254780709

254780709

cell division protein

GeneID in NCBI database:8209714Locus tag:CLIBASIA_02980
Protein GI in NCBI database:254780709Protein Accession:YP_003065122.1
Gene range:+(556538, 557503)Protein Length:321aa
Gene description:cell division protein
COG prediction:[U] Signal recognition particle GTPase
KEGG prediction:cell division protein; K03110 fused signal recognition particle receptor
SEED prediction:Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)
Pathway involved in KEGG:Protein export [PATH:las03060]
Bacterial secretion system [PATH:las03070]
Subsystem involved in SEED:Bacterial Cell Division;
Universal GTPases
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-
MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLDYGEEKI
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHcccEEEccccccHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHcccccccccc
cccHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHccccEEcccccccHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEHHHcHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHcccEEEEEccccHHHEEEccHHHHHHHHccccccccccc
MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIissrrlddgVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMlmplskpfnwdfshrphVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWadrtsadfvcsEIGSDAAALAYEAFKQAQAKKVDVLIIDTagrlhnnsILMAGIGKMIRVLkrldphaphsvLQVLDATTGQNALRQVEMFHAVAGttglimtkmdgtarggglipivvthkipvyflgvgegindlepfvakDFSAVITGCldygeeki
msnqkvaseSLSWIRKLTKgfastslklkegitdiissrrlddgvREELEDllirsdigvaVAQKIVEELLtkryakdvsvqRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLDYGEEKI
MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILvvgvngvgkttvigkLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLDYGEEKI
*****************TKGF*******KEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLT**********RVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCL*******
**********LSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLDYGEEKI
*********SLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLDY*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLDYGEEKI
MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLDYGEEKI
MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLDYGEEKI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target321 cell division protein [Candidatus Liberibacter asiaticu
254780711 461 signal recognition particle protein [Candidatus Li 2e-24
254780273539 putative ABC transporter ATP-binding protein [Cand 0.001
254781123610 putative ABC transporter, ATP-binding protein [Can 0.004
>gi|254780711|ref|YP_003065124.1| signal recognition particle protein [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Back     alignment
 Score =  104 bits (259), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 132/278 (47%), Gaps = 21/278 (7%)

Query: 48  ELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVS------ELIHKMLMPL-- 99
           E+    + +D+ + V Q       +KR  +    +++L  +       +++H  L+ +  
Sbjct: 33  EIRRTFLEADVSLEVVQS-----FSKRVQEKAKGEKILRSIQPGQMVIKIVHDELVEVLG 87

Query: 100 SKPFNWDFS-HRPHVILVVGVNGVGKTTVIGKLS-KKMSDAGLKVMLAAGDTFRSAAIDQ 157
            +    D +   P VI++VG+ G GKTT   K++    +    K+++A+ D  R AA +Q
Sbjct: 88  KESIELDLNAPSPLVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQ 147

Query: 158 LKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGK 217
           L+   ++   D +          +A  A + A+    D +I+DTAGR H N  LM  I +
Sbjct: 148 LRYLGEQIQVDTLEVIPEQSPEKIAIRATQSARDGGYDAVILDTAGRNHINDSLMQEISE 207

Query: 218 MIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIP 277
           +  +        PH +L V DA TGQ+A+     F  +   TG+I+T+MDG  RGG  + 
Sbjct: 208 IKSLTN------PHEILLVADALTGQDAVHLARNFDKIVDLTGIILTRMDGDGRGGAALS 261

Query: 278 IVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLD 315
           +      P+  +G GE INDLE F     +  I G  D
Sbjct: 262 MRTVTGKPIKAIGTGEKINDLENFFPDRIANRILGMGD 299

>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Back     alignment
 Score = 35.4 bits (80), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 48/112 (42%), Gaps = 10/112 (8%)

Query: 113 VILVVGVNGVGKTTVIGKLSKKMS------DAGLKVMLAAGDTFRSAAIDQLKIWADRTS 166
           ++ V+G NG GKTT+   L+   S        G  V L+  D  R +   +  +W D + 
Sbjct: 345 IVGVIGPNGAGKTTLFRMLTGDESPDSGTIHVGETVCLSYVDQSRDSLEAEKTVWEDISG 404

Query: 167 ADFVCS----EIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAG 214
            D +      EI S A   A+      Q +++  L     GR+H   IL +G
Sbjct: 405 GDDIVKLNGHEINSRAYCSAFNFKGGDQQQRIGSLSGGQRGRVHLAKILKSG 456

>gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Back     alignment
 Score = 33.9 bits (76), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 39/76 (51%), Gaps = 9/76 (11%)

Query: 106 DFSHRPH---VILVVGVNGVGKTTVIGKLSKKMS-DAGLKVMLAAGDTFRSAAIDQLK-- 159
           DFS R H    I +VG NG GKTT++  L+ K+  D G    +  G   + A IDQ +  
Sbjct: 302 DFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGF---ITLGTNLKIATIDQKRED 358

