254780705

254780705

phosphate ABC transporter, permease protein PstA

GeneID in NCBI database:8209709Locus tag:CLIBASIA_02960
Protein GI in NCBI database:254780705Protein Accession:YP_003065118.1
Gene range:+(561345, 562622)Protein Length:425aa
Gene description:phosphate ABC transporter, permease protein PstA
COG prediction:[P] ABC-type phosphate transport system, permease component
KEGG prediction:pstA; phosphate ABC transporter, permease protein PstA; K02038 phosphate transport system permease protein
SEED prediction:Phosphate transport system permease protein PstA (TC 3.A.1.7.1)
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:High affinity phosphate transporter and control of PHO regulon;
Phosphate metabolism
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM7 TM-Helix
TOPPRED7 TM-Helix
HMMTOP8 TM-Helix
MEMSAT6 TM-Helix
MEMSAT_SVM5 TM-Helix
PHOBIUS7 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-----
MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEcHHHccccccccccHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcccEEEEEEEEcHHHHHHHHHccccccccccccHHHHHHHHHHHHcccEEEEEEHHHHcccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEccHHHccccccccccHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHcHHHHHHHHHHHHcccHHccccEEEEEEccccHHHHcccccccHHHHHcccHHHHHHHHHHHHcccEEEEEccHHcccccccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
mksfsinkknlKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQThislpiefsetivdpqkkrfmdpailLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKtlmtdpsligktVEVSLLASANIDSalkgylyspanvhrmsDYQWKWFQKldsdgalfldfnygffingassrpevaGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEefshkgffSSFVQANINNLASVPSIVYGILGSAVLInffkmprstaLVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHvlplampailTGSTVSLARALGETAPLLFVGMVAFvtdypvgvtdiaTAFPVQIYLWaadaerpfveRTFGAILLLLIFLAVINTAMLWLRNRFKKRW
MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLrnrfkkrw
MKSFSINKKNLKYRYISEWLFRFYCvvavlvvfvflilllssivsKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTfgailllliflaVINTAMLWLRNRFKKRW
**************YISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVD***********LLRADYNLLVRKAL********************L**TARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASS**E*AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK**
MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW
*KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxx
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW
MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW
MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target425 phosphate ABC transporter, permease protein PstA [Candi
255764486493 ABC transporter, membrane spanning protein [Candid 4e-13
254780341281 proline/glycine betaine ABC transporter, permease 0.006
>gi|255764486|ref|YP_003065119.2| ABC transporter, membrane spanning protein [Candidatus Liberibacter asiaticus str. psy62] Length = 493 Back     alignment
 Score = 67.4 bits (163), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 82/162 (50%), Gaps = 18/162 (11%)

Query: 207 VVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSA 266
           ++G+ Y+  I +  S P+G+  AIY+ E++ K    + ++     L  +P+IVYG    +
Sbjct: 257 LIGTFYIGFIAMLFSVPIGLLIAIYMAEYAPKKL-RAVIKPITEMLVGIPTIVYGFFALS 315

Query: 267 VLINFFK-----------------MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSI 309
           ++  F +                 +   + L  GL++ +M +P +   +   + ++P S+
Sbjct: 316 LVGPFLRDISIYMNGLITGNYKSFIEAQSVLTAGLVMGIMLIPYVSSLSEDVISSIPRSL 375

Query: 310 RSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET 351
           R  +LGLGA++ +T+ + + P A P I     ++ +R +GET
Sbjct: 376 RDGSLGLGATRSETMKYVIFPAAFPGIAGAILMTASRTIGET 417

>gi|254780341|ref|YP_003064754.1| proline/glycine betaine ABC transporter, permease protein [Candidatus Liberibacter asiaticus str. psy62] Length = 281 Back     alignment
 Score = 33.5 bits (75), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 64/127 (50%), Gaps = 16/127 (12%)

Query: 223 PLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVG 282
           PLG+ +A Y         F S ++  ++++ ++P+ VY ++ + VL     +P   A + 
Sbjct: 113 PLGVLAAWYPR-------FYSIIRLFLDSMQTIPTFVY-LIPALVLFGLGMVPGIVATI- 163

Query: 283 GLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHV-LPLAMPAILTGST 341
                + ++P+ +  T + + + P  ++ AA   GA+  Q VF  V LP A+P I+   T
Sbjct: 164 -----VFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQ-VFRKVELPFAIPQIVASLT 217

Query: 342 VSLARAL 348
            ++  +L
Sbjct: 218 QTIMLSL 224

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target425 phosphate ABC transporter, permease protein PstA [Candi
315121870427 phosphate ABC transporter, permease protein PstA [Candi 1 0.0
222084781444 phosphate ABC transporter, permease protein PstA [Agrob 1 1e-132
306843559436 phosphate ABC transporter, permease protein PstA [Bruce 1 1e-132
153008105438 phosphate ABC transporter inner membrane subunit PstA [ 1 1e-131
190890214440 phosphate ABC transporter permease [Rhizobium etli CIAT 1 1e-131
327192730440 phosphate ABC transporter, permease protein [Rhizobium 1 1e-131
23502988436 phosphate ABC transporter permease [Brucella suis 1330] 1 1e-131
161620050436 phosphate ABC transporter, permease protein PstA [Bruce 1 1e-131
254713458436 phosphate ABC transporter, permease protein PstA [Bruce 1 1e-131
254700771436 phosphate ABC transporter, permease protein PstA [Bruce 1 1e-131
>gi|315121870|ref|YP_004062359.1| phosphate ABC transporter, permease protein PstA [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 427 Back     alignment and organism information
 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/427 (79%), Positives = 385/427 (90%), Gaps = 2/427 (0%)

