRQPMASDL   81 (229)
Q Consensus         2 ~~h~~~~f~~~L~~l~~~i~~m~~~v~~~l~~~~~al~~~D~~~a~~v~~~d~~id~~~~~I~~~~~~lLa~~qPva~DL   81 (229)
                      +.||.+.|+++|.+++.++.+|+..+..|+..+..++.++|++.++.+.++|+.+|+++.+|.++|+++|+.++|++.|+
T Consensus         2 ~~~m~~~~~~~l~~l~~~l~~m~~~~~~ml~~~~~~l~~~d~~~~~~i~~~d~~id~~~~~i~~~~~~~ls~~~~~~~~~   81 (227)
T 1t72_A            2 GGGGGXKLFKELEETKEQVIKXAKLVQEAIDKATEALNKQNVELAEEVIKGDDTIDLLEVDIERRCIRXIALYQPEAGDL   81 (227)
T ss_dssp             CCTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHCCCHHHH
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHH
T ss_conf             84300049999999999999999999999999999998799999999997588888899999999998655048656788


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             55425999999999999999999999998310265310133446779999999987644322112589999999999999
Q gi|254780703|r   82 REIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLVWTIEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELD  161 (229)
Q Consensus        82 R~i~~~~~i~~dlERIgD~a~~Ia~~~~~~~~~~~~~~~~~~l~~m~~~v~~m~~~a~~af~~~d~~~a~~i~~~e~~id  161 (229)
                      |.+.+++++++++|||||||.+||+.+.... .+++.+....+.+|++.+.+++..++++|.++|.+.|.++.+.+++|+
T Consensus        82 ~~i~~~~~i~~~lErIgD~~~~ia~~~~~~~-~~~~~~~~~~l~~~~~~v~~~~~~~~~a~~~~d~~~a~~i~~~~~~i~  160 (227)
T 1t72_A           82 RXIXGIYKIVSDLERXGDEAENIAERAILLA-EEPPLKPYVNINFXSEIVKEXVNDSVISFIQQDTLLAKKVIEKDDTVD  160 (227)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-TSCCSSCCHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             8999999899999999999999999999842-368862021389999999999999999883147999999999857899


Q ss_pred             HHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEECCCCCCCCCCCHHC
Q ss_conf             9999999999985321789889999999999868799999999986666531021223113560314
Q gi|254780703|r  162 AMHTSLFRELLTYMMEDPRNITLCTHLLFCSKNIERIGDHVTNIAETIHYMTTGVQPYKERVRKEDC  228 (229)
Q Consensus       162 ~l~~~l~~~~~~~l~~~~~~~~~~~~~~~i~r~lERigDh~~nIae~iif~~tG~~~~~~~~~~~~~  228 (229)
                      ++++++++.++.++.++++++..++.+++++++|||||||++|||+.++|+.+|+.|.+++++..|+
T Consensus       161 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~~i~~~leRi~d~~~nIae~~~~l~~g~~~~~~~~~~~~e  227 (227)
T 1t72_A          161 ELYHQLERELXTYVLEDPRNIKRAXHLSFVARHYERIADHAENVAEAAIYLSEGEIVKHQHIKEKGE  227 (227)
T ss_dssp             HHHHHHHHHHHHHHHHCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC------------
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             9999999999999984988599999999999999999999999999999999083046898554679



>1sum_B (B:) Phosphate transport system protein PHOU homolog 2; ABC transport, PST, structural genomics, berkeley structural genomics center, BSGC; 2.00A {Thermotoga maritima} Back     alignment and structure
>1xwm_A (A:) PHOU, phosphate uptake regulator; negative phosphate uptake regulator, structural genomics, protein structure initiative, PSI; 2.50A {Geobacillus stearothermophilus} Back     alignment and structure
>2i0m_A (A:) Phosphate transport system protein PHOU; zinc-binding protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pneumoniae TIGR4} Back     alignment and structure
>2olt_A (A:) Hypothetical protein; NP_719307.1, DUF47, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.00A {Shewanella oneidensis mr-1} PDB: 2iiu_A* Back     alignment and structure
>3l39_A (A:) Putative PHOU-like phosphate regulatory protein; BT4638, structural genomics, joint center for structural genomics, JCSG; 1.93A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1vct_A (A:1-107) Hypothetical protein PH0236; helix rich, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>1vct_A (A:1-107) Hypothetical protein PH0236; helix rich, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>1xwm_A (A:) PHOU, phosphate uptake regulator; negative phosphate uptake regulator, structural genomics, protein structure initiative, PSI; 2.50A {Geobacillus stearothermophilus} Back     alignment and structure
>2i0m_A (A:) Phosphate transport system protein PHOU; zinc-binding protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pneumoniae TIGR4} Back     alignment and structure
>1t72_A (A:) Phosphate transport system protein PHOU homolog; helix bundle, structural genomics, BSGC structure funded by NIH, protein structure initiative; 2.90A {Aquifex aeolicus} Back     alignment and structure
>2olt_A (A:) Hypothetical protein; NP_719307.1, DUF47, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.00A {Shewanella oneidensis mr-1} PDB: 2iiu_A* Back     alignment and structure
>3l39_A (A:) Putative PHOU-like phosphate regulatory protein; BT4638, structural genomics, joint center for structural genomics, JCSG; 1.93A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1sum_B (B:) Phosphate transport system protein PHOU homolog 2; ABC transport, PST, structural genomics, berkeley structural genomics center, BSGC; 2.00A {Thermotoga maritima} Back     alignment and structure