Query: 160 IWADRTSADFVCSEIG 175
           I  D++ A ++    G
Sbjct: 359 IDPDKSLASYLTGSSG 374

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target321 cell division protein [Candidatus Liberibacter asiaticu
315121874315 cell division protein [Candidatus Liberibacter solanace 1 1e-146
86359533522 cell division protein [Rhizobium etli CFN 42] Length = 1 1e-104
241206753533 signal recognition particle-docking protein FtsY [Rhizo 1 1e-104
190893800520 cell division protein [Rhizobium etli CIAT 652] Length 1 1e-104
218661335335 cell division protein [Rhizobium etli IE4771] Length = 1 1e-104
209551317528 signal recognition particle-docking protein FtsY [Rhizo 1 1e-104
116254270531 cell division protein [Rhizobium leguminosarum bv. vici 1 1e-104
327190191524 cell division protein [Rhizobium etli CNPAF512] Length 1 1e-103
325294064476 cell division particle [Agrobacterium sp. H13-3] Length 1 1e-103
227823743532 signal recognition particle-docking protein FtsY [Sinor 1 1e-103
>gi|315121874|ref|YP_004062363.1| cell division protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 315 Back     alignment and organism information
 Score =  521 bits (1342), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 254/314 (80%), Positives = 280/314 (89%)

Query: 8   SESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIV 67
           S+S SWI+K  KGFASTSLKLKEGI  +ISS+RLDD VR+ELEDLLIR+DIG+  AQ+IV
Sbjct: 2   SKSFSWIQKKAKGFASTSLKLKEGIAAVISSKRLDDSVRDELEDLLIRADIGLEAAQEIV 61

Query: 68  EELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTV 127
            +L+ KRY KDVS+Q VL DVSE I+K+LMP+SK F+ DFSHRPHVILVVGVNG GKTT 
Sbjct: 62  GDLVAKRYNKDVSIQCVLQDVSEKIYKILMPISKSFDLDFSHRPHVILVVGVNGAGKTTA 121

Query: 128 IGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK 187
           IGKLSKKMSD+GLK+MLAAGDTFRSAA+DQLKIWADRTS+DFV SEIGSDAAALAYEAF+
Sbjct: 122 IGKLSKKMSDSGLKIMLAAGDTFRSAAVDQLKIWADRTSSDFVGSEIGSDAAALAYEAFR 181

Query: 188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALR 247
           QAQAK VDVLIIDTAGRLHNNS LMAGIGKMIRVLKRLDP APHSVLQVLDAT GQNALR
Sbjct: 182 QAQAKNVDVLIIDTAGRLHNNSALMAGIGKMIRVLKRLDPDAPHSVLQVLDATVGQNALR 241

Query: 248 QVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFS 307
           QVE+F +VAGTTGLIMTK+DGTARGG L+ I + HKIPVYFLG GEGINDLEPFVAKDFS
Sbjct: 242 QVELFQSVAGTTGLIMTKLDGTARGGILVSIAIKHKIPVYFLGTGEGINDLEPFVAKDFS 301