Query: 1   MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60
           MKSFS+NKK LK RYISE+LFRF CV+AVL+V  FLI+ L SIVSKGIG LWQTHISLPI
Sbjct: 1   MKSFSVNKKKLKSRYISEFLFRFSCVIAVLIVLAFLIIFLYSIVSKGIGTLWQTHISLPI 60

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
           EFSETI+DP K RF DP+IL +A+YNLLV+ ALARKL ISDS H++L Q S+M+S+T RY
Sbjct: 61  EFSETIIDPNKNRFKDPSILQKANYNLLVQMALARKLGISDSEHSMLAQVSEMISSTVRY 120

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYL-YS-PANVHRMSDYQWKWFQKLDSD 178
            LR TL+ DPSLIGKTVE+ LLASANIDSALKGY+ +S PA V ++SD Q KWF++L +D
Sbjct: 121 RLRNTLLADPSLIGKTVEMPLLASANIDSALKGYIDFSLPATVRKISDDQLKWFRQLVAD 180

Query: 179 GALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           G++   FNYGFF+NGASSRPE AGIGVA+VGSLYM+LIVI LSFP+GIASAIYLEEF+ K
Sbjct: 181 GSISFHFNYGFFVNGASSRPESAGIGVAIVGSLYMILIVIALSFPVGIASAIYLEEFAPK 240

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
            FFSSF+QANINNLASVPS+VYGILGSA+L+NFF+MPRST+LVGGLILA+MTLPSIIIA 
Sbjct: 241 NFFSSFIQANINNLASVPSVVYGILGSAMLVNFFQMPRSTSLVGGLILAIMTLPSIIIAA 300

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
           GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLA+PAILTGSTVSLARALGETAPLLFVG
Sbjct: 301 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAVPAILTGSTVSLARALGETAPLLFVG 360

Query: 359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
           MVAFVTDYP G+TDIATAFPVQ+YLW +DAER FVE+TFG+ILLLL+FLAVINT MLWLR
Sbjct: 361 MVAFVTDYPEGITDIATAFPVQVYLWTSDAERLFVEKTFGSILLLLVFLAVINTVMLWLR 420