Query: 308 AVITGCLDYGEEKI 321
             ITG  DY E+KI
Sbjct: 302 TAITGYFDYNEKKI 315


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86359533|ref|YP_471425.1| cell division protein [Rhizobium etli CFN 42] Length = 522 Back     alignment and organism information
>gi|241206753|ref|YP_002977849.1| signal recognition particle-docking protein FtsY [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 533 Back     alignment and organism information
>gi|190893800|ref|YP_001980342.1| cell division protein [Rhizobium etli CIAT 652] Length = 520 Back     alignment and organism information
>gi|218661335|ref|ZP_03517265.1| cell division protein [Rhizobium etli IE4771] Length = 335 Back     alignment and organism information
>gi|209551317|ref|YP_002283234.1| signal recognition particle-docking protein FtsY [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 528 Back     alignment and organism information
>gi|116254270|ref|YP_770108.1| cell division protein [Rhizobium leguminosarum bv. viciae 3841] Length = 531 Back     alignment and organism information
>gi|327190191|gb|EGE57296.1| cell division protein [Rhizobium etli CNPAF512] Length = 524 Back     alignment and organism information
>gi|325294064|ref|YP_004279928.1| cell division particle [Agrobacterium sp. H13-3] Length = 476 Back     alignment and organism information
>gi|227823743|ref|YP_002827716.1| signal recognition particle-docking protein FtsY [Sinorhizobium fredii NGR234] Length = 532 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target321 cell division protein [Candidatus Liberibacter asiaticu
PRK10416318 PRK10416, PRK10416, signal recognition particle-docking 1e-112
PRK14974336 PRK14974, PRK14974, cell division protein FtsY; Provisi 2e-54
COG0541 451 COG0541, Ffh, Signal recognition particle GTPase [Intra 7e-54
KOG0780 483 KOG0780, KOG0780, KOG0780, Signal recognition particle, 5e-52
PRK00771 437 PRK00771, PRK00771, signal recognition particle protein 1e-46
TIGR00959 428 TIGR00959, ffh, signal recognition particle protein 6e-45
KOG0781587 KOG0781, KOG0781, KOG0781, Signal recognition particle 4e-31
PRK05703424 PRK05703, flhF, flagellar biosynthesis regulator FlhF; 4e-19
PRK12723388 PRK12723, PRK12723, flagellar biosynthesis regulator Fl 6e-07
COG0552340 COG0552, FtsY, Signal recognition particle GTPase [Intr 7e-86
TIGR00064272 TIGR00064, ftsY, signal recognition particle-docking pr 2e-78
TIGR01425 429 TIGR01425, SRP54_euk, signal recognition particle prote 2e-32
PRK06731270 PRK06731, flhF, flagellar biosynthesis regulator FlhF; 6e-09
PRK11889436 PRK11889, flhF, flagellar biosynthesis regulator FlhF; 6e-09
pfam00448196 pfam00448, SRP54, SRP54-type protein, GTPase domain 2e-66
cd03115173 cd03115, SRP, The signal recognition particle (SRP) med 6e-49
PRK10867 433 PRK10867, PRK10867, signal recognition particle protein 2e-42
COG1419407 COG1419, FlhF, Flagellar GTP-binding protein [Cell moti 1e-19
PRK12726407 PRK12726, PRK12726, flagellar biosynthesis regulator Fl 4e-10
PRK12724432 PRK12724, PRK12724, flagellar biosynthesis regulator Fl 7e-10
PRK14723 767 PRK14723, flhF, flagellar biosynthesis regulator FlhF; 1e-08
PRK14722374 PRK14722, flhF, flagellar biosynthesis regulator FlhF; 1e-08
PRK12727559 PRK12727, PRK12727, flagellar biosynthesis regulator Fl 6e-08
PRK14721420 PRK14721, flhF, flagellar biosynthesis regulator FlhF; 8e-05
PRK06995484 PRK06995, flhF, flagellar biosynthesis regulator FlhF; 1e-04
TIGR03499282 TIGR03499, FlhF, flagellar biosynthetic protein FlhF 6e-15
smart00382148 smart00382, AAA, ATPases associated with a variety of c 1e-09
pfam0288177 pfam02881, SRP54_N, SRP54-type protein, helical bundle 9e-08
COG1703323 COG1703, ArgK, Putative periplasmic protein kinase ArgK 8e-05
pfam03308267 pfam03308, ArgK, ArgK protein 0.001
>gnl|CDD|182441 PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>gnl|CDD|184937 PRK14974, PRK14974, cell division protein FtsY; Provisional Back     alignment and domain information
>gnl|CDD|30887 COG0541, Ffh, Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|35999 KOG0780, KOG0780, KOG0780, Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|179118 PRK00771, PRK00771, signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>gnl|CDD|162133 TIGR00959, ffh, signal recognition particle protein Back     alignment and domain information
>gnl|CDD|36000 KOG0781, KOG0781, KOG0781, Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|180213 PRK05703, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|183702 PRK12723, PRK12723, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|30898 COG0552, FtsY, Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|161686 TIGR00064, ftsY, signal recognition particle-docking protein FtsY Back     alignment and domain information
>gnl|CDD|130492 TIGR01425, SRP54_euk, signal recognition particle protein SRP54 Back     alignment and domain information
>gnl|CDD|75717 PRK06731, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|183360 PRK11889, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|144151 pfam00448, SRP54, SRP54-type protein, GTPase domain Back     alignment and domain information
>gnl|CDD|48379 cd03115, SRP, The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>gnl|CDD|182793 PRK10867, PRK10867, signal recognition particle protein; Provisional Back     alignment and domain information
>gnl|CDD|31609 COG1419, FlhF, Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|183704 PRK12726, PRK12726, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|183703 PRK12724, PRK12724, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|173186 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|173185 PRK14722, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|183705 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|173184 PRK14721, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|180787 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|163294 TIGR03499, FlhF, flagellar biosynthetic protein FlhF Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|145830 pfam02881, SRP54_N, SRP54-type protein, helical bundle domain Back     alignment and domain information
>gnl|CDD|31889 COG1703, ArgK, Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|112137 pfam03308, ArgK, ArgK protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 321 cell division protein [Candidatus Liberibacter asiaticu
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 100.0
TIGR00959 439 ffh signal recognition particle protein; InterPro: IPR0 100.0
PRK10867 453 signal recognition particle protein; Provisional 100.0
PRK00771 433 signal recognition particle protein Srp54; Provisional 100.0
COG0541 451 Ffh Signal recognition particle GTPase [Intracellular t 100.0
TIGR01425 453 SRP54_euk signal recognition particle protein SRP54; In 100.0
KOG0780 483 consensus 100.0
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 100.0
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 100.0
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 100.0
KOG0781587 consensus 100.0
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 100.0
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 100.0
PRK04220306 2-phosphoglycerate kinase; Provisional 97.81
COG1084346 Predicted GTPase [General function prediction only] 95.56
PRK10416499 cell division protein FtsY; Provisional 100.0
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 100.0
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 100.0
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 100.0
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 100.0
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 100.0
cd03115173 SRP The signal recognition particle (SRP) mediates the 100.0
PHA02518211 ParA-like protein; Provisional 98.8
pfam07015231 VirC1 VirC1 protein. This family consists of several ba 98.73
cd02117212 NifH_like This family contains the NifH (iron protein) 98.69
PRK13849231 putative crown gall tumor protein VirC1; Provisional 98.68
PRK09435325 arginine/ornithine transport system ATPase; Provisional 98.68
pfam01656212 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain. Thi 98.67
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 98.63
pfam00142269 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, 98.61
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 98.58
cd02040270 NifH NifH gene encodes component II (iron protein) of n 98.51
cd02032267 Bchl_like This family of proteins contains bchL and chl 98.48
cd02036179 MinD Bacterial cell division requires the formation of 98.44
PRK13768253 GTPase; Provisional 98.37
cd03110179 Fer4_NifH_child This protein family's function is unkow 98.35
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptation) is 98.35
PRK13231264 nitrogenase reductase-like protein; Reviewed 98.33
PRK13235274 nifH nitrogenase reductase; Reviewed 98.3
cd02038139 FleN-like FleN is a member of the Fer4_NifH superfamily 98.26
PRK13233275 nifH nitrogenase reductase; Reviewed 98.26
CHL00072271 chlL photochlorophyllide reductase subunit L 98.25
PRK00090223 bioD dithiobiotin synthetase; Reviewed 98.24
PRK13185269 chlL protochlorophyllide reductase iron-sulfur ATP-bind 98.17
PRK11670369 putative ATPase; Provisional 98.15
CHL00175279 minD septum-site determining protein; Validated 98.12
pfam00009185 GTP_EFTU Elongation factor Tu GTP binding domain. This 98.11
PRK01077 451 cobyrinic acid a,c-diamide synthase; Validated 98.09
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) is a 98.08
PRK03003474 engA GTP-binding protein EngA; Reviewed 98.03
PRK10463290 hydrogenase nickel incorporation protein HypB; Provisio 98.02
cd01878204 HflX HflX subfamily. A distinct conserved domain with a 98.02
COG3640255 CooC CO dehydrogenase maturation factor [Cell division 97.97
COG0455262 flhG Antiactivator of flagellar biosynthesis FleN, an A 97.9
PRK12374231 putative dithiobiotin synthetase; Provisional 97.85
PRK13236295 nitrogenase reductase; Reviewed 97.81
PRK05291445 trmE tRNA modification GTPase TrmE; Reviewed 97.8
PRK13234293 nifH nitrogenase reductase; Reviewed 97.77
cd01895174 EngA2 EngA2 subfamily. This CD represents the second GT 97.73
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein foun 97.71
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 97.69
PRK00784 492 cobyric acid synthase; Provisional 97.66
pfam01591223 6PF2K 6-phosphofructo-2-kinase. This enzyme occurs as a 97.62
PRK00093438 engA GTP-binding protein EngA; Reviewed 97.6
PRK11537317 putative GTP-binding protein YjiA; Provisional 97.53
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic i 97.52
cd00881189 GTP_translation_factor GTP translation factor family. T 97.49
PRK13896 432 cobyrinic acid a,c-diamide synthase; Provisional 97.49
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This fami 97.41
cd01894157 EngA1 EngA1 subfamily. This CD represents the first GTP 97.41
KOG0923 902 consensus 97.4
PRK00093 438 engA GTP-binding protein EngA; Reviewed 97.36
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA 97.3
PRK00454196 engB GTPase EngB; Reviewed 97.21
KOG0925 699 consensus 97.2
PRK03003 474 engA GTP-binding protein EngA; Reviewed 97.2
cd03109134 DTBS Dethiobiotin synthetase (DTBS) is the penultimate 97.19
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamily of 97.19
cd01898170 Obg Obg subfamily. The Obg nucleotide binding protein s 97.16
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 97.13
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 97.11
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Translo 97.08
pfam02421188 FeoB_N Ferrous iron transport protein B. Escherichia co 97.08
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 97.06
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 97.06
COG0523 323 Putative GTPases (G3E family) [General function predict 97.02
cd04171164 SelB SelB subfamily. SelB is an elongation factor neede 97.01
pfam10662143 PduV-EutP Ethanolamine utilisation - propanediol utilis 96.98
smart00178184 SAR Sar1p-like members of the Ras-family of small GTPas 96.98
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 96.95
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfamily. 96.92
COG1797 451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme meta 96.9
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthesis pr 96.88
COG0486454 ThdF Predicted GTPase [General function prediction only 96.87
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 96.86
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protein Ysx 96.86
PRK09518 714 bifunctional cytidylate kinase/GTP-binding protein; Rev 96.84
COG2894272 MinD Septum formation inhibitor-activating ATPase [Cell 96.82
PRK09518714 bifunctional cytidylate kinase/GTP-binding protein; Rev 96.81