Query: 419 NRFKKRW 425
           NRF+K W
Sbjct: 421 NRFRKHW 427


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084781|ref|YP_002543310.1| phosphate ABC transporter, permease protein PstA [Agrobacterium radiobacter K84] Length = 444 Back     alignment and organism information
>gi|306843559|ref|ZP_07476160.1| phosphate ABC transporter, permease protein PstA [Brucella sp. BO1] Length = 436 Back     alignment and organism information
>gi|153008105|ref|YP_001369320.1| phosphate ABC transporter inner membrane subunit PstA [Ochrobactrum anthropi ATCC 49188] Length = 438 Back     alignment and organism information
>gi|190890214|ref|YP_001976756.1| phosphate ABC transporter permease [Rhizobium etli CIAT 652] Length = 440 Back     alignment and organism information
>gi|327192730|gb|EGE59666.1| phosphate ABC transporter, permease protein [Rhizobium etli CNPAF512] Length = 440 Back     alignment and organism information
>gi|23502988|ref|NP_699115.1| phosphate ABC transporter permease [Brucella suis 1330] Length = 436 Back     alignment and organism information
>gi|161620050|ref|YP_001593937.1| phosphate ABC transporter, permease protein PstA [Brucella canis ATCC 23365] Length = 436 Back     alignment and organism information
>gi|254713458|ref|ZP_05175269.1| phosphate ABC transporter, permease protein PstA [Brucella ceti M644/93/1] Length = 436 Back     alignment and organism information
>gi|254700771|ref|ZP_05162599.1| phosphate ABC transporter, permease protein PstA [Brucella suis bv. 5 str. 513] Length = 436 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target425 phosphate ABC transporter, permease protein PstA [Candi
TIGR00974271 TIGR00974, 3a0107s02c, phosphate ABC transporter, perme 2e-48
COG0573310 COG0573, PstC, ABC-type phosphate transport system, per 5e-27
TIGR02138295 TIGR02138, phosphate_pstC, phosphate ABC transporter, p 1e-24
COG4149225 COG4149, ModC, ABC-type molybdate transport system, per 7e-10
COG1177267 COG1177, PotC, ABC-type spermidine/putrescine transport 8e-10
COG0555274 COG0555, CysU, ABC-type sulfate transport system, perme 4e-09
COG2011222 COG2011, AbcD, ABC-type metal ion transport system, per 1e-06
COG1178 540 COG1178, ThiP, ABC-type Fe3+ transport system, permease 2e-05
COG0581292 COG0581, PstA, ABC-type phosphate transport system, per 2e-58
pfam11812155 pfam11812, DUF3333, Domain of unknown function (DUF3333 4e-35
PRK11268295 PRK11268, pstA, phosphate transporter permease subunit 8e-19
cd06261190 cd06261, TM_PBP2, Transmembrane subunit (TM) found in P 2e-14
PRK11275319 PRK11275, pstC, phosphate transporter permease subunit 6e-08
COG1174221 COG1174, OpuBB, ABC-type proline/glycine betaine transp 9e-08
COG4176290 COG4176, ProW, ABC-type proline/glycine betaine transpo 3e-06
PRK10952355 PRK10952, PRK10952, glycine betaine transporter membran 6e-05
TIGR03255272 TIGR03255, PhnV, 2-aminoethylphosphonate ABC transport 2e-04
TIGR03416267 TIGR03416, ABC_choXWV_perm, choline ABC transporter, pe 6e-04
COG1178540 COG1178, ThiP, ABC-type Fe3+ transport system, permease 0.001
COG1173289 COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel t 0.001
COG4590733 COG4590, COG4590, ABC-type uncharacterized transport sy 3e-10
TIGR02141208 TIGR02141, modB_ABC, molybdate ABC transporter, permeas 9e-08
TIGR01581225 TIGR01581, Mo_ABC_porter, NifC-like ABC-type porter 4e-06
pfam00528183 pfam00528, BPD_transp_1, Binding-protein-dependent tran 5e-09
TIGR02139265 TIGR02139, permease_CysT, sulfate ABC transporter, perm 9e-06
PRK09421229 PRK09421, modB, molybdate ABC transporter permease prot 3e-05
COG0600258 COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate t 1e-04
CHL00187237 CHL00187, cysT, sulfate transport protein; Provisional 3e-04
COG1176287 COG1176, PotB, ABC-type spermidine/putrescine transport 3e-04
TIGR03226312 TIGR03226, PhnU, 2-aminoethylphosphonate ABC transporte 0.001
PRK10971277 PRK10971, PRK10971, sulfate/thiosulfate transporter sub 0.001
PRK15050296 PRK15050, PRK15050, 2-aminoethylphosphonate transport s 0.001
PRK09497285 PRK09497, potB, spermidine/putrescine ABC transporter m 0.002
>gnl|CDD|162141 TIGR00974, 3a0107s02c, phosphate ABC transporter, permease protein PstA Back     alignment and domain information
>gnl|CDD|30918 COG0573, PstC, ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|162724 TIGR02138, phosphate_pstC, phosphate ABC transporter, permease protein PstC Back     alignment and domain information
>gnl|CDD|33901 COG4149, ModC, ABC-type molybdate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31370 COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30901 COG0555, CysU, ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|32194 COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31371 COG1178, ThiP, ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|30926 COG0581, PstA, ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|152248 pfam11812, DUF3333, Domain of unknown function (DUF3333) Back     alignment and domain information
>gnl|CDD|183065 PRK11268, pstA, phosphate transporter permease subunit PtsA; Provisional Back     alignment and domain information
>gnl|CDD|119394 cd06261, TM_PBP2, Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs Back     alignment and domain information
>gnl|CDD|183070 PRK11275, pstC, phosphate transporter permease subunit PstC; Provisional Back     alignment and domain information
>gnl|CDD|31367 COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|33916 COG4176, ProW, ABC-type proline/glycine betaine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182861 PRK10952, PRK10952, glycine betaine transporter membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|132299 TIGR03255, PhnV, 2-aminoethylphosphonate ABC transport system, membrane component PhnV Back     alignment and domain information
>gnl|CDD|132457 TIGR03416, ABC_choXWV_perm, choline ABC transporter, permease protein Back     alignment and domain information
>gnl|CDD|31371 COG1178, ThiP, ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31366 COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|34228 COG4590, COG4590, ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>gnl|CDD|162726 TIGR02141, modB_ABC, molybdate ABC transporter, permease protein Back     alignment and domain information
>gnl|CDD|130643 TIGR01581, Mo_ABC_porter, NifC-like ABC-type porter Back     alignment and domain information
>gnl|CDD|144205 pfam00528, BPD_transp_1, Binding-protein-dependent transport system inner membrane component Back     alignment and domain information
>gnl|CDD|131194 TIGR02139, permease_CysT, sulfate ABC transporter, permease protein CysT Back     alignment and domain information
>gnl|CDD|181841 PRK09421, modB, molybdate ABC transporter permease protein; Reviewed Back     alignment and domain information
>gnl|CDD|30945 COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|164564 CHL00187, cysT, sulfate transport protein; Provisional Back     alignment and domain information
>gnl|CDD|31369 COG1176, PotB, ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|132270 TIGR03226, PhnU, 2-aminoethylphosphonate ABC transporter, permease protein Back     alignment and domain information
>gnl|CDD|182873 PRK10971, PRK10971, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|185010 PRK15050, PRK15050, 2-aminoethylphosphonate transport system permease PhnU; Provisional Back     alignment and domain information
>gnl|CDD|181910 PRK09497, potB, spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 425 phosphate ABC transporter, permease protein PstA [Candi
COG0581292 PstA ABC-type phosphate transport system, permease comp 100.0
TIGR00974302 3a0107s02c phosphate ABC transporter, permease protein 100.0
PRK11275319 pstC phosphate transporter permease subunit; Provisiona 100.0
PRK10971277 sulfate/thiosulfate transporter subunit; Provisional 99.97
PRK09494219 glnP glutamine ABC transporter permease protein; Review 99.74