pfam00025174 Arf ADP-ribosylation factor family. Pfam combines a num 96.8
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), Tet(W) 96.77
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 96.74
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase family 96.7
TIGR00101199 ureG urease accessory protein UreG; InterPro: IPR004400 96.66
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translocatio 96.65
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 6) p 96.64
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 96.61
PTZ00133182 ADP-ribosylation factor; Provisional 96.57
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor doma 96.57
PRK00089 296 era GTP-binding protein Era; Reviewed 96.54
pfam00071162 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ra 96.53
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein present in 96.53
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recombinati 96.52
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ortholog 96.48
PRK04040189 adenylate kinase; Provisional 96.48
cd02033329 BchX Chlorophyllide reductase converts chlorophylls int 96.47
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 (Arf- 96.46
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 96.43
TIGR01448 769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 96.35
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Ypt2 ar 96.35
COG0132223 BioD Dethiobiotin synthetase [Coenzyme metabolism] 96.34
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.34
COG2874235 FlaH Predicted ATPases involved in biogenesis of archae 96.32
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 96.29
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation facto 96.27
cd04123162 Rab21 Rab21 subfamily. The localization and function of 96.26
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes to the 96.22
cd00154159 Rab Rab family. Rab GTPases form the largest family wit 96.12
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.06
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with prot 95.98
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (Arl2- 95.97
PRK13808 297 adenylate kinase; Provisional 95.92
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicated in 95.87
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was identif 95.84
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was first i 95.77
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 95.65
PRK08939306 primosomal protein DnaI; Reviewed 95.62
COG1160 444 Predicted GTPases [General function prediction only] 95.57
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in every e 95.57
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily consists 95.56
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in numero 95.45
COG1159 298 Era GTPase [General function prediction only] 95.43
KOG2749415 consensus 95.34
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 100.0
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 97.27
COG1160444 Predicted GTPases [General function prediction only] 96.19
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 100.0
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 97.11
PRK09841726 cryptic autophosphorylating protein tyrosine kinase Etk 98.94
cd03114148 ArgK-like The function of this protein family is unkown 98.81
PRK11519720 tyrosine kinase; Provisional 98.78
cd02035217 ArsA ArsA ATPase functionas as an efflux pump located o 98.73
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein YhjQ. 98.53
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosi 98.52
TIGR03029274 EpsG chain length determinant protein tyrosine kinase E 98.52
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 98.49
PRK10818270 cell division inhibitor MinD; Provisional 98.39
TIGR01007207 eps_fam capsular exopolysaccharide family; InterPro: IP 98.38
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 98.37
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 98.31
PRK13232273 nifH nitrogenase reductase; Reviewed 98.23
KOG0924 1042 consensus 98.18
pfam06564244 YhjQ YhjQ protein. This family consists of several bact 98.18
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 98.14
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 98.14
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 98.1
KOG0922 674 consensus 98.01
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of this 97.93
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 97.89
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 97.75
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 97.71
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 97.62
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 97.61
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 97.6
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 97.59
COG3523 1188 IcmF Type VI protein secretion system component VasK [I 97.53
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 97.48
smart00487201 DEXDc DEAD-like helicases superfamily. 97.43
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding protein 97.43
cd03112158 CobW_like The function of this protein family is unkown 97.43
CHL00095823 clpC Clp protease ATP binding subunit 97.42
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 97.39
PRK11448 1126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 97.28
PRK09112352 DNA polymerase III subunit delta'; Validated 97.27
PRK10865857 protein disaggregation chaperone; Provisional 97.24
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 97.18
PRK07471 363 DNA polymerase III subunit delta'; Validated 97.11
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 (RF3) 96.94
COG2403 449 Predicted GTPase [General function prediction only] 96.92
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha su 96.91
PRK10037250 cell division protein; Provisional 96.91
PRK08769319 DNA polymerase III subunit delta'; Validated 96.89
PRK05564 313 DNA polymerase III subunit delta'; Validated 96.88
PTZ00141 443 elongation factor 1 alpha; Provisional 96.88
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential component of 96.87
cd04105203 SR_beta Signal recognition particle receptor, beta subu 96.86
KOG1051 898 consensus 96.84
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00176">TIGR00176165 mobB molybdopterin-guanine dinucleotide biosynthesis pr 96.75
pfam09439181 SRPRB Signal recognition particle receptor beta subunit 96.74
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 96.65
PRK05917290 DNA polymerase III subunit delta'; Validated 96.6
PRK12317 426 elongation factor 1-alpha; Reviewed 96.59
PRK08058329 DNA polymerase III subunit delta'; Validated 96.55
PRK02362 736 ski2-like helicase; Provisional 96.43
PRK07132303 DNA polymerase III subunit delta'; Validated 96.31
PRK08699325 DNA polymerase III subunit delta'; Validated 96.28
CHL00071 409 tufA elongation factor Tu 96.26
PRK12735 396 elongation factor Tu; Reviewed 96.21
PRK05707 328 DNA polymerase III subunit delta'; Validated 96.18
PTZ00336 449 elongation factor 1-alpha; Provisional 96.1
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell moti 96.08
PRK00741 526 prfC peptide chain release factor 3; Provisional 96.06
pfam04548200 AIG1 AIG1 family. Arabidopsis protein AIG1 appears to b 96.03
COG1100219 GTPase SAR1 and related small G proteins [General funct 95.97
PRK01172 674 ski2-like helicase; Provisional 95.91
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of several pr 95.86
KOG0734 752 consensus 95.78
PRK07993 334 DNA polymerase III subunit delta'; Validated 95.56
PRK00049 397 elongation factor Tu; Reviewed 95.49
PRK06964342 DNA polymerase III subunit delta'; Validated 95.39
PRK06871324 DNA polymerase III subunit delta'; Validated 95.36
PRK05986190 cob(I)yrinic acid a,c-diamide adenosyltransferase; Vali 95.36
KOG0920 924 consensus 95.36
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This 98.88
pfam02374304 ArsA_ATPase Anion-transporting ATPase. This Pfam family 98.78
COG0003 322 ArsA Predicted ATPase involved in chromosome partitioni 98.33
COG1192259 Soj ATPases involved in chromosome partitioning [Cell d 98.18
PRK13705388 plasmid-partitioning protein SopA; Provisional 98.16
PRK09401 1176 reverse gyrase; Reviewed 98.08
PRK13230292 nitrogenase reductase-like protein; Reviewed 98.08
PHA02519387 plasmid partition protein SopA; Reviewed 98.06
KOG1805 1100 consensus 97.97
pfam06745231 KaiC KaiC. This family represents a conserved region wi 97.91
COG0489265 Mrp ATPases involved in chromosome partitioning [Cell d 97.85
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 97.76
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 97.67
COG4240300 Predicted kinase [General function prediction only] 97.66
PRK04328250 hypothetical protein; Provisional 97.66
PRK05541176 adenylylsulfate kinase; Provisional 97.64
cd01124187 KaiC KaiC is a circadian clock protein primarily found 97.55
TIGR01968272 minD_bact septum site-determining protein MinD; InterPr 97.5
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 97.5
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 97.49
PRK06696227 uridine kinase; Validated 97.43
KOG1532 366 consensus 97.43
PRK03846198 adenylylsulfate kinase; Provisional 97.41
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 97.4
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 97.38
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 97.35
PRK05480209 uridine kinase; Provisional 97.35
PRK13869405 plasmid-partitioning protein RepA; Provisional 97.29
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 97.29
PRK00889175 adenylylsulfate kinase; Provisional 97.26
TIGR03453387 partition_RepA plasmid partitioning protein RepA. Membe 97.26
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 97.25
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 97.23
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 97.21
PRK09270230 frcK putative fructose transport system kinase; Reviewe 97.2
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 97.19
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 97.18
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 97.18
PRK00440318 rfc replication factor C small subunit; Reviewed 97.16
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 97.15
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 97.12
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 97.11
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 97.1
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 97.01
CHL00181287 cbbX CbbX; Provisional 97.0
PRK07667190 uridine kinase; Provisional 96.98
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 96.98
PTZ00301210 uridine kinase; Provisional 96.94
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 96.88
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 96.79
cd03111106 CpaE_like This protein family consists of proteins simi 96.79
PRK00698204 tmk thymidylate kinase; Validated 96.72
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.66
TIGR00345 330 arsA arsenite-activated ATPase (arsA); InterPro: IPR003 96.64
TIGR01188 343 drrA daunorubicin resistance ABC transporter, ATP-bindi 96.63
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 96.63
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.57
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 96.55
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 96.52
PRK05439312 pantothenate kinase; Provisional 96.51
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.5
pfam00004131 AAA ATPase family associated with various cellular acti 96.48
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1/aden 96.46
PRK06761281 hypothetical protein; Provisional 96.45
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 96.42
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 96.4
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 96.4
PRK05632 702 phosphate acetyltransferase; Reviewed 96.38
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.38
PRK13342 417 recombination factor protein RarA; Reviewed 96.38
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.33
PRK05201 442 hslU ATP-dependent protease ATP-binding subunit; Provis 96.3
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.29
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and metabo 96.25
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 96.23
KOG2825323 consensus 96.2
COG4586325 ABC-type uncharacterized transport system, ATPase compo 96.19
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.18
PTZ00088225 adenylate kinase 1; Provisional 96.17
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.16
PRK13409590 putative ATPase RIL; Provisional 96.14