PRK10352314 nickel transporter permease NikB; Provisional 99.42
PRK10914339 dipeptide transporter permease DppB; Provisional 99.42
COG0601317 DppB ABC-type dipeptide/oligopeptide/nickel transport s 99.34
PRK11268292 pstA phosphate transporter permease subunit; Provisiona 100.0
TIGR02138317 phosphate_pstC phosphate ABC transporter, permease prot 100.0
COG0573310 PstC ABC-type phosphate transport system, permease comp 100.0
pfam11812155 DUF3333 Domain of unknown function (DUF3333). This fami 100.0
PRK09421229 modB molybdate ABC transporter permease protein; Review 99.97
TIGR02141212 modB_ABC molybdate ABC transporter, permease protein; I 99.97
COG4590733 ABC-type uncharacterized transport system, permease com 99.97
COG4149225 ModC ABC-type molybdate transport system, permease comp 99.97
TIGR01581226 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR0 99.96
COG0555274 CysU ABC-type sulfate transport system, permease compon 99.96
TIGR02139265 permease_CysT sulfate ABC transporter, permease protein 99.96
PRK10592281 putrescine transporter subunit: membrane component of A 99.96
PRK11602291 cysW sulfate/thiosulfate transporter permease subunit; 99.96
TIGR03255272 PhnV 2-aminoethylphosphonate ABC transport system, memb 99.96
COG1177267 PotC ABC-type spermidine/putrescine transport system, p 99.95
TIGR00969280 3a0106s02 sulfate ABC transporter, permease protein; In 99.95
PRK09500257 potC spermidine/putrescine ABC transporter membrane pro 99.95
PRK10782217 DL-methionine transporter permease subunit; Provisional 99.94
TIGR03226312 PhnU 2-aminoethylphosphonate ABC transporter, permease 99.93
TIGR03262546 PhnU2 putative 2-aminoethylphosphonate ABC transport sy 99.93
PRK09433536 thiP thiamine transporter membrane protein; Reviewed 99.91
PRK09497285 potB spermidine/putrescine ABC transporter membrane pro 99.91
TIGR02140275 permease_CysW sulfate ABC transporter, permease protein 99.9
TIGR03262 546 PhnU2 putative 2-aminoethylphosphonate ABC transport sy 99.9
COG1178540 ThiP ABC-type Fe3+ transport system, permease component 99.9
COG1178 540 ThiP ABC-type Fe3+ transport system, permease component 99.89
PRK10683317 putrescine transporter subunit: membrane component of A 99.88
PRK09433 536 thiP thiamine transporter membrane protein; Reviewed 99.85
COG4662227 TupA ABC-type tungstate transport system, periplasmic c 99.83
PRK10952354 glycine betaine transporter membrane protein; Provision 99.82
COG4208287 CysW ABC-type sulfate transport system, permease compon 99.82
COG2011222 AbcD ABC-type metal ion transport system, permease comp 99.81
COG1176287 PotB ABC-type spermidine/putrescine transport system, p 99.81
PRK10998296 malG maltose transporter permease; Provisional 99.79
PRK10160275 taurine transporter subunit; Provisional 99.77
PRK11365263 ssuC alkanesulfonate transporter permease subunit; Prov 99.77
pfam00528183 BPD_transp_1 Binding-protein-dependent transport system 99.76
COG1175295 UgpA ABC-type sugar transport systems, permease compone 99.74
PRK10561280 glycerol-3-phosphate transporter permease; Provisional 99.73
COG0395281 UgpE ABC-type sugar transport system, permease componen 99.72
COG0765222 HisM ABC-type amino acid transport system, permease com 99.72
PRK11123238 arginine transporter permease subunit ArtQ; Provisional 99.71
PRK10973281 glycerol-3-phosphate transporter membrane protein; Prov 99.7
COG0600258 TauC ABC-type nitrate/sulfonate/bicarbonate transport s 99.68
COG4132282 ABC-type uncharacterized transport system, permease com 99.65
COG3639283 ABC-type phosphate/phosphonate transport system, permea 99.62
PRK10999520 malF maltose transporter membrane protein; Provisional 99.61
COG1173289 DppC ABC-type dipeptide/oligopeptide/nickel transport s 99.53
PRK09881296 ATP-dependent peptide transporter membrane subunit; Pro 99.51
PRK10417272 nikC nickel transporter permease NikC; Provisional 99.47
PRK10913300 dipeptide transporter; Provisional 99.47
COG3833282 MalG ABC-type maltose transport systems, permease compo 99.42
COG4215230 ArtQ ABC-type arginine transport system, permease compo 99.39
PRK09471306 oppB oligopeptide transporter permease; Reviewed 99.35
COG4209309 LplB ABC-type polysaccharide transport system, permease 99.23
TIGR03004216 ectoine_ehuC ectoine/hydroxyectoine ABC transporter, pe 98.91
TIGR01097192 3A0109s02M phosphonate ABC transporter, permease protei 98.81
TIGR02790258 nickel_nikC nickel ABC transporter, permease subunit Ni 98.75
COG4986523 ABC-type anion transport system, duplicated permease co 98.61
COG4239341 ABC-type uncharacterized transport system, permease com 98.58
TIGR01253 519 thiP thiamine/thiamine pyrophosphate ABC transporter, p 98.44
COG4135 551 ABC-type uncharacterized transport system, permease com 97.97
CHL00187235 cysT sulfate transport protein; Provisional 99.92
cd06261190 TM_PBP2 Transmembrane subunit (TM) found in Periplasmic 99.88
COG1174221 OpuBB ABC-type proline/glycine betaine transport system 99.76
COG4135551 ABC-type uncharacterized transport system, permease com 98.46
COG4171296 SapC ABC-type antimicrobial peptide transport system, p 98.26
TIGR03416267 ABC_choXWV_perm choline ABC transporter, permease prote 99.83
COG4176290 ProW ABC-type proline/glycine betaine transport system, 99.71
PRK11122222 artM arginine transporter permease subunit ArtM; Provis 99.62
COG4160228 ArtM ABC-type arginine/histidine transport system, perm 98.88
TIGR03003218 ectoine_ehuD ectoine/hydroxyectoine ABC transporter, pe 98.61
COG4986 523 ABC-type anion transport system, duplicated permease co 98.51
COG4597397 BatB ABC-type amino acid transport system, permease com 97.9
TIGR01183203 ntrB nitrate ABC transporter, permease protein; InterPr 97.85
TIGR02789315 nickel_nikB nickel ABC transporter, permease subunit Ni 97.82
COG4174364 ABC-type uncharacterized transport system, permease com 94.86
TIGR01253519 thiP thiamine/thiamine pyrophosphate ABC transporter, p 98.81
TIGR0172699 HEQRo_perm_3TM amino acid ABC transporter, permease pro 96.73
COG4168321 SapB ABC-type antimicrobial peptide transport system, p 94.62
COG0390256 ABC-type uncharacterized transport system, permease com 94.46
pfam03649250 UPF0014 Uncharacterized protein family (UPF0014). 92.66
TIGR01478315 STEVOR variant surface antigen, stevor family; InterPro 91.23
>COG0581 PstA ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00974 3a0107s02c phosphate ABC transporter, permease protein PstA; InterPro: IPR005672 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>PRK11275 pstC phosphate transporter permease subunit; Provisional Back     alignment and domain information
>PRK10971 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK09494 glnP glutamine ABC transporter permease protein; Reviewed Back     alignment and domain information
>PRK10352 nickel transporter permease NikB; Provisional Back     alignment and domain information
>PRK10914 dipeptide transporter permease DppB; Provisional Back     alignment and domain information
>COG0601 DppB ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11268 pstA phosphate transporter permease subunit; Provisional Back     alignment and domain information
>TIGR02138 phosphate_pstC phosphate ABC transporter, permease protein PstC; InterPro: IPR011864 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG0573 PstC ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam11812 DUF3333 Domain of unknown function (DUF3333) Back     alignment and domain information
>PRK09421 modB molybdate ABC transporter permease protein; Reviewed Back     alignment and domain information
>TIGR02141 modB_ABC molybdate ABC transporter, permease protein; InterPro: IPR011867 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG4149 ModC ABC-type molybdate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01581 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR006469 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG0555 CysU ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02139 permease_CysT sulfate ABC transporter, permease protein CysT; InterPro: IPR011865 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK10592 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>PRK11602 cysW sulfate/thiosulfate transporter permease subunit; Provisional Back     alignment and domain information
>TIGR03255 PhnV 2-aminoethylphosphonate ABC transport system, membrane component PhnV Back     alignment and domain information
>COG1177 PotC ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00969 3a0106s02 sulfate ABC transporter, permease protein; InterPro: IPR005667 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>PRK09500 potC spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information
>PRK10782 DL-methionine transporter permease subunit; Provisional Back     alignment and domain information
>TIGR03226 PhnU 2-aminoethylphosphonate ABC transporter, permease protein Back     alignment and domain information
>TIGR03262 PhnU2 putative 2-aminoethylphosphonate ABC transport system, permease protein Back     alignment and domain information
>PRK09433 thiP thiamine transporter membrane protein; Reviewed Back     alignment and domain information
>PRK09497 potB spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information
>TIGR02140 permease_CysW sulfate ABC transporter, permease protein CysW; InterPro: IPR011866 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR03262 PhnU2 putative 2-aminoethylphosphonate ABC transport system, permease protein Back     alignment and domain information
>COG1178 ThiP ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1178 ThiP ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10683 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>PRK09433 thiP thiamine transporter membrane protein; Reviewed Back     alignment and domain information
>COG4662 TupA ABC-type tungstate transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>PRK10952 glycine betaine transporter membrane protein; Provisional Back     alignment and domain information
>COG4208 CysW ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2011 AbcD ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1176 PotB ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10998 malG maltose transporter permease; Provisional Back     alignment and domain information
>PRK10160 taurine transporter subunit; Provisional Back     alignment and domain information
>PRK11365 ssuC alkanesulfonate transporter permease subunit; Provisional Back     alignment and domain information
>pfam00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component Back     alignment and domain information
>COG1175 UgpA ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10561 glycerol-3-phosphate transporter permease; Provisional Back     alignment and domain information
>COG0395 UgpE ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0765 HisM ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11123 arginine transporter permease subunit ArtQ; Provisional Back     alignment and domain information
>PRK10973 glycerol-3-phosphate transporter membrane protein; Provisional Back     alignment and domain information
>COG0600 TauC ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4132 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG3639 ABC-type phosphate/phosphonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10999 malF maltose transporter membrane protein; Provisional Back     alignment and domain information
>COG1173 DppC ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09881 ATP-dependent peptide transporter membrane subunit; Provisional Back     alignment and domain information
>PRK10417 nikC nickel transporter permease NikC; Provisional Back     alignment and domain information
>PRK10913 dipeptide transporter; Provisional Back     alignment and domain information
>COG3833 MalG ABC-type maltose transport systems, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4215 ArtQ ABC-type arginine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09471 oppB oligopeptide transporter permease; Reviewed Back     alignment and domain information
>COG4209 LplB ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03004 ectoine_ehuC ectoine/hydroxyectoine ABC transporter, permease protein EhuC; InterPro: IPR014342 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR01097 3A0109s02M phosphonate ABC transporter, permease protein; InterPro: IPR005769 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>TIGR02790 nickel_nikC nickel ABC transporter, permease subunit NikC; InterPro: IPR014157 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4986 ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4239 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>TIGR01253 thiP thiamine/thiamine pyrophosphate ABC transporter, permease protein; InterPro: IPR005947 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4135 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>CHL00187 cysT sulfate transport protein; Provisional Back     alignment and domain information
>cd06261 TM_PBP2 Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs Back     alignment and domain information
>COG1174 OpuBB ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4135 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG4171 SapC ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms] Back     alignment and domain information
>TIGR03416 ABC_choXWV_perm choline ABC transporter, permease protein Back     alignment and domain information
>COG4176 ProW ABC-type proline/glycine betaine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11122 artM arginine transporter permease subunit ArtM; Provisional Back     alignment and domain information
>COG4160 ArtM ABC-type arginine/histidine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03003 ectoine_ehuD ectoine/hydroxyectoine ABC transporter, permease protein EhuD; InterPro: IPR014341 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4986 ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4597 BatB ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01183 ntrB nitrate ABC transporter, permease protein; InterPro: IPR005889 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR02789 nickel_nikB nickel ABC transporter, permease subunit NikB; InterPro: IPR014156 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4174 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>TIGR01253 thiP thiamine/thiamine pyrophosphate ABC transporter, permease protein; InterPro: IPR005947 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR01726 HEQRo_perm_3TM amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family; InterPro: IPR010065 This entry represents one of several classes of multiple membrane spanning regions found in the inner membrane component of binding-protein-dependent transport systems Back     alignment and domain information
>COG4168 SapB ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms] Back     alignment and domain information
>COG0390 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>pfam03649 UPF0014 Uncharacterized protein family (UPF0014) Back     alignment and domain information
>TIGR01478 STEVOR variant surface antigen, stevor family; InterPro: IPR006374 Malaria is still a major cause of mortality in many areas of the world Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target425 phosphate ABC transporter, permease protein PstA [Candi
3d31_C295 Sulfate/molybdate ABC transporter, permease protein; AT 2e-11
3dhw_A217 D-methionine transport system permease protein METI; AB 1e-07
2r6g_F514 Maltose transport system permease protein MALF; ABC tra 2e-06
>3d31_C Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: f.58.1.1 Length = 295 Back     alignment and structure
 Score = 66.2 bits (161), Expect = 2e-11
 Identities = 43/229 (18%), Positives = 81/229 (35%), Gaps = 31/229 (13%)