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 96.14
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 96.12
TIGR00606 1328 rad50 rad50; InterPro: IPR004584 Rad50 is involved in r 96.1
PRK05636507 replicative DNA helicase; Provisional 96.09
TIGR00958770 3a01208 antigen peptide transporter 2; InterPro: IPR005 96.08
PRK11545177 gntK gluconate kinase 1; Provisional 96.07
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 96.04
PRK11000 369 maltose/maltodextrin transporter ATP-binding protein; P 96.03
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 96.02
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also known 96.01
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 95.96
PRK10851 352 sulfate/thiosulfate transporter subunit; Provisional 95.95
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 95.94
PRK09825176 idnK D-gluconate kinase; Provisional 95.93
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.93
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 95.92
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 95.91
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 95.87
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 95.84
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 95.72
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 95.71
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 95.71
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.64
TIGR03575 340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic. Me 95.63
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.63
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 95.62
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 95.62
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 95.61
PRK07399314 DNA polymerase III subunit delta'; Validated 95.59
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 95.59
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 95.59
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 95.59
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.57
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 95.55
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.53
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 95.52
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme in 95.52
CHL00195491 ycf46 Ycf46; Provisional 95.48
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.44
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 95.44
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 95.44
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provisiona 95.41
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 95.4
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 95.38
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 95.34
PRK08840464 replicative DNA helicase; Provisional 95.33
COG0410237 LivF ABC-type branched-chain amino acid transport syste 95.32
pfam0288177 SRP54_N SRP54-type protein, helical bundle domain. 98.78
smart00382148 AAA ATPases associated with a variety of cellular activ 98.58
pfam09140261 MipZ ATPase MipZ. MipZ is an ATPase that forms a comple 98.51
cd02042104 ParA ParA and ParB of Caulobacter crescentus belong to 98.27
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 98.25
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a variety 98.11
PRK06067241 flagellar accessory protein FlaH; Validated 97.91
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 97.9
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 97.89
cd01394218 radB RadB. The archaeal protein radB shares similarity 97.85
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 97.83
COG2805353 PilT Tfp pilus assembly protein, pilus retraction ATPas 97.81
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 97.81
PRK09302501 circadian clock protein KaiC; Reviewed 97.78
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.76
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 97.73
cd02034116 CooC The accessory protein CooC, which contains a nucle 97.72
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 97.71
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 97.67
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 97.66
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 97.63
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 97.56
pfam08433266 KTI12 Chromatin associated protein KTI12. This is a fam 97.46
pfam03266168 DUF265 Protein of unknown function, DUF265. 97.43
pfam00154322 RecA recA bacterial DNA recombination protein. RecA is 97.43
PRK05342 411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 97.4
PRK12402337 replication factor C small subunit 2; Reviewed 97.39
PRK10436461 hypothetical protein; Provisional 97.38
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 97.37
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 97.35
cd03116159 MobB Molybdenum is an essential trace element in the fo 97.34
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 97.33
PRK04195 403 replication factor C large subunit; Provisional 97.29
PRK00313332 lpxK tetraacyldisaccharide 4'-kinase; Provisional 97.29
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 97.27
KOG2878282 consensus 97.24
PRK07952242 DNA replication protein DnaC; Validated 97.23
PRK06835330 DNA replication protein DnaC; Validated 97.23
PRK08233182 hypothetical protein; Provisional 97.22
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 97.19
pfam02606318 LpxK Tetraacyldisaccharide-1-P 4'-kinase. This family c 97.18
PRK13695174 putative NTPase; Provisional 97.16
PRK00652334 lpxK tetraacyldisaccharide 4'-kinase; Reviewed 97.14
cd00983325 recA RecA is a bacterial enzyme which has roles in homo 97.1
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 97.08
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 97.08
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 97.07
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 97.05
PRK01906339 tetraacyldisaccharide 4'-kinase; Provisional 97.02
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 97.0
PRK11823 454 DNA repair protein RadA; Provisional 96.99
PRK09302 501 circadian clock protein KaiC; Reviewed 96.97
PRK08116262 hypothetical protein; Validated 96.94
COG1066 456 Sms Predicted ATP-dependent serine protease [Posttransl 96.9
PRK00411 394 cdc6 cell division control protein 6; Reviewed 96.88
PRK12377248 putative replication protein; Provisional 96.87
PRK09354350 recA recombinase A; Provisional 96.86
KOG2004 906 consensus 96.81
pfam04851103 ResIII Type III restriction enzyme, res subunit. 96.77
TIGR02903 616 spore_lon_C ATP-dependent protease, Lon family; InterPr 96.74
pfam05621302 TniB Bacterial TniB protein. This family consists of se 96.57
PRK05595444 replicative DNA helicase; Provisional 96.56
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 96.55
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 96.5
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 96.45
TIGR01085 494 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterP 96.44
COG3598402 RepA RecA-family ATPase [DNA replication, recombination 96.43
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 96.42
COG1484254 DnaC DNA replication protein [DNA replication, recombin 96.33
PRK06762166 hypothetical protein; Provisional 96.31
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 96.3
PTZ00035350 Rad51; Provisional 96.29
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 96.26
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 96.21
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 96.17
COG4152300 ABC-type uncharacterized transport system, ATPase compo 96.17
PRK00279215 adk adenylate kinase; Reviewed 96.17
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 96.12
PRK07429331 phosphoribulokinase; Provisional 96.12
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 96.08
KOG1533290 consensus 96.06
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 96.06
PRK02496185 adk adenylate kinase; Provisional 96.05
COG4555245 NatA ABC-type Na+ transport system, ATPase component [E 96.05
pfam00406186 ADK Adenylate kinase. 95.9
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 95.89
pfam00931285 NB-ARC NB-ARC domain. 95.87
TIGR00382 452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 95.83
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 95.82
pfam00625182 Guanylate_kin Guanylate kinase. 95.78
PRK08694468 consensus 95.72
PRK00139 481 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diamin 95.67
PRK12422 455 chromosomal replication initiation protein; Provisional 95.63
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 95.62
PRK06921265 hypothetical protein; Provisional 95.62
pfam09848 348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 95.59
pfam00265175 TK Thymidine kinase. 95.56
COG1663336 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope 95.55
cd01128249 rho_factor Transcription termination factor rho is a ba 95.49
PRK00300208 gmk guanylate kinase; Provisional 95.4
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 95.37
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 95.37
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Transcript 95.37
PRK06904472 replicative DNA helicase; Validated 95.36
PRK09165484 replicative DNA helicase; Provisional 95.34
PRK00149 447 dnaA chromosomal replication initiation protein; Review 95.34
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 98.33
PRK06526254 transposase; Provisional 97.84
PRK09183258 transposase/IS protein; Provisional 97.81
TIGR01967 1320 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IP 97.76
PRK08181269 transposase; Validated 97.57
TIGR00450473 thdF tRNA modification GTPase TrmE; InterPro: IPR004520 96.08
COG1341 398 Predicted GTPase or GTP-binding protein [General functi 98.05
TIGR02397 363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 97.77
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 97.69
PRK10875 607 recD exonuclease V subunit alpha; Provisional 97.67
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 97.46
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 97.3
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 97.13
PRK06305 462 DNA polymerase III subunits gamma and tau; Validated 97.08
pfam05970 418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 97.04
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 96.98
KOG0926 1172 consensus 96.7
PRK01184183 hypothetical protein; Provisional 96.55
TIGR01447 753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 96.3
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 96.0
PRK13889 992 conjugal transfer relaxase TraA; Provisional 95.78
PRK06090319 DNA polymerase III subunit delta'; Validated 95.77
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 97.51
PRK04301318 radA DNA repair and recombination protein RadA; Validat 97.42
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 97.15
PRK07413382 hypothetical protein; Validated 96.45
PRK07940 395 DNA polymerase III subunit delta'; Validated 97.41
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 97.36
PRK03992390 proteasome-activating nucleotidase; Provisional 96.02
TIGR02928 383 TIGR02928 orc1/cdc6 family replication initiation prote 97.39
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 96.15
PRK05858 543 hypothetical protein; Provisional 95.68
PRK12337492 2-phosphoglycerate kinase; Provisional 97.27
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 97.24
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subun 96.28
TIGR00390 463 hslU heat shock protein HslVU, ATPase subunit HslU; Int 95.96
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 97.13
cd01881176 Obg_like The Obg-like subfamily consists of five well-d 96.85
PRK13766764 Hef nuclease; Provisional 96.56
PRK07560730 elongation factor EF-2; Reviewed 95.62
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 96.17
pfam00205138 TPP_enzyme_M Thiamine pyrophosphate enzyme, central dom 95.46
>TIGR00064 ftsY signal recognition particle-docking protein FtsY; InterPro: IPR004390 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein; InterPro: IPR004780 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54; InterPro: IPR006325 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , Back     alignment and domain information
>KOG0780 consensus Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0781 consensus Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK10416 cell division protein FtsY; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>pfam00448 SRP54 SRP54-type protein, GTPase domain Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>pfam07015 VirC1 VirC1 protein Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information