Query: 206 AVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGS 265
           ++  SLY   +   L+  LG  +   L  F   G     V++ I+    VP  V GI   
Sbjct: 83  SIFLSLYAGFLATLLALLLGAPTGYILARFDFPG--KRLVESIIDVPVVVPHTVAGIALL 140

Query: 266 AVLINFFKMPRSTALVGG---------LILALMTLPSIIIATGVALRTVPSSIRSAALGL 316
            V  +   +                  + +  +++P +  +     ++V   + +AA  L
Sbjct: 141 TVFGSRGLIGEPLESYIQFRDALPGIVVAMLFVSMPYLANSAREGFKSVDPRLENAARSL 200

Query: 317 GASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATA 376
           GA   +  F   LPL+   +L GS ++ ARA+ E   ++ +     V             
Sbjct: 201 GAPLWKAFFFVTLPLSARYLLIGSVMTWARAISEFGAVVILAYYPMVG------------ 248

Query: 377 FPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P  IY         F+     A   + + L ++  ++  +       W
Sbjct: 249 -PTLIYDR-------FISYGLSASRPIAVLLILVTLSIFLVIRTLSAGW 289


>3dhw_A D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} SCOP: f.58.1.1 Length = 217 Back     alignment and structure
>2r6g_F Maltose transport system permease protein MALF; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} SCOP: e.70.1.1 f.58.1.1 PDB: 3fh6_F Length = 514 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target425 phosphate ABC transporter, permease protein PstA [Candi
2onk_C284 Molybdate/tungstate ABC transporter, permease protein; 99.93
3d31_C295 Sulfate/molybdate ABC transporter, permease protein; AT 99.93
3dhw_A217 D-methionine transport system permease protein METI; AB 99.91
2r6g_F514 Maltose transport system permease protein MALF; ABC tra 99.91
2r6g_G296 Maltose transport system permease protein MALG; ABC tra 99.86
>2onk_C Molybdate/tungstate ABC transporter, permease protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: f.58.1.1 Back     alignment and structure
Probab=99.93  E-value=1.1e-24  Score=174.76  Aligned_cols=207  Identities=18%  Similarity=0.177  Sum_probs=167.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC----
Q ss_conf             1202667899999999999999999999999998643730245678989988765336999999999999862666----
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMP----  275 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~----  275 (425)
                      ..+.+.++.+|+..+++++++++++|+..|+++.++  +.+.+++++..+.....+|++++++..+.++.+.....    
T Consensus        67 ~~~~~~~~~~Sl~~a~~s~~l~~~ig~~~a~~l~~~--~~~~~~~~~~l~~~p~~iP~~v~~~~~~~~~~~~~~~~~~~~  144 (284)
T 2onk_C           67 DPAVWKVVLTTYYAALISTLIAVIFGTPLAYILARK--SFPGKSVVEGIVDLPVVIPHTVAGIALLVVFGSSGLIGSFSP  144 (284)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSC--CCSSHHHHHHHHHHHHHSCHHHHHHHHHHHHSTTSTTTTTCS
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             979999999999999999999999999999999982--644899999999978744514456666553312255676210


Q ss_pred             ---CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             ---30046897533454366899999999851106789899870772127777883975332589999999999876779
Q gi|254780705|r  276 ---RSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA  352 (425)
Q Consensus       276 ---~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta  352 (425)
                         ..+.....++.....+|+++...+++++++|+++.|||..+|+++||++++|++|.++|+++++.+++++++++|++
T Consensus       145 ~~~~~~~~~iil~~~~~~~p~~~~~~~~~l~~i~~~l~eaA~~lGas~~~~~~~IilP~~~p~i~~~~il~f~~~~~~~~  224 (284)
T 2onk_C          145 LKFVDALPGIVVAMLFVSVPIYINQAKEGFASVDVRLEHVARTLGSSPLRVFFTVSLPLSVRHIVAGAIMSWARGISEFG  224 (284)
T ss_dssp             SCCTTSHHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHTTCCHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHCCH
T ss_pred             CHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCHHHHHHHHHCCCCCCEEEHEEEHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             00321069999998861465022234355315885689999975989353011024999999999999999999999999


Q ss_pred             HHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             999985432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  353 PLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       353 ~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      ...++++.             ..++|..+|....+.+.   +.+.+.+++++++.+.++.+..++++|-+.|
T Consensus       225 ~~~~l~~~-------------~~~~~~~i~~~~~~~~~---~~~~a~a~il~~i~l~~~~~~~~l~~r~~~~  280 (284)
T 2onk_C          225 AVVVIAYY-------------PMIAPTLIYERYLSEGL---SAAMPVAAILILLSLAVFVALRIIVGREDVS  280 (284)
T ss_dssp             HHHTTCCS-------------SCCHHHHHHHHHHHHCG---GGTHHHHHHHHHHHHHHHHHHHHTTC-----
T ss_pred             HHHHHHCC-------------CCHHHHHHHHHHHCCCH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99988289-------------85299999999980589---9999999999999999999999999713774



>3d31_C Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: f.58.1.1 Back     alignment and structure
>3dhw_A D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} SCOP: f.58.1.1 Back     alignment and structure
>2r6g_F Maltose transport system permease protein MALF; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} SCOP: e.70.1.1 f.58.1.1 PDB: 3fh6_F Back     alignment and structure
>2r6g_G Maltose transport system permease protein MALG; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} SCOP: f.58.1.1 PDB: 3fh6_G Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 425 phosphate ABC transporter, permease protein PstA [Candi
d3dhwa1203 f.58.1.1 (A:6-208) D-methionine transport system permea 7e-08
>d3dhwa1 f.58.1.1 (A:6-208) D-methionine transport system permease protein MetI {Escherichia coli [TaxId: 562]} Length = 203 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: MetI-like
superfamily: MetI-like
family: MetI-like
domain: D-methionine transport system permease protein MetI
species: Escherichia coli [TaxId: 562]
 Score = 52.4 bits (125), Expect = 7e-08
 Identities = 31/160 (19%), Positives = 61/160 (38%), Gaps = 2/160 (1%)

Query: 200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYL-EEFSHKGFFSSFVQANINNLASVPSI 258
           V G+   +  +         +  P+G+   +    +          V A +N   S+P I
Sbjct: 5   VRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFI 64

Query: 259 VYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGA 318
           +  +                     + L +   P I      AL  +P+ +  A+  +GA
Sbjct: 65  ILLVWMIPFTRVIVGTSIG-LQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGA 123

Query: 319 SKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
           + +Q V   +LP A+P ++  +T++L   +G +A    VG
Sbjct: 124 TPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVG 163


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target425 phosphate ABC transporter, permease protein PstA [Candi
d3d31c1248 Sulfate/molybdate ABC transporter, permease protein {Me 99.92
d2r6gg1290 Maltose transport system permease protein MalG {Escheri 99.9
d2onkc1252 Molybdate/tungstate transport system permease protein W 99.9
d2r6gf2244 Maltose transport system permease protein MalF {Escheri 99.88
d3dhwa1203 D-methionine transport system permease protein MetI {Es 99.87
>d3d31c1 f.58.1.1 (C:13-260) Sulfate/molybdate ABC transporter, permease protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MetI-like
superfamily: MetI-like
family: MetI-like
domain: Sulfate/molybdate ABC transporter, permease protein
species: Methanosarcina acetivorans [TaxId: 2214]
Probab=99.92  E-value=1.1e-23  Score=166.71  Aligned_cols=194  Identities=21%  Similarity=0.217  Sum_probs=157.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC------
Q ss_conf             20266789999999999999999999999999864373024567898998876533699999999999986266------
Q gi|254780705|r  201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKM------  274 (425)
Q Consensus       201 ~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~------  274 (425)
                      ...+.++..|++.+.++.++++++|+..|++++++  +.+.++.++........+|++++|+..+..+.+....      
T Consensus        43 ~~~~~~l~~Sl~~a~~s~~i~~~lg~~~a~~~~~~--~~~~~~~~~~l~~~p~~ip~vv~~~~~~~~~~~~~~~~~~~~~  120 (248)
T d3d31c1          43 RSVISSIFLSLYAGFLATLLALLLGAPTGYILARF--DFPGKRLVESIIDVPVVVPHTVAGIALLTVFGSRGLIGEPLES  120 (248)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTC--CCTTHHHHHHHHHGGGTSCHHHHHHHHHHHHSTTSTTTGGGTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCHHHHHHHHHHHHHHHHHHCCHHHHHHCCCCCCCCCCCCCC
T ss_conf             89999999999999999999999999999999864--6512568999999999999720002445203432111112222


Q ss_pred             ---CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             ---63004689753345436689999999985110678989987077212777788397533258999999999987677
Q gi|254780705|r  275 ---PRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET  351 (425)
Q Consensus       275 ---~~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEt  351 (425)
                         ...+.....++...+.+|++++..+++++++|++++|||..+|+|+||+++||++|.++|+++++.++++.++++|.
T Consensus       121 ~~~~~~~~~~iii~~~~~~~p~~~~~~~~~l~~i~~~~~eAA~~lGas~~~~~~~I~lP~~~p~i~~~~~l~f~~~~~~~  200 (248)
T d3d31c1         121 YIQFRDALPGIVVAMLFVSMPYLANSAREGFKSVDPRLENAARSLGAPLWKAFFFVTLPLSARYLLIGSVMTWARAISEF  200 (248)
T ss_dssp             TCCCTTSHHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHTTCCHHHHHHHTHHHHHHHHHHHHHHHHHHHHHTCC
T ss_pred             CCCCCCCCCEEEHHHCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             11245642001001101100368888899997103368999876310423477898899999999999999999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999985432101366561344557999999860366500699999999999999999999
Q gi|254780705|r  352 APLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT  412 (425)
Q Consensus       352 a~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~  412 (425)
                      .+..++|+.             ..+++..+|....+.+.+   .+.+.+++++++.+.+..
T Consensus       201 ~~~~~l~~~-------------~~~~~~~i~~~~~~~~~~---~a~a~a~il~~~~l~~~~  245 (248)
T d3d31c1         201 GAVVILAYY-------------PMVGPTLIYDRFISYGLS---ASRPIAVLLILVTLSIFL  245 (248)
T ss_dssp             HHHHHHHCT-------------TCCHHHHHHHHHHHSTTT---TTHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHCCC-------------CCHHHHHHHHHHHHCCHH---HHHHHHHHHHHHHHHHHH
T ss_conf             988733189-------------840999999999955899---999999999999999999



>d2r6gg1 f.58.1.1 (G:7-296) Maltose transport system permease protein MalG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onkc1 f.58.1.1 (C:1-252) Molybdate/tungstate transport system permease protein WtpB (ModB) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2r6gf2 f.58.1.1 (F:261-504) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwa1 f.58.1.1 (A:6-208) D-methionine transport system permease protein MetI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 425 phosphate ABC transporter, permease protein PstA [
3dhw_A_217 (A:) D-methionine transport system permease protei 2e-13
3d31_C_295 (C:) Sulfate/molybdate ABC transporter, permease p 1e-09
2r6g_G_73-244172 (G:73-244) Maltose transport system permease prote 2e-13
2onk_C_69-249181 (C:69-249) Molybdate/tungstate ABC transporter, pe 6e-13
2r6g_F_269-326_360-453152 (F:269-326,F:360-453) Maltose transport system per 3e-10
>3dhw_A (A:) D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12}Length = 217 Back     alignment and structure
 Score = 71.5 bits (175), Expect = 2e-13
 Identities = 38/226 (16%), Positives = 77/226 (34%), Gaps = 19/226 (8%)

Query: 200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYL-EEFSHKGFFSSFVQANINNLASVPSI 258
           V G+   +  +         +  P+G+   +    +          V A +N   S+P I
Sbjct: 10  VRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFI 69

Query: 259 VYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGA 318
           +  +                     + L +   P I      AL  +P+ +  A+  +GA
Sbjct: 70  ILLVWMIPFTRVIVGTS-IGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGA 128

Query: 319 SKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFP 378
           + +Q V   +LP A+P ++  +T++L   +G +A    VG                    
Sbjct: 129 TPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQ-------------- 174

Query: 379 VQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              Y +        V      ++LL+I + +I  A   +     ++
Sbjct: 175 -IGYQYGYIGYNATV--MNTVLVLLVILVYLIQFAGDRIVRAVTRK 217


>3d31_C (C:) Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans}Length = 295 Back     alignment and structure
>2r6g_G (G:73-244) Maltose transport system permease protein MALG; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12}Length = 172 Back     alignment and structure
>2onk_C (C:69-249) Molybdate/tungstate ABC transporter, permease protein; membrane protein; 3.10A {Archaeoglobus fulgidus}Length = 181 Back     alignment and structure
>2r6g_F (F:269-326,F:360-453) Maltose transport system permease protein MALF; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12}Length = 152 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target425 phosphate ABC transporter, permease protein PstA [Candi
3d31_C_295 Sulfate/molybdate ABC transporter, permease protei 99.94
3dhw_A_217 D-methionine transport system permease protein MET 99.91
2r6g_G_73-244172 Maltose transport system permease protein MALG; AB 99.9
2onk_C_69-249181 Molybdate/tungstate ABC transporter, permease prot 99.89
2r6g_F_269-326_360-453152 Maltose transport system permease protein MALF; AB 99.8
>3d31_C (C:) Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} Back     alignment and structure
Probab=99.94  E-value=2.7e-25  Score=179.57  Aligned_cols=208  Identities=20%  Similarity=0.194  Sum_probs=177.3

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC----
Q ss_conf             0120266789999999999999999999999999864373024567898998876533699999999999986266----
Q gi|254780705|r  199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKM----  274 (425)
Q Consensus       199 e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~----  274 (425)
                      ...+.+.++.+|++.++++++++.++|+++|++++++  +.+.++.++..+.....+|.++.++..+..+......    
T Consensus        76 ~~~~~~~~l~~Tl~~~~~~~~~~~~ig~~~a~~l~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  153 (295)
T 3d31_C           76 GNRSVISSIFLSLYAGFLATLLALLLGAPTGYILARF--DFPGKRLVESIIDVPVVVPHTVAGIALLTVFGSRGLIGEPL  153 (295)
T ss_dssp             HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTC--CCTTHHHHHHHHHGGGTSCHHHHHHHHHHHHSTTSTTTGGG
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHH
T ss_conf             5989999999999999999999999999999999963--66479999999999999999999999999997266324303


Q ss_pred             -----CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -----630046897533454366899999999851106789899870772127777883975332589999999999876
Q gi|254780705|r  275 -----PRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALG  349 (425)
Q Consensus       275 -----~~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~G  349 (425)
                           ...+.....+++.++.+|+++...+++++++|++++|||..+|||+||++++|++|+++|++++|.++++..+++
T Consensus       154 ~~~~~~~~~~~~~i~~~~~~~~p~~~~~~~~~l~~i~~~l~eAA~~~Gas~~~~f~~I~lP~~~p~i~~~~~l~~~~~~~  233 (295)
T 3d31_C          154 ESYIQFRDALPGIVVAMLFVSMPYLANSAREGFKSVDPRLENAARSLGAPLWKAFFFVTLPLSARYLLIGSVMTWARAIS  233 (295)
T ss_dssp             TTTCCCTTSHHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHTTCCHHHHHHHTHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             32167123999999999999999999999999975050589999876998262127746996999999999999999999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             779999985432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  350 ETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       350 Eta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      |+....++++.             ..++++.+|....+.+.+.   +++.+++++++++.++.+...+.+|.++|
T Consensus       234 ~~~~~~~l~~~-------------~~~~~~~i~~~~~~~~~~~---~~a~~~i~~~~~~~~~~~~~~~~~r~~~~  292 (295)
T 3d31_C          234 EFGAVVILAYY-------------PMVGPTLIYDRFISYGLSA---SRPIAVLLILVTLSIFLVIRTLSAGWSIY  292 (295)
T ss_dssp             CCHHHHHHHCT-------------TCCHHHHHHHHHHHSTTTT---THHHHHHHHHHHHHHHHHHC---------
T ss_pred             HHHHHHHHHCC-------------CCHHHHHHHHHHHHCCHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999589-------------7319999999999448999---99999999999999999999999760364



>3dhw_A (A:) D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} Back     alignment and structure
>2r6g_G (G:73-244) Maltose transport system permease protein MALG; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} Back     alignment and structure
>2onk_C (C:69-249) Molybdate/tungstate ABC transporter, permease protein; membrane protein; 3.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2r6g_F (F:269-326,F:360-453) Maltose transport system permease protein MALF; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} Back     alignment and structure